2GM3A

Crystal structure of an universal stress protein family protein from arabidopsis thaliana at3g01520 with amp bound
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
171
structure length
153
Chain Sequence
b'PTKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVSIYASPEDFRDMRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEVKRVRPDFLVVGSRGLGTVSAFCVKHAECPVMTIKRNADETPSDPADD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown protein
molecule tags Structural genomics, unknown function
source organism Arabidopsis thaliana
publication title Crystal structure of the protein At3g01520, a eukaryotic universal stress protein-like protein from arabidopsis thaliana in complex with AMP.
pubmed doi rcsb
total genus 46
structure length 153
sequence length 171
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2gm3A00
4ZT3A 2V0CA 4QBTA 4ZCSA 3TS1A 1T9GS 3ND5A 3A2KA 4YBRA 4MUKA 3D6VA 5TEWA 4BWVA 1GN8A 3CVXA 3G6KA 1K4KA 2Z08A 2D5BA 1EJ2A 1Q15A 5TEVA 2B7LA 4MVCA 5H7XA 4MW6A 1EFPA 3RHSA 3P0JA 1JILA 2QUJA 1GLNA 3PNBA 1ZUNA 3UMVA 1O95D 4MWCA 1FFYA 1WQ4A 4YP5A 1JMVA 4NZPA 3PNVA 1KR2A 1O97D 1Q77A 1NI5A 2DPLA 3U1VA 2VTBB 1NUQA 4OUDB 1JZQA 3VU8A 4MWDA 1ZH0A 4XSVA 2IJGX 1K97A 3SDBA 3KFLA 3LOQA 1GPMA 2DERA 1QJCA 3IDFA 2D13A 3VRHA 5K0SA 5TS2A 1U7DA 4MLPA 4AQ7A 1ZJWA 2QJFA 3AG5A 3KT8A 4MUNA 4EG1A 2JAXA 1J70A 3UY4A 2WQ6A 1FYDA 1O6BA 3P0HA 4DE5A 1O97C 4AS1A 4UZFA 1QQTA 1IRXA 1EXDA 4MQ6A 3TNJA 2J4DA 4MW4A 2D54A 2CYBA 3K32A 2BYTA 5TGTA 2CUZA 1IVSA 4KR7A 1NZJA 1O5TA 2QUKA 5DEOA 5F23A 1J09A 5J58A 2CV1A 1TYBE 2GKSA 4J75A 1WZ2A 4MW0A 1H3EA 3BL5A 3MLBA 4I6GA 3TQOA 2J09A 3CLUD 3ZIUA 2XRZA 4MW9A 5HG0A 2QJTA 1TYCA 3IH5A 1TFUA 2VXOA 5KHAA 1Y42X 3VGJA 3QE4A 4G5YA 4Q93A 3Q12A 2J5BA 3IVGA 3K9WA 4ZT7A 3RFFA 3CA8A 1OBHA 4K0RA 1MB9A 3FH0A 3AFHA 4YP7A 5KCMA 1COZA 3S3TA 3IVXA 3PRHA 4P2BA 3ZUGA 1X8XA 3UC5A 4XFDA 1P7PA 2IELA 4QRDA 5H16A 1OWNA 1QU2A 4HK4A 5KWVA 1IQUA 1I2DA 4GU5A 4I6EA 4G6ZA 3KT6A 3IMEA 4UZEA 3X1KA 2PXHA 1LW7A 1GTRA 3A04A 4JFAA 2PG3A 4JXXA 1U3DA 3CLRC 4U8HA 1JECA 3AKZA 1WJGA 2V0GA 4QREA 1ILEA 1MC1A 2YWBA 4ZCPA 3N05A 4I6JA 4ZCQA 1WQ3A 3RK0A 4MUIA 2ZUFA 1KH2A 3P0IA 2QUIA 2IP1A 2PIDA 2I1LA 5FO0A 3RJZA 1F7VA 4U63A 2QTRA 1M8PA 2RD2A 3TZEA 3GLVA 2YXNA 3IOBA 1VBMA 3CVVA 1I6MA 1PFWA 1WXGA 2OV4A 1WXEA 3N2YA 4ND6A 4EG5A 2J07A 4EG7A 4WNYA 3ZJUA 1EE1A 1MBZA 3SZ3A 2AKEA 4EG3A 2Z3VA 3RBAA 3AG6A 1NYLA 4MVYA 3FG9A 3G5AA 2EL7A 4F3RA 1TYDE 2YWCA 3FWKA 4S1OA 3ISJA 1YI8A 4MVXA 4L2IA 3E27A 1N2JA 2JANA 1UFVA 4TS1A 1U3CA 3C8ZA 1RQGA 3Q4GA 2PZ8A 3L93A 4NDAA 1N2HA 3ZXSA 1G8GA 2A1UB 4E1AA 3FIUA 1U7XA 3DV2A 1K4MA 3TZLA 2GOYA 1O94C 3DPIA 3CLSC 1JIIA 2AG6A 3N9IA 2A7XA 4ND7A 1H3NA 4ZCRA 5LLTA 3CVWA 1QU3A 4MW7A 4JYZA 1VBNA 3NBAA 1JGTA 1IHOA 3LE8A 1N2EA 5IHXA 4JZYA 2WQ7A 1MJHA 2CT8A 3COWA 3D6UA 3ELBA 1PFVA 1PFYA 4RPIA 3X1JA 3ZJVA 3FI0A 1KH3A 4YMIA 5J59A 3QTBA 1J20A 2R5WA 1HYBA 3MUEA 4EGAA 2CSXA 1XNGA 4DJAA 3COVA 5FO1A 2E18A 3INNA 1N3LA 1KP2A 1YUMA 1EFVB 2QUHA 2QTMA 4EF6A 1J1UA 3PXUA 3MMXA 3COZA 1JIJA 1WOYA 4PBRA 2CYAA 3IOCA 4MUFA 1N78A 1XNJA 1NP7A 1EUYA 4ZCTA 5FNZA 1O95C 5DK4A 2CV0A 2CFOA 2A88A 1KQPA 3DO8A 3UK2A 1T6ZA 3H9BA 3CVYA 2C5SA 4MWEA 2PFSA 1V8FA 3FHJA 3FY4A 3OP1A 4L2IB 4J76A 3HGMA 3IUBA 1WXHA 1KORA 1OWOA 3HL4A 3IMGA 4CDMA 3HV0A 3HFJA 3I05A 3IUEA 1J21A 4CT0A 4A91A 4KPUA 1OBCA 3AL0C 4NX2A 4NATA 3AIIA 4HPWA 4F4HA 3ZJTA 1TEZA 2TS1A 2BTEA 3GMIA 5IJXA 3P52A 4ZT2A 5K0TA 1IFXA 3ILVA 1M83A 1T6XA 4CDNA 2HGZA 4WSOA 1IH8A 1PG0A 2H2AA 1NURA 4ZT4A 1KH1A 3CR8A 1KAQA 1LI7A 4NAUA 3ND7A 4MUJA 1SURA 1WXFA 3CLRD 2QJOA 3FNRA 4R2MA 3G59A 3NBKA 1Q11A 2G36A 4MW1A 4FZJA 3L92A 4PBTA 1VBKA 3HMQA 2CYCA 1S4MA 3NV7A 4MUHA 3UOWA 1EFVA 2YY5A 3F3MA 2ZUEA 4NAHA 1O94D 3IOEA 2X1LA 2E21A 1Q19A 2NZ2A 2DLCX 1DNPA 1WY5A 4DDHA 4ZT6A 4OJMX 1O96B 2OQ2A 4R2LA 4MW5A 4EG4A 1M8FA 4KKVA 5J5AA 4U7JA 1T9GR 1MOPA 1N2BA 3Q10A 3H97A 1I6KA 1PG2A 4MWBA 1OWMA 3MLAA 3H05A 4RUKA 4EG8A 4PBSA 2O8VA 4DDKA 2DETA 2X0KA 1NSYA 3LCJA 1D2RA 3CVUA 4JXZA 3A05A 2X1MA 1R6XA 3ZGZA 2A1UA 1MB2A 1F4LA 1NUSA 1U0BB 1WKBA 1H1TA 4GRIA 1YIDA 2H29A 2X3FA 1YULA 1XJQA 3SZGA 4DNXA 1QTQA 3A4IA 4MAFA 1JEEA 1EUQA 4KPUB 1JZSA 3FETA 1GZUA 1ZH6A 3DLAA 2RE8A 2CV2A 1TYAE 5HUHA 2A1TS 1OD6A 1QNFA 2O5RA 4MULA 1V47A 2DR2A 3SP1A 1KP3A 2Z09A 1J1ZA 1VLHA 4KR9A 2AZXA 2PZBA 1CT9A 2WSIA 1M8GA 1MAUA 5BNZA 3OTWA 3PNYA 4ARCA 3COYA 4YP6A 1B6TA 2XRYA 1KAMA 1LI5A 3MXTA 3ND6A 3IVCA 3CLUC 1QRUA 4X0EA 1GAXA 1T6YA 2GM3A 1KKUA 3GUZA 1JHDA 4MW2A 3SEQA 3JXEA 2NSYA 1NUUA 1G59A 2J08A 1MRZA 1N75A 2A1TR 3CLTC 1N2GA 5AHWA 5DB4A 3N8HA 4EG6A 3CLSD 1WXIA 3KT0A 1XNHA 1O96A 1VL2A 1O0BA 4HJRA 4KR6A 4DDMA 4XFJA 4CQNA 4Q16A 1G8HA 2HZ7A 3H99A 3IMCA 2DXIA 4MVWA 2VTBA 3SYTA 5LFAA 4OUDA 4R0NA 4G5FA 4EFKA 3ZXIA 4DLPA 3IODA 1I6LA 1QRSA 1BS2A 3H9CA 3KT3A 1OWLA 3QTTA 1N2OA 2E89A 1MAWA 1G8FA 1N2IA 5DASA 1OWPA 2ZP1A 1NUTA 2HMAA 1K92A 4ARIA 1ULHA 2A86A 1TQ8A 4ZT5A 1F7UA 1N77A 2PZAA 5JBNA 1JEDA 1N1DA 1KQOA 4PY2A 1PFUA 3HZRA 1NUPA 1GTSA 3FOCA 2WB2A 4MUEA 1JIKA 1X6VA 1YIAA 5LM3A 4K03A 1R6UA 1KQNA 2JA2A 1M8JA 2A84A 2A4MA 4HJXA 4MUGA 3FDXA 3CLTD 2EJCA 1A8HA 1O0CA 5EKDA 1R6TA 1H3FA 1F9AA 1M8KA 2QTNA 4H3SA 2DUMA 5HUJA 1IQRA 3M5WA 3RK1A 1YUNA 2DEUA 3TQIA 3X1MA 1IQ0A 2E0IA 1M1ZA 3SEZA 1EFPB 1QRTA
chains in the Genus database with same CATH superfamily
4IXNA 4WCFB 1F1JA 4E13A 1VE9A 3G9UA 4RAQA 2AXEA 4JLWA 4YGYA 1OBVA 1CW2B 4MWZA 4Q4HA 1E5VA 3V8PA 3ES9A 1HSOA 1HF3A 1RKVA 4TKUA 5IMBA 4CLRB 5LJIA 1N3IA 1D3AA 2NAPA 3JQDA 5EJEA 4A8JC 4DANA 4KE6A 4F8EA 2ZCJA 1RACA 2O7NA 3FPKA 1FLNA 5DSXA 3WRWA 3MTJA 2NX2A 3P0JA 2O6HA 4JKIA 1EG7A 1VSTA 1R15A 1GLNA 3F46A 2H52A 4QTXA 1E2PA 1K88A 4D7AA 4HYYA 4V03A 2RB5A 2A9VA 3HABA 3RJ9A 2I76A 3V4FA 4BVKA 2PZLA 1PJ4A 1XAGA 1OI2A 3VAZA 1J8VA 1FTYA 3RIXA 3RPEA 2CUKA 2I66A 3E22A 3ZKAA 4A6XA 4MR9B 3A1TA 4TYWA 2B5OA 2KPOA 4B6SA 1AT1A 1H2RS 2C99A 2VN8A 3JY6A 3MCTA 2D13A 4TRNA 1NE2A 3DAPA 3NHKA 4ZWNA 1FOEB 2CVZA 4YUYA 4MARA 3AG5A 3IAS6 4WZBB 4JBNA 4G5QA 4V0MA 2VYFA 4LMBA 2B1GA 3AF5A 5K51A 4DV0B 1SCUA 4O5OA 2A9QA 3HJAA 5ICCA 3H0CA 4AVYA 4IUDS 4DLSA 2R0QC 1KI6A 4BKMA 3HYSA 5HGJA 3LLMA 4AS1A 4YRMA 2CHFA 1B2LA 3TCNA 5EWJA 4BN4A 4C0LA 3Q3CA 4IDEA 4QUBA 4NJEB 5IYZF 4DS3A 4GI5A 1EXDA 3JQGB 2Q3DA 3U4GA 2JIQA 1LWOA 1E6MA 1TZ2A 2Z98A 2JCXA 2UUBB 4E5PA 2XZOA 5AVQA 2D54A 3EG9A 4E03A 3MHPA 1JEJA 2A5JA 2ASEA 3N2EA 4FCTA 4XR9A 3FNIA 3RSQA 2IYAA 2QM8A 1AUPA 2RGBA 2IHTA 4JJEA 1IVSA 3L49A 2JEYA 4UD2A 1N1EA 4NJEA 5J58A 1XN1A 2I6FA 4GKJB 3G0GA 2GKSA 2GPWA 4IOLA 5BR7A 3U4QB 3CH6A 5D86A 3HI6A 2NO0A 4I4CA 1OXVA 4RXTA 3CLUD 5JD3A 3FBWA 3RV3A 4TMXA 1JR3E 1WRBA 2ZUCA 4LN1A 5CRIA 1PR0A 2WFZA 2MMCA 4MDHA 4Y0AA 2ZT8A 4Y6OA 2F67A 5T4FA 1G38A 2JAUA 1D9XA 4PZPA 4ALKA 5B12A 1G5PA 2PX6A 4FX2A 4QHYA 1L7NA 2QTBA 3Q12A 5LB4A 4JI0B 1PJTA 2REQA 2Z5VA 4L0CA 4ZREA 1ACMA 2QGZA 3NJRA 4G85A 3V7FA 3ORFA 4CLOA 2LGJA 3K8YA 4EX6A 3QSGA 3VAYA 3P0FA 3FPHA 3I58A 4FOLA 4P3PA 4BNDA 4DBZA 1DBIA 2HO5A 1AB5A 4WA7A 2BFBB 1Y7PA 1DO8A 2GO7A 3H9QA 3ZKWB 4BO4A 3CIOA 3UA4A 2REQB 3GPIA 5DM1A 1OI4A 2XV1A 2BHSA 3FDIA 2WP8J 3AVYA 3VM6A 1P1RA 4OM7A 3SHVA 4X97A 5EXXA 2UXBB 4UE6A 1HTBA 1T29A 4QGHA 1RBMA 2JAHA 2QN2A 3HP4A 1ZUNB 5KB3A 4FMPA 4P98A 4DUGD 4K40A 1BHJA 1NC1A 2BGUA 1CHNA 5DHPA 4DC9A 1OAKA 3Q7RA 2YXDA 2GF9A 2IY8A 4M0EA 2WTUA 3KQPA 2R85A 4FZ3A 4JBGA 5DBFA 1SIBE 3KOUA 1HLGA 1QK5A 1ZHFA 4Q9IA 5DOZA 2M2IA 1FMLA 2YQZA 4DV2B 1MC1A 2ZRPA 3FFAA 1L4UA 1GLGA 2ZJ3A 5KPJA 3PL1A 5LOVB 2WG1A 5CDFA 3H6HA 1QB8A 1L5LA 4KRFA 2N47A 1U31A 3EZNA 3HRHA 3Q7QA 4KWTA 3VU9A 1S0UA 4CMGA 1U7WA 1MQAA 4ZHQA 3RIEA 4BBPA 4Q3NA 4NF2A 4C3OB 1WMEA 4KHPB 3ADOA 3LKDA 1FEZA 4ETMA 2OHHA 3WKCA 2I33A 3ZJUA 4TQ9A 2YHIB 1M0WA 1W19A 3EXEB 1K9VF 4BGEA 2WDPA 1GAQA 2R8EA 2Z3VA 4UAUA 1X7ZA 5SZIA 2ZSIA 3USCS 1EQ2A 1Q7CA 2Q4DA 3LWNA 3NC4A 4C20A 5IAAA 2C4UA 3VU9B 1NY6A 1K5HA 5FD8A 1UH5A 1NVVR 3ACBA 1JIXA 3FWKA 4BQOA 4S1OA 1W85A 3G02A 3QU5A 4E32A 2XEDA 3N70A 4PGAA 1SZPA 2E4UA 2WPNA 3NKLA 4JJ6A 5F5NA 1ID8A 1MT0A 1FDWA 4XPIA 4NZZA 1BGWA 3WMXA 1UWKA 3W2HA 1SZJG 1GRQA 4DR3B 1EA7A 3S70A 1AHPA 5I7EA 2VJNA 3C16C 5IWCA 3WQQA 2HDOA 4J6EA 1BXKA 4B17A 4ABYA 5AKLA 1HETA 4K2AA 4BC0A 4D56A 1N9ZA 4U2BA 1XYVA 3IAXA 2PUEA 1KI9A 4HNGA 4RIFA 4AMBA 3RFVA 2AN3A 5JUWA 3QKSA 1OFHA 4H7IA 1GNRA 2JLZA 2VJKA 2QR2A 4Y6GB 3V9PA 2AMYA 1VYHA 3IJEB 4QARA 2QAJA 5E95A 4LFAB 3Q5GA 4W5TA 2CXOA 3IR7A 4MRNA 4C2AA 1RWWA 3CZMA 4MAMA 2BBTA 3H1GA 3K9QO 3E7XA 3LUKA 5JAZA 4X61A 3ELBA 3RASA 1K8XB 1UJMA 1VMKA 1IHXA 2FZCA 4OF4A 3P27A 1AZLA 1CJKC 3QTBA 3UM9A 1X2BA 4QYXA 2R5WA 4H77A 4L9RA 4YMLA 5AJVB 3VO9A 2WPDD 2O06A 3D6FA 3EB9A 1NFRA 1SVSA 1L6IA 3KC2A 4FFVA 2J3IA 1MEOA 2F1JA 4RTRA 4KGZA 2Z04A 1I80A 1ZOIA 3CFYA 5EHGA 1G5HA 3CEMA 2LE0A 2YV1A 4NJMB 4ARSA 3N8GA 2YIMA 4DV1B 3O6VA 1MX5A 1ODSA 1JSRA 3BD9A 1O77A 4X91A 2A9JA 2ATVA 1BEZA 1PS8A 4FDVA 1CHDA 1O6CA 4Y9UA 2RK4A 3LHIA 4Y2QA 4WW0A 1NQ5A 1GUBA 2I0FA 3COJA 2H11A 1ZM2A 1O2DA 1OHHD 3BFKA 4NARA 2G5PA 3P9XA 4J16C 3CZAA 3KXKA 1B43A 4KBYA 1BRMA 1ETUA 2RAUA 2XYVA 2ZJ0A 2N0SA 4GC5A 2GCIA 4JI6B 3TDKA 4BNUA 4F85A 5IASA 2GHQA 4M8SA 4WZAB 2PDAA 1DAFA 4RH0A 1EK6A 4NC9A 3S55A 1QHGA 2QBYB 3WAGA 3O95A 2PSDA 1ND5A 1U1IA 2IXFA 3DE0X 5BSUA 5DX8A 3FY4A 4EY3A 2J41A 1USWA 1O5IA 1VLMA 2VDUE 3FZQA 1OWOA 3N2GA 4YALA 4JOSA 5KREA 2ZJ5A 3HB0A 3GEHA 5E3HA 4AKHA 1AQNA 2VXBA 2PK3A 2JD2A 3OZSA 4YB8A 4I55A 3NAQA 3TE6A 1Y9EA 3ROEA 5BN4A 3JSAA 4F6RB 3U60B 2EARA 1I30A 3ZJTA 1C41A 2C8JA 3ISTA 3JQAD 1VP3A 4GSKA 5I7SA 5JQGA 2VPWA 1V8PA 2AFIA 2XB8A 3BC1A 3MGGA 2PY6A 16PKA 4J8PA 3TJMA 5HK8A 1M83A 2UU9B 4IJKA 1Z5GA 2QYHA 3GK3A 2G7MC 3NGLA 1XZIA 4EJFA 1K3UB 3J81k 5FI0B 1EFDN 3KSAC 1MTOA 3TWOA 1AQYA 3HXTA 1YR3A 2PBRA 3DDNA 4G5SA 4MGEA 5AK5A 4DNOA 5JSFA 3JQBC 1PD1A 1QLHA 3KZXA 4LUCA 1A77A 4YAGA 2GT1A 3B82A 1H2AS 5DHTA 4JT9A 3I3OA 1TMYA 2WUDA 1Q5PA 2YNMA 5DH9A 5HDQA 1CY0A 4ZGBA 1T6NA 2W2MA 4YRRA 4E5DA 3HKEB 3OPQA 2NPFA 1CEQA 1G5FA 4WFJA 3FKSD 4F4IA 1DRWA 3DAGA 1BQEA 4F84A 4U7HA 1FRVA 3NFYA 4IJMA 3FNRA 3NIBA 1SR8A 1U5BA 2AWOA 1FFAA 2ZSEA 2WIKA 4EVIA 1V5GA 2X0FA 4CKCA 3NBKA 3C6ZA 3REQB 1DO2A 1DKQA 4R1QA 1K3FA 4ZZ2A 2NUPA 3AHCA 4LK3A 1EP1B 3TB6A 1HL7A 4LDNA 1PIWA 3PFFA 4MVJP 3QYFA 4GKKB 1PKXA 4FGSA 2YVUA 3IBTA 2YY5A 3BFVA 4KI7A 4QX6A 2ORIA 4W5JA 5TT0A 4PE5B 3GHYA 4Q0MA 3WS7A 3AWIA 3QP9A 1TD1A 2DSTA 3IPLA 5EUBA 1JR2A 1BMQA 1T15A 3IQXA 1M1YA 3G2QA 5J5AA 1I10A 5A4MS 5I7VA 2HU8A 3HDGA 1YVPA 1GD1O 2GDJA 3G3EA 3BL6A 3D81A 1NG1A 1NI3A 3H97A 1FYVA 4JIGA 4ZOAA 4RUKA 3T61A 4WJLA 3G13A 3KLPX 4DCPA 3H16A 3OLYA 5AIBA 1NQWA 3DT6A 4DMFA 3DDZX 4AUKA 2H8GA 1NSYA 4UU8A 4EECA 4Q3CA 2WR8A 2NVUA 2AT1A 3GP3A 2P62A 5SV2A 1G60A 3BH0A 4DA7A 2BIFA 2WZCA 4IY1A 1WSWA 1C3XA 2A1UA 2Y27A 3QVUA 4J0GA 3D0OA 3HO6A 1N3BA 4KWEA 2CCJA 1KXJA 4N3BA 3WNCA 2IBSA 2W83A 4I8XA 3B2EA 5ALGA 5EVJA 2FSIA 5B2ZA 5IM4F 1L4YA 2A57A 2VDLB 2Q7DA 3MJVA 2LR0A 5IH7A 3QOFA 2VJCA 5A71A 4UOEA 4LVNA 1W94A 1ZI9A 2JCVA 2XMDA 1I8TA 2C4WA 1MB0A 5DYTA 3FETA 3QJ5A 3A1CA 2XMCA 4TWIA 4JLAA 4YWHA 3ICEA 2CHQA 5ALOA 1TYAE 1UFOA 1K08A 1V6SA 2JJ2A 4FR0A 4RVNA 3EA5A 5ALYA 5TQ2B 1C0KA 1BVUA 1TRKA 4Z86A 2ANCA 2JVJA 3W8FA 5BV2P 3C7TA 4WKPA 1KQ3A 5GONA 4HAYA 3C1TA 4DYVA 4C7OB 3QVXA 4UEQA 3VPBA 3Q6MA 1U1FA 2DCUA 1F20A 3QX7A 3RRFA 2NU8A 1Z29A 2XAUA 1Y8QA 1OTHA 2XUHA 3E9YA 4JMPA 3R6LA 4ARCA 2OC4A 1CJMA 3TD9A 4Q4DA 2C3UA 1N4DA 2XCOA 1JVBA 3AP3A 1BH2A 2ZT7A 1DIAA 1UZLA 2VP2A 1WXDA 4JP8A 3QM1A 5E7JA 3FLEA 3MQFA 1VL0A 3QFSA 4FQ5A 5BYJA 4DADA 1FUKA 3WJ7A 2R6R1 4BLTA 3VUFA 3SQDA 4JLJA 1KFJB 2CXXA 2PPVA 3HU5A 4PWYA 4RY8A 4WOBA 3NWOA 1WP4A 1ONSA 5BUQA 1CEEA 1PJAA 4V0LA 3BIXA 4YK7A 4BVHA 3RAEC 1QZUA 5DRTA 3NHLA 2TMKA 2O8NA 2ZYDA 2A1TR 3D8SA 2I80A 2VP9A 5DN6D 1V1MA 3G2HA 2I7DA 4LGCA 2EJWA 4EKDA 4I2VA 5EE3A 2BCJQ 1YZTA 2WKPA 1E2DA 2O9JA 3NTRA 4M86A 4HJRA 5AK0A 1MW8X 4XFJA 1AKWA 3SWWA 1JQKA 1ZNXA 1M5TA 2VNHA 2KLHA 1X0XA 2SKEA 1O5OA 4C08A 4PRZA 4RHCA 2OOSA 1YRAA 1R8JA 3Q3HA 3C85A 2VI5A 5EESA 3OOYA 2CLCX 3HUFA 3NHRA 4KW7A 4HLUA 3S6JA 5L3SA 1GVNB 5HM8A 5C52B 2FQQA 2GEFA 1W8IA 1Z0ZA 3OD1A 3PJFA 1JJAA 2MIIA 1XTIA 4ZC8A 5JS8A 3HXPA 1NU8A 3FOBA 3Q5DA 5KI6A 3B70A 3DEKA 4HVAA 1QP4A 2Q2OA 5BN3A 1VKZA 5I7FA 3KL4A 2Q21A 1R6BX 5K0GA 3IDAA 3M6LA 4X7BA 2IEBA 4DEXA 1E6CA 4B6JA 3RSSA 4JB3A 3D0RA 1RXUA 2RSLA 4LRSB 1CIVA 4QT0A 5ALTA 1FNBA 1M7HA 1JMYA 1UPUA 3GFPA 3HKBB 4FOPA 2FCRA 1LBTA 5B7GA 1QIIA 4FD2A 5JBNA 2HF7A 2OENG 3G7SA 5IVHA 5JTTA 4FLMA 3SICE 4B3TB 2BEWA 3RROA 1I4TD 2AN4A 1EVQA 3EXG2 1N8NA 3G5LA 1C9NA 1F6WA 2ENUA 3VISA 4D44A 5CDYA 5JV5A 3W5DA 3F3YA 1VGQA 3WHIA 2RC6A 1OXTA 5CU7A 5H83A 4N3GA 1O57A 1M8JA 1BGVA 1WEKA 1Z5OA 3B89A 4N5IX 4B7ZA 1BHQ1 4HPXB 1YA6A 4IX1A 4HGQA 4U0JA 4BE4A 1VYVA 4RKWA 2CLHB 1IDOA 3L4BC 2VHVA 4WK4B 1JDBB 3OT1A 5DE3A 1GNQA 2WTNA 5JSKA 2GYUA 1IQRA 3IERA 4MPTA 2WJZB 2COKA 4FOTA 1JN0A 1EX7A 3BYZA 4FDTA 1U7HA 1EFPB 1PT9A 4G2NA 4OHBA 3LLSA 3QENA 4JUFA 2J85A 4J1SA 3GLSA 4LI3X 1YL7A 3T3GA 4ZMBA 2DMRA 3TAHA 3U5TA 3IE0A 2V0CA 4M8LA 2IW1A 2HPZA 2QTVA 2BSAA 2ZRFA 4Q21A 3EGVA 3G0OA 3HU1A 3B3JA 3LWBA 4UC0A 3ZIDA 5EHZA 1FW6A 1GZ6A 4LWOA 2XUZA 1G64A 3D6VA 2PRIA 3GQBA 1JKJA 2FWIA 1LSSA 2HY7A 2GLXA 3QHAA 1AE1A 4OK5A 1E18A 4MYHA 1L7RA 1W5AA 5IARA 1RE0A 5JOQA 1T9HA 1E2NA 3LA8A 3H2KA 4DLLA 4N12A 5AVWA 5FHRA 5FBHA 1IN5A 2GFIA 3BMQA 2QUJA 1YR9A 2HA3A 1E3WA 4MICA 4YFYA 4JSYA 5KMGB 1REQA 2Q1TA 4KLAA 1AQUA 4EHHA 2V98A 4KMOA 1L5WA 1UWLA 4ND8A 3ZV3A 4MS4A 1YXMA 2OFWA 4UVDA 3A6FA 4IHQA 1SBCA 1Q1QA 3HPQA 1KERA 2OB1A 1DTWB 1KIMA 3AHJA 2HX1A 2ZIFA 4YRLA 3TL6A 4YRZA 4JI2B 4K9NA 2F4VB 2P9CA 1ZN2A 3GFRA 1Q21A 3IIKA 1W87A 2PT9A 4IIEA 4KDCA 4WINA 3L1UA 5C8YA 3RF7A 4UJ3A 5F64A 1HBJA 5B7QA 1F2TB 2CL0X 3D54D 1SU8A 4GYKA 4KOAA 3ZHBA 2LVBA 2PGNA 4DEYA 4EHKA 4MKRA 1H05A 2V97A 3MTIA 4DSUA 3M6VA 4N7BA 5I9LA 5EXPA 2O52A 4QXPA 4HF7A 3UPUA 3PQ2A 3I4FA 4PCAA 3E3LA 5AJWA 1O97C 4L0MA 4MAAA 2OD2A 4YUWA 4KO1S 5K09A 1DT5A 3FWHA 4XRGA 1Y8CA 2BELA 3HJRA 4ECAA 4MQ6A 3WYDA 4OUKX 4JC5A 3KD2A 4IMRA 5CLJA 1SKMA 4Z9FA 2Q5EA 2WIBA 4QDTA 3T34A 4Z4CA 4ZAYA 4Z7OB 2QJWA 3VR4D 1IY1A 4IYRA 4TLAA 1ZYUA 2HRRA 1STOA 2BYTA 2FEPA 3F78A 4P0QB 3GYGA 4X6YA 3NHBA 5AKGA 2ZUTA 4N6OA 5C5CA 4B40A 2QMEA 3PXCX 1KFKB 2RGAA 2X3UA 4LYAA 1VP9A 1P0QA 1QV9A 1UT8A 2FZEA 4LG1A 5KYUB 4Z4EA 2BHNA 1SFRA 2H1CA 4LZNA 4DCJA 1YC5A 4PXAA 3RBVA 4ZQIA 1MVOA 3CJTA 4XDZA 2WJ3A 2XRZA 4CEHA 4KGVA 5C3UA 1TVEA 1PNOA 2YBEA 4G0ZA 4ZAVA 4B09A 1E3JA 2OCIA 2NT4A 3DVRX 3VXKA 3TNYA 4PHHA 3TK1A 2R6FA 4HQOA 3Q7EA 4WBSA 1O94A 3NB0A 2JPDA 4IQ0A 4BGUA 3EDMA 2R4QA 4L3WA 2IKQA 2R68A 5K6TA 1B15A 3DE5X 1M34B 4OGFA 5T6MA 2FZGA 3WNBA 3ASYA 3H2SA 2Q6OA 1ORDA 4KDFA 1B1CA 3T7TA 1WV0A 3B9RA 2NTNA 3IP7A 1EK2A 1LH0A 1IBMB 2GBPA 4DTCA 1NVBA 1B16A 1P3JA 4M7WA 2XWBF 3UC5A 1HFEL 1VDZA 3JU3A 3QKRA 5JQGB 2VAXA 1OWNA 1X3SA 2WM8A 3UYKA 4JLUA 4CM7A 4P3XA 5CM8B 1BDMA 2B2NA 3LNCA 1JXAA 3NI2A 3RG2A 1PL6A 1SEPA 5IUKC 5HUQA 3CRVA 1XNRB 3FNHA 4RU1A 4BWYA 2GTPA 2IZ7A 1DJOA 1M9NA 4QICA 4JKYA 3X1KA 1D09A 1P0FA 4B3JA 1LW7A 1QHFA 2O0KA 3AK4A 3LT1A 1EH5A 3OCUA 4JFAA 1L4HA 2H5IA 2I87A 3Q11A 4O1HA 1W4LA 3RSHA 3VPFA 5IM4A 1QFMA 5AQ1A 4IWXA 3VPCA 2HNKA 3A6DA 3UMGA 2ESRA 4JOBA 1KYQA 3L7LA 4Q03A 1YZHA 3D6JA 4LC1A 5LYJA 2XOKD 1QGUB 1ZVJA 3IDSA 3RU3A 2OV8A 4R5HA 3DQZA 4XB1A 3F6PA 1YO6A 4MA4A 4ZCPA 4CLXA 4EPVA 1GCUA 4JWTA 1WBBA 1LA2A 3FAKA 2PIDA 3RJZA 2JFXA 3JQBA 3ORRA 2P75A 4K6HA 2FQWA 1PD0A 3EXIA 3FAZA 1FDRA 1UJCA 2OAP1 2R48A 3G8CA 2VAMA 1VHWA 4D9EA 1QG4A 1AKRA 3N2YA 2J07A 3LZDA 1IZ9A 1EE1A 1WO8A 3KEOA 2FPWA 4K9PA 2GN2A 2QN3A 1E1QA 2BBWA 4E51A 1NYLA 1W29A 2DFLA 4WZAA 5E7IA 5AVOA 4I1OA 4CMAA 2X6RA 4O5AA 3NMUF 1HDGO 3HR7A 3TOVA 4BECA 2AOUB 3SIRA 2WMNB 5TGZA 3QLUC 1MPXA 3LX5A 1M6YA 1B8UA 4EHFA 1YA8A 4CM4B 1PDWA 4UW9A 4ROSA 4IDNA 5KDDA 4NE7A 3O0DA 4OHZA 2GYVA 4HHEA 3D6AA 4EI2A 3ABZA 2I3ZA 3RYIB 2ATEA 4FZ5A 3GJTA 3VJKA 4E1AA 1U7XA 4LHYA 2XPCA 1E63A 1UK9A 2UYGA 1GARA 1MO5A 4PNZA 1ZICA 4WWHA 5B3KA 2JJ2D 2MR5A 3GPDG 3QQ5A 3DV9A 1W88A 1X2EA 2N46A 3DLTA 3N9IA 5HOEA 4LSMA 5IK2A 4H3VA 3I61A 1VYTA 4ZTUB 4LTNA 1QG2A 1DG9A 3MA0A 1S1MA 2PVPA 1N9GB 4FKZA 4HQLA 4MKFA 2LCQA 5KIAA 1M6EX 4I1YA 3L7CA 3V4RA 2Z4TA 3NM4A 1YH3A 5AIAA 1SOWA 5IEJA 4J4HA 2AJBA 2B8TA 4MGYR 1RIFA 1SD5A 2JLUA 3A6PC 2RGUA 3D6UA 1VGVA 2O2XA 3DKVA 3EF3A 3ZLTA 4RH1A 1R6VA 4IZOA 4YMGA 5EIEA 5H8WA 3X1JA 4GW3A 2UYYA 1HDRA 3HJUA 5JCZA 1A1SA 1A98A 3TMAA 4HB4A 2HJGA 2DJ5A 3NDIA 1I2BA 4DA0A 4M0LA 1S6YA 3CPJB 3MS2A 1E5TA 1K8YB 2X41A 3QLUA 3PXDA 4BNHA 2ZDGA 1N0HA 2UZAA 2NG1A 2XUJA 4X6LA 4F3CA 4WXYB 2PUJA 3NZEA 4XQGA 3WDLA 5K0BA 3I2KA 4FSXA 1U28C 3K9GA 2P2ZA 4KQEA 2VCEA 3NVAA 5L7TA 3HV2A 3IIMA 1U2GA 1G20B 4FHCA 5K5EA 1PJ8A 3MAGA 4NS1A 1R2QA 3ZK7A 4UBKA 1U0NA 2CFCA 2HK7A 1UM8A 3AESB 2JLYA 2BMAA 3C6MA 4RHEA 3WL3A 1DLIA 3GQVA 3PTZA 3UK1A 3UICA 3FPGA 1LJ8A 5DMXA 5ENZA 5BXYA 1VG8A 4HADA 1JDJA 1IJEA 1V8DA 1RXSA 1B3RA 1I0IA 3AUUA 2AUMA 2GAAA 3I0MA 4WFIA 3L8HA 4XAQA 1KMNA 2EYQA 2ZYVX 3NEJA 3OU2A 3V1TC 1YZ3A 4NIMA 3KOMA 3BZUA 1U2TA 1W1WA 2E5WA 1E6LA 2JZCA 1EUZA 4NMWA 2AMLA 2J7PD 4KPFC 2CLSA 1FVFA 2WDZA 3T5AA 1JQAA 3KHUA 1IG3A 2OO3A 2ZJBA 1PLKA 1SWVA 3G2PA 3Q0EA 5G0SA 4RVHA 3G8BA 5BR4A 2YS7A 5LUAA 2IZ6A 3M89A 1DUSA 3DLCA 2Y1CA 4RGBA 2FGKA 3HV0A 1E5DA 1P91A 3KWJA 4NFSA 3S2YA 4GWLA 4ZYWA 3LX6A 3WLRA 1X1CA 4FYPA 1ZS9A 3U37A 3S99A 4L85A 3KLBA 2BI8A 2ZXEA 3TR5A 2UXDB 1QP8A 2X42A 1HNZB 3PVCA 4E2XA 4F91B 3P52A 4ZOLA 4L4XA 5ER6A 3WLSA 3M9LA 5IPFA 2O54A 1HQKA 2EBHX 4OHOA 2PUAA 3CZPA 1RE1A 2C2HA 5I51A 5JNRA 1QS0B 4M0FA 1W0CA 4Y0NA 1U3GA 5EKSA 2Q3HA 3WMRA 1HLDA 1KOGA 1JTVA 4UUNA 1VKHA 3VH1A 5ESRA 3BE6A 4Q9HA 2HPHA 3PLAE 3PJGA 1RXIA 3B6JA 2EKQA 2ZETA 1RI3A 2WVGA 2W43A 2WB4A 2YWJA 2R8OA 4NAUA 5ALDA 3FKJA 3P97A 3ZE1B 3OZIA 4JU9A 3C3KA 1U3TA 2Q4EA 3I9KA 1XEXA 2FFQA 2QTGA 3KEMA 3P9KA 4M46A 1IMJA 3I04A 2ZUBA 4CMEA 3QVJA 4D9FA 2HMWA 2H2IA 1VJGA 3LQ4A 1IOVA 3N5CA 4BMOB 3K5HA 5D3ZA 2FG7C 4BQSA 1B6GA 2OXCA 2O0LA 4Z9YA 3ORYA 4GNKA 4IIVA 3V55A 2G9RA 5LQKA 2ZS8A 2QKYA 5CFQA 1JDVA 1NW6A 4M53A 1ZHHA 1EFLA 2YZGA 3BTVA 4OB8A 4XGRA 5GJCA 4MUHA 3U61B 2JGRA 3O91A 5AVSA 1JIUA 1SVOA 1P39A 2OZEA 3F3MA 3LD9A 3S2SA 5KTRA 3GJ5A 1GPWB 4OHXA 2QJRA 1OIWA 1M10A 3L84A 1HEUA 3GXOA 4YO7A 5FBVB 1IHPA 2NZ2A 4TWZA 4E22A 5BORA 1WY5A 2YTZA 2VPYA 3ITEA 3P4XA 4OJMX 2OQ2A 4PG4A 4DDHA 1EDDA 4HX9A 4L02A 1FMTA 2F1OA 2ZRNA 4MW5A 3JD0A 4EHIA 2V3CC 1DIHA 3W5CA 4KN9S 4OJTA 2IEYA 1N2BA 3ANMA 5FPQA 5M2QA 2GUGA 3B8EA 5L4LA 1RRMA 2ZR9A 2GCOB 3MLAA 1RKQA 1ZINA 1Q7BA 1Y37A 2GK6A 4D9NA 2FMXA 4EZBA 3AF6A 5DWQA 2HA2A 1CF9A 4MYRA 4E33A 2IEIA 1CEYA 3Q8KA 1WUIS 4CM4A 1BNCA 5KVVA 2H2GA 3MD0A 2YWFA 1L5OA 1T3TA 4M9QA 4D5EA 2G82A 2GCEA 5PGMA 5H3LA 1Z2AA 5ELXA 4HGRA 1QWSA 3S2FA 3BGSA 4N7JA 4CT4B 1U0BB 5EMNA 3F4LA 4ENSA 3SMQA 2QSJA 4KCGA 4W1QA 2HC9A 5JYBA 4DARA 4GLLA 4C0QC 3LCUA 2VRWA 3NBMA 3O2NA 2BEVA 3HLYA 2NADA 2JFZA 2P1RA 2NU9B 3RU7A 3NHZA 3SR4A 4PZZA 1R50A 1T5OA 1X7WB 3OZ7A 4LE2A 1M2VA 4GF5A 1RM4A 1I24A 2B83A 3H2GA 4HZGA 3ENQA 4NE2A 5AP9A 4E3WA 5JAMA 2RAVA 2X8AA 1AHIA 1CCWA 4HYEA 3MT8A 2VYNA 3SP1A 2EZ4A 1ZIPA 1TA0A 2Z09A 2PFGA 3C97A 3KYJB 2K2WA 4F6LA 1HL3A 3KFXA 1T4MA 2IDJA 5A1TA 4ZD6A 1GFSA 2PCLA 4QXQA 1XEAA 3HG7A 2O2JA 3L1KA 2OY0A 3OWOA 1JDNA 1TQ4A 4JLBA 5HXAA 3T4PA 2BZ1A 2IWRA 2A2ZA 1AUVA 2VLBA 3R4CA 4IGFA 3DZDA 4UM9D 3FHLA 4O33A 5A7GA 4ZK2A 1S2IA 4PX2A 2QX9A 1SXJE 1ICEA 3K0AB 4GBJA 2FDXA 1TC1A 1ZW1A 1E1YA 2EJTA 3C3CA 4NOJA 3NETA 3IEIA 1OZAA 4PC6A 4R8SA 3L05A 2J9FB 2BFNA 1JHDA 5CB4A 2HWKA 1I6WA 4OMDA 1MT3A 2H5JA 1X80A 4OMCA 2WWXA 3MUNA 2Y6VA 3OFNA 4V02A 4S1VA 2H0AA 3KM0A 2FPRA 1H0HA 2QQFA 2ZJ4A 3GMDA 1K7SN 4BDSA 5IJZA 1KE2A 3N8NA 3RABA 2YH2A 1GU1A 1XMVA 2OZKA 4DDMA 3SLRA 4NU0A 3ZDFA 4C7VA 3S29A 4FUQA 5CFOA 4D9IA 4EY7A 1U5AA 3R3XA 1UM9B 1ILWA 3G0BA 1NT2A 2QLTA 2OHIA 5SICE 3RRNA 3S1AB 4E4RA 1NXTA 4RTLA 2HF8A 3E9RA 1KI7A 1R3UA 1RYHA 5CJPA 1J22A 2QVBA 4W8HA 4RJLA 1Z75A 1G3RA 3DOEA 4RPKA 2C3YA 2P2YA 1J33A 1E6WA 2J7KA 4PYKA 3ZIAD 5JDCA 4EYSA 1J0AA 5G0UA 2PKCA 3E3NA 3LUFA 1BX0A 3L79A 2ETXA 3GVCA 1RDFA 1YB6A 5FBQB 4ARVA 3DAFA 2Y2UA 4LI0A 4MV7A 4TZ6A 2A14A 3PL5A 4LS3A 1A0OA 3QE0A 4NECA 4E7PA 4CGZA 2OFFA 1Z88A 4RV4A 3M9WA 3RBXA 3NP7A 2YX1A 3OQPA 4MWTA 2QW0X 4OAQA 5KSYA 4LMAA 2ZTSA 3ZDXB 1BU5A 4X66B 3G89A 2V5AA 1DDOA 4YDSA 1FYXA 1KQOA 2BD0A 4GX0A 2OGTA 3BB3A 1JNXX 1PN3A 4GS5A 4B3CA 2ZJ8A 1NUPA 1RZ3A 2PU5A 4KG7A 4J3NA 4AJKA 2C5AA 3TLZA 3WWYA 2FDCA 3EDCA 1Q74A 1VSQA 3B5EA 4D46A 3EG9B 3KJFA 4CW7A 1JIKA 2IVZA 2ZI6A 4PF1A 2LBPA 3HS3A 3T7JA 1INLA 3BBPA 3DF9A 2CE2X 1AO3A 3I9LA 1J9ZA 2EVWX 4KPGA 5HP4A 1J00A 5FPYA 4OBEA 1ZMOA 2XJ9A 3B1YA 2JGDB 4ZAXA 5H9VA 3VNBA 2G5GX 3KRTA 1F0KA 4RHXA 5K1ZA 3H5OA 4O4HA 2H1OA 1LVHA 1FVOA 2HEIA 3L6UA 3N0TA 4G89A 3OSUA 4AJLA 2QTNA 4B43A 2UXCB 1JPVA 4G25A 3OA2A 3M5WA 1PAUA 4JLSA 1P3DA 3E82A 5D51S 5A06A 2E1PA 4YS6A 3TQIA 3LDFA 1LZKA 4G81A 3X1MA 3GLRA 1N7JA 4DA6A 3HHEA 3ECAA 1UBFA 3EY4A 5IKOA 3L4JA 3CGGA 4FYWA 1RBYA 2BDTA 2W8BB 2YRWA 3RJ5A 5KMGA 2HCFA 2IC5A 1XF9A 2PQ0A 3BHJA 4M1KA 5T6BA 3I4CA 3SHQA 1OV4A 5DNDA 4MS4B 3PFGA 5AKHA 4BGVA 3II6X 4BWVA 3R0IA 2VNSA 2K5UA 1PDOA 1M76A 1XF1A 2IW3A 2O23A 2RGWA 1JDUA 2JAPA 3BA6A 3W1VA 1WKVA 3RE1A 3FWYA 1EJ6A 1XKQA 4LRWA 1R5JA 1XDDA 5AM0A 1YBVA 3T1OA 3OZVA 4FFDA 4ID3A 5B37A 3TW0A 1C7RA 3IELA 4B4KA 2E5FA 2FPIA 4MWCA 5UKDA 2C94A 3C4QA 4HUJA 2Z95A 4P0PB 4BFYA 3AONB 1NI5A 4QKQA 2C0CA 1WCWA 2Q9BA 3ILYA 1HE2A 3WHPA 4MWDA 4TTRA 1K6XA 2HBRA 1W47A 3KFLA 4ESEA 5KU1A 3CBGA 4B45A 3RK4A 2QT1A 4W63A 3L01A 2NZYA 4JJGA 3MT9A 1Y8RB 3WK4A 4I46A 5K20A 3TZ6A 5FA5A 4EY4A 4MLPA 3I9MA 1G291 2G9NA 5HS6A 1ZZGA 1D7OA 2QRZA 1ZGCA 3L7AA 3DXYA 3WHLA 3ZI4A 4J49A 1GN9A 2EIHA 3AEUA 4OQXA 2QU7A 1FYDA 1AKTA 1P73A 3AZOA 3BGVA 4LGYA 1E2BA 3RVQA 2QMYA 1QQTA 3SLKA 4B7AA 1JJVA 4RAOA 5JSHA 3LL4A 1BYUA 1BSVA 3G2KA 4XCXA 3CCBA 4J7AA 1KY4A 5JCPA 3QU2A 4R8VA 5HILA 4BZZA 5DO9A 1LW6E 3QMVA 2P67A 1F4VA 1T9BA 1XZCA 4JOQA 7MDHA 1LQTA 1P4HA 2FJPA 2GFHA 1PFKA 4A9AA 5TGTA 2HN9A 3P7MA 4X3PA 4OXIA 3EQ7A 1NPDA 5A6VA 3AR9A 3P9SA 1PR5A 1R12A 2CSUA 2GAFA 2OGSA 3B78A 4MRPA 3LKBA 1L8QA 4X7PA 1M34E 1IJKA 1CUDA 4CUZA 4MPRA 3PX7A 2CJWB 3ZIUA 5CB6A 3W4IA 2BR4A 1X7HA 2D1TA 2J31A 1EXMA 3VO2A 4K3UA 2P1ZA 2R6AA 3NOVA 4P4TA 4RXUA 4XRRA 4KJXA 3AP2A 1Y8AA 4BJHB 2F3QA 4KO3S 4L4ZA 4C7KA 3OCZA 3ZNOA 2JEOA 3G68A 5LQCA 1M0EA 4HB0A 3BULA 4K9RA 2ERCA 3H4IA 4KLCA 3VGPA 1YK0A 3F74A 2GUWA 3AHIA 3V3KA 3D3QA 1UBTS 1COZA 3FVTA 3H0EA 4OQFA 4II2A 2F8TA 3GQBB 1C9DB 1Z82A 1ZMTA 2QTTA 5ETJA 1DQSA 3E9DA 1SXIA 3NDPA 3ZUGA 4NE9A 3N8DA 4FYYA 1BFDA 3UJ8A 1LTHR 1M2JA 1RHUA 3NRJA 1OLUB 2BTQA 1OIVA 4OQZA 4N82A 3CX7A 2IXEA 3F73A 1OV6A 3J7AC 1SCBA 2VDNB 2FPGB 2R1VB 4UVIA 4NWIA 3MPUA 2XI4A 4LJ7A 4GU5A 5ABPA 3U4MA 1MTZA 3AB8A 2O1EA 1DFGA 3O84A 2JFBA 3EAFA 3TYXA 1XIVA 4Y1RA 3QE2A 3EXHA 1P19A 3RGWS 4CWAA 4XR4A 9ATCA 4DG8A 4OI4A 1GCAA 2VJOA 5CJJA 4YJFA 1J5XA 2AA3A 4N1AA 4O4IA 4Y67A 2PWBA 4JQCA 3H0KA 2VA8A 4HS9A 2J4CA 3RIMA 1IY0A 1QCCA 3BXHA 2C5FA 3WGLA 4BV3A 2BKAA 2RKOA 3H4MA 3N0WA 1SOAA 2QRVB 2V5VA 2E4XA 3RC2A 1EM6A 2GXSA 4P3NA 4LRXA 1DOHA 4RK5A 4MUIA 2ZUFA 1YMUA 3RS3A 3UB3A 1ABEA 1GA4A 1JQBA 1SOVA 1JP7A 5FO0A 3EPPA 4BNWA 4BJ3A 5C8DA 1WMAA 1A4UA 1G66A 2X0EA 4CIXA 1H9BA 2Y1FA 3CG0A 4WZ6A 4DQDA 4IP0A 5ECYA 3UCXA 1ZH8A 3IOBA 1Z13A 3MTAA 4UCQA 1I6MA 3E1GA 2DBQA 2IEGA 4RGQA 3WVNA 4D6PA 3H4TA 1JG6A 4BNLA 1NF3A 4ZC1A 3ZGVA 5I8WA 1EFTA 2NYRA 3D3NA 3RBAA 5IANA 1S2LA 5KHLB 1FRFS 4YR7A 3AHDA 4DKJA 4FI3F 2ZULA 5AJTA 5E9AA 5F2OA 2DYKA 3FYSA 2PSSA 4XWGA 3SBXA 3GDGA 2FVXA 3TPCA 4CTOA 2CDCA 2FWBA 3BIFA 5LZ8A 3VH2A 1T0UA 4LBVA 4GD3Q 1C7FA 4B7XA 5J5VA 2X5JO 4B8ZA 1PQWA 2PMBA 4HGPA 4QNNA 2DG2A 5CNJA 1W44A 2O7SA 4HDOB 4B34A 5I7RA 2VHWA 5J4VA 3OF2A 3RDPA 4RMGA 4CV0A 3GFGA 3RYHA 5D7NA 3THXB 4BMVA 1SKUA 4WRRA 5J40A 3K9BA 3VTKA 4H6PA 1IN1A 1RM3A 2L0XA 4G0MA 3EQ6A 5JISA 4BNMA 4G0UA 3SYNA 4DCMA 3CUUA 4QYTA 1TM7E 4WUVA 5C7YA 1SPXA 4CTNA 1G0OA 2HM7A 3CLSC 1P4SA 2OAQ1 3CLHA 4PVCA 5LLTA 4ZCRA 4G1CA 4NBWA 5KAPA 4GWGA 3OZEA 1QPBA 2PVSA 1XDWA 3OHSX 1QIHA 2RGDA 2NSJA 4DIMA 2FPMA 3OIFA 4HLCA 5YASA 4JZYA 4X20A 2DZDA 5F21A 1Y3FE 1NLFA 1V16A 2WMDA 3JYQA 4URYR 4R7ZA 3FTDA 1PFYA 4HTFA 1DDGA 2FP4B 4LKOA 4P35A 2CNWD 3HKEA 4DRXA 4PSDA 3BSWA 1NLYA 1R74A 1D6JA 1MH1A 2CJPA 3SJCA 1RZRD 1P5ZB 3HDHA 3ITNA 2HR1A 1UZUA 5EJFA 1EHYA 2HIAA 3CH5A 4A2CA 3BUSA 1LLUA 4FJ1A 1RWVA 4LSWA 3HCOA 1XNGA 3HZOA 4DJAA 4ZU3A 5C46F 1OFIA 2FPSA 5CFRA 1PF7E 4HD8A 3CMCO 4EI9A 1GL9B 4DRXB 1E9FA 4EUSA 3S8EA 2O14A 5FYQA 3K70D 2OG1A 3A1UA 3ELUA 3GLFB 1EVKA 4I50F 1FFSA 5CW2A 1KETA 2R6DA 2ZREA 4B1FA 3E8XA 3Q8MA 4TSKA 3N86A 4KXNA 5KINB 1NZDA 4QLBA 1FP4A 1YHZA 3OAAA 5BW8A 4F5EA 5B6JA 5LUBA 4BAGA 3PXUA 3EQ9A 5GM1A 3HCNA 2QRMA 1M75A 1OLSA 5AVXA 2C9MA 3T7SA 3VVCA 5BWOA 4BU0A 1Y81A 1B4DA 4HDCA 5DNWA 4YY3B 4JYAB 4FINA 1QX4A 5KNCA 3CM0A 1GFWA 1XX6A 2VZ8A 4E2FA 2NN3C 3PHLA 4YCJA 2I3GA 2DLDA 2XYQA 4ZVNA 3UT6A 1T4GA 2RG7A 4BNZA 1L1RA 1SUAA 1E2HA 1WNFA 2JHGA 4DVGA 5J23A 4LVCA 3A4TA 4YMUA 1ADBA 5I9SA 1CQZA 2EGGA 3LQ2A 4QDZA 4BEBA 1JVNA 1Y6GA 3TTWA 2W7TA 4YC7A 5CNKA 4TV9B 1R9GA 1NJ2A 1G21B 2PAFA 1AQLA 1IEWA 2CMKA 1XCOA 3DCYA 3HDJA 3LOUA 2ONJA 1FTNA 4DCTA 1TJNA 4PHCA 1KORA 3CXRA 4CDMA 3HADA 3HFJA 1NW7A 2QAGC 1Q50A 2NUBA 2HQSA 3I2FA 4GPZA 4J03A 3IUJA 4U9UA 1F06A 1UT6A 1XQ9A 3BJZA 5BT9A 5AOVA 3QFRA 3CWZA 1CWUA 4HPWA 1GUYA 5TV2A 4F4HA 1FDUA 3OIYA 4FEEA 1GTMA 3AM5A 3ZZ1A 4TV9F 2GD2A 3ILVA 4RH3A 3JYPA 2AE2A 3FR7A 5EQFA 1EUCA 3IB3A 4YDHB 3U7EB 3DLHA 5JSZA 1J9GA 2C4MA 3S40A 1TJPB 2A3RA 4B3HA 1Z33A 2NTJA 4HBGA 1UC8A 4OP3A 5IJAA 4L7QA 3HKCB 2X7JA 2HSGA 2WT8A 3DQQA 4O4HF 4HYQA 3LXRA 3F8SA 3AVUA 2P68A 3TTYA 1SCNE 4TT3A 4QQ8A 1RLIA 3R3UA 2I3AA 4JJZA 4ZO4A 4O2BA 2FP4A 4CG1A 5BURA 2O2HA 5DW3A 2HU5A 2JNWA 5TX7A 4M7PA 2Z6VA 1VLQA 1XYGA 2XD9A 2FW1A 3BT7A 3UKDA 3MJTA 2Y1GA 4NZNA 2RFLA 2AK2A 3PCTA 3G59A 5EIHA 2WHXA 3W4KA 3JZAA 2PRSA 3P1JA 3C3BA 4AMZA 3CE9A 4MK4A 3AY7A 3TPFA 4GWKA 1KYZA 1UBOS 4BUZA 3K09C 3LXUX 2CLLB 3O94A 1JEAA 1YE3A 1TCAA 1RFGE 5ALQA 3C7CB 3K09A 1Q0ZA 1SUDA 3JQ8B 3L40A 4KP7A 3TSZA 5FFMA 2HW8A 2AKYA 1S9DA 3VO1A 1TMGE 4S2EA 3P94A 3TBKA 3UVEA 1TAHA 5EYPA 4FFOA 3R23A 2VAPA 4ZVOA 3HM9A 1ODCA 2PKQO 5H81A 3OLWA 2HJVA 4BZQA 2NUAA 3EC2A 3SX2A 5ARCA 5MDHA 3ROFA 1I3CA 3HXMA 3GPLA 2XWQA 2R00A 2DY1A 4KZPA 3KJZA 3AXTA 1WSAA 5EE9A 1M0TA 1GL3A 4J4BA 4YP9A 1TYZA 2OV3A 3OO1A 1OLXB 2YBDA 1P1JA 1PYDA 2XE7A 3HL0A 3BL8A 5C18A 2WTEA 2P9EA 4G8BA 2ZRBA 3AU8A 3PE6A 2HT1A 2CNKA 4BVLA 2EWMA 4NG5A 3GRPA 1V1JA 4NICA 4WT7A 5EP3A 1KS2A 3ANSA 5BUCA 1WKBA 4XIIA 2GESA 5ECDA 1A9RA 2B4YA 3ABOB 3ZH2A 2NOAA 4E46A 1FUIA 3RVOA 2J0UB 4LZWA 4RA6A 4X62B 1NMXA 2B98A 1TAQA 3C14C 1K6MA 2JCBA 1MUUA 2F8MA 2HSEA 2ZE5A 4M60A 4O1IA 4KQ2A 1NE7A 3ZWBA 1JEEA 2W58A 1CKEA 2H4XA 2IDKA 3KKZA 4F4JA 5LP6B 3R0XA 1IM8A 3DAHA 4K9QA 4N47A 1JLLB 1AA9A 1NVXQ 2AMJA 4M1YA 4TYNA 2XVYA 1QGDA 1NVMB 1W6RA 1ATZA 2XUIA 1C4XA 5ALMA 4BPRA 1KO8A 1VE1A 1YB5A 1TK9A 2DKNA 2GK7A 4WCDA 2BBOA 2HIGA 2JZOA 4HNTA 3PDJA 2XKAA 3K9FC 2QVCA 3O3CA 1UBJS 2AN9A 2V7BA 3U4HA 3JALB 4HO1X 3WKAA 1M8GA 4OFBA 3THSA 1NYQA 1UQTA 1X80B 3ROKA 3EDRA 2BP7B 1DAOA 2B9EA 3NIWA 3K0FB 3VU3A 4L8LA 5KPDA 3HR8A 2IPLA 3ND6A 4FJ0A 3IVCA 4RVGA 3BJEA 3TBFA 3HJHA 2OUIA 4R2JA 4N0MA 1WB5A 4LY3A 1Q2UA 4OXYA 1VMEA 3O4HA 3DE7X 4YRKA 1NXOA 2ASVA 3KPJA 1PHRA 3NBYC 2BY4A 3M1LA 2D2FA 5CP8A 4YBZA 2WU1A 2PX5A 1TAUA 4UDNA 3IESA 2ZBGA 1VB3A 3T0GA 3WIUA 1RWPA 5DLDA 5DCWA 3WGMA 1KEVA 5M04A 2GI4A 1CUBA 2QVXX 4PVDA 4B46A 5HMMA 3FB4A 5EJ5A 2UUPA 4EP1A 5I9BA 1CY1A 2HZ7A 1QLWA 2PQ6A 1ML3A 3KKOA 1MN6A 1O9BA 1Z47A 2F3TA 1U1DA 2AEMA 3ITDA 4JHLA 1MV8A 4P84A 1F2DA 1VA4A 2AFHA 1RYZA 3G2MA 4DNPA 1E9AA 1VHTA 3DTVA 2FK8A 2OK7A 3R9WA 4JI3B 1G4AE 1IUPA 3H04A 4R1UA 4GM1A 5JQWA 1CDOA 1G8FA 1GGMA 1KVUA 2X8JA 2YDXA 4UHKA 5KQGA 4OB6A 3A6KA 4PAQA 3UGQA 4KAJA 1QAOA 1A27A 2VVTA 4E1VA 4XLTA 2PBFA 1SVNA 4TSRA 1TKCA 1N6KA 3Q9NA 3RVLA 1AF7A 1FXWF 1JT9A 1W9MA 3NAMA 1YB2A 4X6UA 4HVLA 4IJ5A 1J8YF 1OJLA 4UU1A 2J48A 3DD1A 3KXPA 3TNDA 4DLZA 5CG1A 2X0IA 3T7IA 5CPBA 2VXCA 4QYWA 2WYWA 2IZ0A 1AOXA 2XLCA 2BM1A 2CZGA 3IJRA 3HKCA 2NU7B 3QA3E 4K9MA 1PFUA 2YN4A 2ZJ2A 4ZRNA 1JYEA 1VKOA 2GBGA 4Y6RA 1DC4A 1GZ7A 3OEHA 5BNTA 3MIZA 3HU2A 5FTNA 4XX0B 4LXXA 2XCQA 1XZLA 1VHQA 3ETEA 3KCQA 3RCBA 2IHJA 4QHSA 3RVSA 3SF8B 3U4QA 1WS6A 2W2NA 3QUBA 1JV2B 1FY2A 3NVKI 3QVOA 2IFTA 3MMNA 1Q3TA 1XK6A 2PNFA 2FFRA 4PW0A 2ZJAA 1HEYA 1BOOA 1ORTA 2BTOA 2CVFA 4AECA 1CZLA 2JF0A 1QH0A 2C8LA 1EWYA 1BWSA 4UNSA 3WNQA 1HA3A 3OWHA 2MT9A 5DGHA 1N0WA 4JHXA 3FOZA 3TCXB 4U9HS 4I7EA 4Z9XA 2YINC 1QRTA 4I4TA 3HN2A 5LU8A 4QYIB 5EIOA 2FN3A 1CR2A 5BQOA 4B9AA 2V7TA 4YIHA 5C7OO 4DUZB 2HDHA 5HCUA 4FP9A 3TQCA 3QU7A 3NYIA 4EPXA 4WCFC 1UF9A 2O7VA 4TSFA 1ZU5A 3TW8A 4N54A 3NLLA 1EJ2A 4HEA1 1F8YA 5LBIA 3A32A 2AJTA 2F3RA 3EDOA 3MWKA 1Y34E 3MBOA 4Q3EA 1WPXA 1XZEA 2V58A 4JEHA 3WK6A 1UBKS 1FA9A 4JJ4A 3WWZA 4RZUA 4EDHA 2Z83A 2QZ9A 4G2TA 4KTVE 1NUQA 1J7KA 3K6JA 1EFUA 3WLNA 2B94A 3TZCA 4C4YA 4KSYA 5I3CA 3FTQA 1IN8A 3E9ZA 4G9BA 3UK7A 5FH9A 1EEXB 4UBMA 2UVQA 3O1HB 5EIWA 3WJ1A 4BVFA 2HWYA 2WJ4A 3QPAA 4Z1OA 1EUDA 5JMOA 1FF9A 4IIXA 4D26A 3QLJA 5HX7A 1BEEA 1DEXA 4JA0A 4I9NA 3NW9A 4AFNA 2QQGA 1ODTC 4XQEA 5LOVA 4EG1A 3D0KA 3WC4A 2BMVA 1SZCA 1QG6A 2PSHA 3EODA 3HNRA 5TMBA 4P80A 4OOEA 5FOUA 4OHCA 1ADGA 2GVNA 3JX9A 3LF2A 4OGKA 4X8MA 2O3UA 3TVTA 2XD4A 4F2HA 2GSDA 4HFNA 4RFLA 4AKTA 5A0VA 4Q47A 3JQAA 4R8MA 2J4DA 3T0FA 1TQHA 4E1BA 3LNTA 5BWBA 4PPYA 1UBMS 4A8HA 2QRGA 3UCFA 3CE6A 4KFUA 4JC4A 4JUBA 4V39A 1M0SA 2FTKE 3ZZTA 3ZLBA 2AW5A 2CN1A 1SBYA 3HHPA 3LPNA 3GLKA 3SS7X 4WZAE 1T91A 2IHUA 4Z53A 2OUKA 3GVXA 4FFNA 3RYCB 1KZ1A 4TZ0A 3DBOB 2F43B 1NDHA 3TQOA 3SJBA 5A7HA 2JA1A 1ZDMA 4R3UC 4Z4FA 5TF0A 3MFYA 1JB1A 1G8AA 4INZA 1G1AA 5CDGA 2QJTA 1EZZA 2V0NA 2I4NA 5KNBH 1KPHA 4AUNA 1JFRA 1HRDA 5HJ2A 5BUZA 3QKSB 4I8DA 2GILA 2ZSUA 3NUQA 2VKQA 4KLZA 1TDJA 4LJ4A 5ALPA 3ECCA 3CA8A 1OBHA 3SU8A 1RYYA 3FH0A 4JITA 2VBCA 2R4UA 2PL3A 2GTHA 3ICVA 4BCCA 4CHGA 4YRNA 3UWPA 2B3TA 1U8YA 3K1JA 3TIGA 4BKRA 2Y0DA 4MPJA 2IHNA 1DCFA 3TTSA 1E2MA 1JFFB 2LIVA 2FP3A 2WU0A 4IIJA 1T6BY 4KXXA 5CDTA 5DX0A 3D31A 4YV7A 2BSQA 4CEHB 5F4ZA 4HK4A 2WWFA 2Q0HA 2OMKA 5BW5A 4UTRA 2DPHA 5AVTA 4HN4B 2R1UA 4AQDA 1WMFA 1ZGHA 5LU9A 4DLUA 4AUEA 3BHMA 3AKEA 4TM7A 1J0XO 4I0WB 2BEJA 5F2KA 4CODB 1VG9B 2PU7A 1K68A 4W99A 1BCSA 3ODPA 1LDGA 2QMZA 3KZVA 5JC8A 2YUTA 1Q91A 5LPNA 2AR7A 3SKXA 2B1JA 1E3QA 5A3SA 4JX9A 3BRSA 1L5ZA 1RWNA 4YUAA 3CKYA 3CY6A 2Z2IA 1HDZA 3ZDEA 5CITA 2CEKA 4N03A 3LBFA 3G8AA 4JUIA 5EC8A 5FUBA 1VLVA 5BYAA 5TJ9A 3QMMA 1JEOA 1FSZA 2RH4A 4UMEA 2PYDA 5D3QA 5C81A 2Z6AA 1ILEA 2YWBA 3N05A 4ZCQA 9LDBA 2RAFA 1VMIA 3KJNA 4OH7A 3P0IA 3PQEA 3SE7A 4BNKA 9GPBA 1SCKA 4KIGA 1J2EA 3BIOA 3BPSA 2FY8A 4JR2A 3ZZUA 4GYYA 5JIBA 1OB5A 1GGEA 1LWNA 1RI2A 2Z0MA 3I6MA 3KO8A 4L22A 1GA6A 1Y3BE 2GF2A 2H08A 1WU7A 3GGOA 4GZMA 4MJLA 4QGBA 3OFVA 3PI7A 4R1SA 3M4ZA 5JPCA 3K1AA 1RZUA 3KZOA 3BSSA 1Y1KE 3A6EA 4FK8A 4EKNB 4HVCA 3SXJA 1J39A 3SZ3A 3O74A 2SBTA 2TRSB 3F6SA 4JODA 2F00A 4C43A 3THXA 1H5QA 2ERYA 1PP4A 1XZNA 4RHFA 5A5DA 1E32A 3C7DB 1RKXA 1VIVA 3O1IC 4KH0A 4NYIQ 4ETNA 4V1CI 1VPWA 4I4NA 4GI7A 1C1DB 3K70B 3AUKA 1L5HA 3L6OO 2PGAA 3DKKA 4DZRA 1EP9A 4PFKA 2DFTA 2P8SA 1DSSG 4PLTA 3OKAA 3UUWA 3UPTA 3C8ZA 3H4VA 3JSXA 2XUGA 4QWMA 5ALUA 5SYMA 2QX8A 1JDZA 2AJCA 3C6QA 1GZSA 2CBXA 4ZRDA 1DQYA 4JJAA 5HQ3A 2Y66A 1K9SA 3HDTA 3O47A 2HHJA 3WBJA 1V16B 3MVEA 3G2NA 1V8ZA 4HC4A 4MKIA 2WJHA 4CMIB 5JY1A 3RYFB 5LQDA 2YMMA 2VJDA 4HEHA 1SG6A 1YS9A 4M9CA 5LQAA 3KSRA 5JSZB 2PSJA 4QG3A 1TQ6A 5H9WA 2A7XA 4JY7A 4UQLA 4UM8B 4F93B 4RXMA 1UJ2A 2QPTA 3PKZA 3PTLA 3T5BA 3OTHA 4IBOA 2CVHA 2JHFA 1CUVA 2RHJA 3TKLA 3UJ3X 5FX2A 4S1NA 2PS1A 1UEIA 1GG9A 3V1KA 3A3NA 2CDAA 2PUVA 5CYOA 1R4AA 4JK3A 5FTWA 3PVZA 4TKVA 1QPZA 1PE0A 1TO6A 3W3AH 1XDSA 1Z26A 1GQFA 4PR3A 2C29D 2W6QA 4UDYX 5JJLA 4RORA 3DLPX 1U2SA 4R54A 4DQXA 2F7SA 1AKNA 2Z8XA 3IV7A 4R1TA 1Z2PX 4K9LA 1SQGA 3WO0A 5KZMB 1U9CA 5CDUA 3TLBA 4AJEA 4CCWA 5JAPA 2X13A 1Y4SA 4M0UA 1XUOA 2ZRGA 5AKZA 1XR3A 1XL0A 5ALFA 4DUPA 5HSGA 1U80A 2H0RA 1PK9A 2XF2A 4GLFA 2HKIA 4EEKA 1QGUA 3ASUA 1KP2A 5JNVA 1H0KA 3K9CA 4HH0A 4QVIA 4ZAZA 3GL9A 4XE5A 1LTQA 1E58A 1QQ7A 4H7KA 4LEIA 4XPZA 2R7KA 4Q9JA 1MQ8B 1PV2A 3MG9A 1MX9A 1UIMA 1OGJA 4XIGS 3AEKB 1OBFO 2L2QA 3IO5A 1VJTA 4NBNA 1IM2A 4QDXA 1VRWA 1F5NA 5I8ZA 4D43A 5CCDA 2EC5A 2Y1OA 3DSRA 4ZQEA 4ASUD 2MSNA 2ZUVA 1EHIA 3HB9A 4MR9A 3DVAB 1ISGA 3MSCA 2W0SA 5G4LA 4KNVA 4S12A 3PJEA 4YCCA 2XWPA 1TD9A 4XYLA 2JGIA 2CXSA 3VMMA 4LY9A 4OATA 3UK2A 3KYDB 4XYGA 1G3MA 3JAKA 5KOIA 3P9RA 3PD1A 1SB8A 3QIAA 2CXNA 1EPUA 3BVPA 3DPUA 3PEVA 4HKTA 2PFSA 3RWBA 3U4AA 3VPAA 2FLKA 1QHIA 4GP9A 1RQ2A 4C88A 3VOAA 4NZ9A 2EIXA 5CT8A 2XXBA 2P78A 1BIFA 1PTKA 5JAUA 3ZLVA 2LXNA 1LQ2A 1QKJA 1TZMA 1Z4QA 4BKOA 1ULZA 1CJUC 3CF0A 3LY7A 4UAJA 5GJVC 3OZTA 1Y1LA 3OTOB 3JQGA 2I1QA 3LWDA 3C7KA 5DOVA 4N65A 1KAHA 1WNTA 5KNCD 5KVAA 4ZT2A 4I9GA 2WU8A 3QLEA 2I67A 3F8WA 4DY6A 2IF2A 4K6GA 4PTLA 5IWAB 1SO8A 1UBUS 3ZZNA 5DNYB 3SMVA 3G23A 2W90A 1VJ0A 1WUKS 3OQIA 4PHGA 4D25A 1WDLA 2NAFA 3TSWA 1JU4A 3ZV4A 4PANA 2I2BA 5FBLB 4WBXC 5IEBA 3E7FA 1W34A 1HZZA 2A9RA 2WHPB 3MWEA 3SIPA 3L7DA 5EZYA 4M49A 1L3CA 4ZVUA 1SHKA 2BGJA 5TB5A 1BH6A 4OYYA 5FEMA 5U1PA 3VR1A 4AN1A 4P82A 2C4HA 1YDEA 4CM9A 3H3JA 1FSPA 3UEOA 4GE0A 1EK1A 3RLFA 1FMJA 4TVOA 4B9EA 4G8DA 4NBVA 1ADFA 2IF0A 2AHRA 1NJ6A 1R0RE 1UMDA 4R1NA 4W5QA 3M2TA 1I51A 4J0KA 1YDHA 2PUCA 1X1DA 3GYBA 4IKOA 3KYBA 2FZKA 2PLFA 1IBSA 1Z6TA 4QRHA 3PB3A 5JJBA 2PHZA 5KSOA 3KUXA 4KWCA 2UDPA 3TQQA 2ZYHA 4DMUB 2WVHA 1F8UA 3WWEA 4BRWA 2Z8YM 4B87A 2X1LA 2X5KO 1C9JA 2YIVX 3ESDA 4X5OA 3WZ2A 1WETA 2FETA 2R6JA 4HLDA 4RL6A 2OM6A 4Q4LA 4ZT6A 3SX0A 3V48A 2R6HA 2X7XA 4F92B 3QWBA 1DJPA 1S9HA 1AS2A 2W2XA 4KO4S 3FSGA 3HXOA 1Q0SA 3G85A 4IHJA 3ZGYA 3ZNNA 1W85B 1WF3A 1ZR2A 6AT1A 4NCNA 1P8JA 2O8VA 3ME5A 3EULA 1VE5A 4OK6A 3A6ZA 2DBRA 4EW2A 2VDQB 5TGDA 1QE0A 3VR2A 5BV1A 3CVUA 4IUCS 3TIVA 1S8AA 3B6MA 1ECPA 3G0DA 4Z7JA 5C1PA 4TQUS 4IHKA 5AW2A 4FHFA 5KOYA 4MDYA 4DNFA 3IOMA 1F4LA 3FUXA 4IICA 2DB3A 1A9TA 3W1WA 1YIDA 2V3WA 1T1RA 2W6IA 5F9FA 1Z3CA 1JHZA 1G42A 5AXDA 4NCKA 5EMHA 1UDAA 5JARA 1E2UA 3A4IA 4C5BA 2ISQA 2NSHA 1JKMA 1Z4KA 2XTAA 4F5ZA 2CC2A 1EVZA 2H17A 1ZH2A 2O1XA 3PHCA 4HAOA 4XM0A 1JB9A 1DX4A 2BP7A 3WYBA 1KKLA 2X2FA 4DB4A 1E60A 1X8KA 1XC7A 1RMYA 5HUHA 2HRDA 2O1WA 2AYZA 5DGDA 5CK5A 3RIYA 1MPTA 3WYEA 2GXAA 1DRVA 5CW1A 1TJYA 3DE4X 4AZ3B 521PA 4G56A 1OXMA 2XEXA 5EQDA 3EDYA 2APJA 1RRVA 2VPIA 3MN1A 4MWGA 4AQYB 4ZVRA 3GA5A 4Q9DA 1WP9A 2ZRHA 1N7HA 4GUAA 4O2AB 2GPBA 3IQDB 3TOZA 4CTJA 2C7PA 3IP6A 4XOUA 3RLIA 3PNYA 3MWFA 5EP1A 3PLNA 2QP9X 3EMDA 1KAMA 4RHTA 2J3EA 1DARA 4KQXA 3FROA 3ZUPA 1W36B 2MSDB 1JE0A 5T57A 4AJHA 1T6YA 3OJFA 4CFSA 2GM3A 1YVDA 2H31A 1GNSA 1HC7A 5DCYA 3IAUA 4K88A 2D6FA 1ZMXA 1I32A 4NU8X 3SPXA 5EIXA 3K2EA 1Z8FA 4X8HA 3IUPA 1SKQA 4A2WA 4EAAA 1ORVA 4RF3A 2GS9A 3CZ5A 2R00C 3U9TA 3W8EA 5KNCH 2YJZA 5KX5A 3RT7A 2IUYA 2P40A 3CONA 3ENVA 4DLVA 1B23P 3ZI7A 3RTBA 4XB6B 4X63A 3SS8A 1PG5A 1UL1X 4HQKA 4NFYA 4CYMA 5BMOA 2DP4E 1RIIA 1VL2A 5LQUA 1V7ZA 3BE4A 4OK3A 3BF7A 1H42A 1C3JA 2YNMD 4MZDA 2XXJA 4HAVA 5LFAA 3QYAA 3TECE 1RLMA 4KK4A 4XYMA 1ARZA 1ESNA 5DNEA 4CL0A 2H7YA 4U4AA 1X39A 1WXWA 3X1DA 1OZFA 1S3IA 1RYDA 4TXMA 1V6CA 2IOQA 1RAAA 4B84A 4EPYA 3LBYA 1U6KA 1GCOA 8OHMA 5DVZA 3K5PA 1GQRA 4YGXB 2FX5A 2J32A 3LU1A 3B1JA 1PNQA 1R0LA 1W76A 3OI7A 3RREA 3GG9A 1GKLA 1NMEA 2QRLA 3ZK9A 2ZDQA 4C04A 2ZRJA 1CUAA 3L1IA 4IXWA 3SC3A 1VJCA 4C1BA 4D6YA 1EB8A 1K92A 2CF5A 5J2UF 1UKCA 3F6RA 5TRTA 4OI0A 2ROQA 3CZQA 2XE6A 1OAOA 3L5KA 3UWSA 2EFYA 4FFBB 3HYLA 3U17A 3WLEA 4AZ0B 1L7MA 2ZIGA 3FOFC 5AQEA 2XSZA 2O8DB 4LNUB 5I45A 4ERNA 4CM3A 5FAKA 1HX7A 1V3VA 2WYHA 2L17A 2JFYA 2VF8A 3AR2A 3FA2A 3D1VA 2Z56A 2A0FA 3BHNA 3D6HA 1PR1A 2FPPA 4JB0A 4P36A 2WSSA 1M7BA 4A23A 5AW5A 1SU4A 2R8RA 2VUTA 3GGGA 3IULA 3TEFA 3LCRA 4YUXA 1XKLA 4RY0A 1L9KA 2EFEB 3LYHA 4DCSA 3AKCA 2WFLA 5GADl 1ZWKA 1G6HA 3VYSB 1AC5A 1X38A 4M9SA 4C4AA 1TA9A 4ZU6X 1L7XA 2PT5A 2NZ8A 5K3CA 4QDKA 1LV7A 3FYUC 1UOOA 1E0SA 2AJLI 4E2YA 4KFCA 1E3MA 2O8CA 4ZGWA 1N9KA 1NRJB 2D7JA 4RQAA 3PTAA 2QD2A 2ZRIA 5A3VA 5DHAA 4JBWA 3WI7A 4MGIR 3PEUA 2ZIVB 1JFTA 1LS6A 3S4YA 1RC8A 1LX6A 2ZM5A 3VZSA 4QRIA 4C76A 1Q14A 3QF4A 5CX1B 5KTOA 5JCJD 3LM8A 3QX8A 5CURA 1KAOA 3ONWA 4M9XA 1UJNA 1JFLA 4NABA 2HB6A 3RBZA 3FMOB 3SK0A 3JYOA 5DM2A 4EABA 4I5GA 3OEWA 3OFSA 1AGXA 3ORQA 4BAZA 1MF7A 1Q0TA 1EFRA 5KVQA 1O9GA 2IYXA 3EIXA 4WJZA 3B2QA 4PO9A 3WYAA 1MA0A 2Y4OA 4X1KA 4N9QA 1J0EA 3GDHA 5HF6A 3C4VA 2GWHA 4OLFA 4P81A 4EITA 2B7LA 1NJFA 2PPLA 4HG2A 3K20A 4UPEA 3UMVA 1ZUNA 1C2YA 4D97A 1PJLA 1JMVA 3PNVA 3C87A 4FBLA 5HWSA 1LFAA 1NJGA 2CGEA 2Z1NA 2HK6A 3LA6A 2DPGA 3PV0A 1UK7A 5CT4A 4DJJA 4Y2VA 2NV2B 3SJAA 4QT4A 3VU8A 2OZLA 4ZYLA 2R8YA 3BDIA 1MRSA 1Q17A 2ATCA 3GHHA 1E64A 4WN9A 4EEXA 3O1LA 3D8UA 4REQB 1GPMA 3KDAA 3PD7A 4RWEA 2ZVPX 3IDFA 2PLNA 2NZJA 5EJ6A 1MHTA 3IKJA 1G0NA 1HQYE 2XXAB 3N8KA 2EKDA 4PYOA 2F6RA 3OIVA 4MUNA 3UF0A 1GTL1 1JR4A 5LLSA 3ZJ4A 2CF6A 1S8OA 2C4TA 2G70A 1UWCA 3WL4A 3PUXA 2C1ZA 2OZVA 2P9HA 2VDWA 1YQEA 1K0UA 2M6KA 2C00A 3NT5A 2XRMA 3N7TA 3W1EA 4HAUA 4S3MA 3RI3A 3F7NA 2CL6X 3PWTA 4UHHA 1E1MA 1WMBA 4LHXA 1ADYA 5D01A 1GXSA 4NESA 4PHFA 1EVEA 1PJ2A 2I2AA 1O6FA 1UOEA 3E8MA 4DG5A 4N0EA 1AS3A 3GRAA 1ENPA 5EHIA 3D8TA 2CUZA 1G3QA 2J0EA 1U4OA 5KS2A 2N75A 2HLNA 2R25B 4C0XA 4I36A 5EE1A 1U4SA 4YQFA 3ZHCA 2Q3LA 3RAFC 3NTLA 4XJSA 2YHAA 1TEXA 1LSJA 1PEAA 5FXMA 4CDGA 4CE6A 2J6IA 3ZGXA 3ADBA 1DG3A 2OB2A 2VC2B 2R751 1PFQA 3NBXX 2VXOA 2J5XA 4DCCA 1Y42X 4MIKA 2JLBA 1GYRA 2J1LA 1JSZA 3SR0A 4EATA 2WK1A 5F12A 1FYEA 3EVEA 2V59A 2WSBA 4G36A 4A73A 4LGMA 4N6GA 4PC2A 2AG1A 3IBCA 4FSHA 3AI7A 3RM3A 5AW3A 3DBRA 1TQ2A 4JI8B 1V25A 2BZGA 3QG1A 4UXIA 1ZIDA 4QPNA 2GR9A 5KJ1A 2H51A 3PZRA 1VIDA 2AI1A 2VJYA 1YL5A 5D2CA 2XE4A 1QHEA 3CF4G 4GP7A 4IDHA 2BEKA 4F8JA 2C7RA 2PLWA 5E6SB 5EZYF 2V4MA 1PR9A 3CLVA 4CM8A 1U0HC 1THMA 5B2EA 4I5FA 1V11A 4RJ2A 4CR6A 1KY3A 1CD5A 3RRBA 1AQIA 4UZEA 2VQ6A 2IPAB 2YZ7A 3G1UA 3IRVA 4RQUA 4C3UA 2AG5A 3DYBA 3ISVA 2R7LA 3HN7A 3NUZA 4L95C 3OQJA 2NZVG 2A8YA 3AB7A 1YACA 3ED1A 3JRNA 3O3NB 4HWKA 4NLLA 4ON9A 4Y2PA 2A5DA 5E6SA 3A2MA 1CRLA 1P17A 2XOXA 3CLRC 2JFGA 4AY3A 2MSLA 4BFXA 3PQFA 5AM2A 2ZB4A 1Z39A 2ZIZA 4ZDIA 3CF2A 3IXQA 2B92A 4HQ6A 4YRPA 1FUUA 2ZYTX 2G25A 4ADSG 5LC1A 6ADHA 2EZUA 2VWQA 2WMOB 4MMXB 8ADHA 4B7UA 1I3KA 2VHEA 1MG0A 1DO0A 2FUNB 5LBTA 3V2IA 1Z8HA 1A5BB 4OQPA 4A36A 1S89A 3FDZA 5AR1A 2QUBA 1CLUA 2VA9A 3K8ZA 2GCPA 2X6TA 4GMFA 2WF7A 4P4SA 3WGNA 2OXFA 4NPCA 4CU2A 1JR3A 1SRRA 3TNFA 2E2WA 1WXEA 3OBBA 3DW3X 1W4AA 2X8BA 3MQ4A 3BB1A 2A9OA 1QUEA 3W6PA 2AV6A 2QAGB 5DTEA 5H5JA 3T1TA 2ACKA 4TMFA 4X1YA 5HRUA 5ALJA 2WJIA 1JX6A 2QE7D 2C84A 3G5AA 1TYDE 4RZSA 1EP3B 1GQOA 1YS4A 1KA9H 1ODKA 2F3SA 3Q9LA 3ISJA 5EP4A 4BV9A 4I3HA 3IEPA 5D6NA 5ES3A 1UC5B 1NNI1 1OX4A 1UFVA 3EQ2A 3PNPA 4YREA 3V4VB 5JNLA 1X1QA 2WUGA 3STXA 2QYOA 2ZAGA 2WU4A 1T2UA 4J91A 5H4GA 5HKKA 3PICA 5JYEA 1E92A 1V43A 3IQHX 1G4UR 5I8PA 4LF8B 3TJZA 4KXQA 1DX6A 2A1UB 2Z4SA 1QGZA 3N7UA 3TLGB 4M87A 2V3VA 3SYKA 2QOEA 2BF4A 2W6CX 4CIVA 5B57C 1FB5A 1PGOA 4QDUA 1L1QA 4QQKA 2F9FA 2H85A 4G5RA 1I7DA 3MWYW 4Y2TA 2GOYA 1G8MA 2I6QA 2WJGA 1TADA 3OQIB 2XKJE 1DQZA 4RM2A 4HRVA 1CP3A 1OLOA 2OORC 3PSHA 3H11A 4ZODA 2BCGY 4TN1A 5HYVA 2PUBA 2C2XA 3FTEA 2OBMA 3AY0A 3CUSA 2WQ7A 5B1HA 1IZZA 1LBQA 3AT1A 3PI6A 2IEAA 4R68A 3DTVD 4A6DA 1VPVA 2NO9A 2JIDA 2IITA 5F5XA 2XOKA 1Q95A 3ZGLA 1E8DA 4DYHA 3T1YB 1BRTA 5I7OA 3AEZA 3BDVA 3HMKA 2DPXA 3I2IA 3PFIA 4NFHA 4YMIA 1WCIB 1J20A 3OZFA 5AJXA 4FFWA 1G6OA 2BI7A 4HDRA 3HSSA 1IRIA 4RNCA 2PGIA 3CBQA 5DKFA 4W7HA 5B6IA 3D4LA 5JI2E 3ZQ6A 4ZYXA 1TZCA 2WUWE 121PA 3GZ4A 3SEAA 2CSXA 1XELA 3FIJA 3N76A 3TM5A 1WKCA 3CNHA 3KQUA 4L72A 4ESHA 1U9ZA 1V5WA 4KGDA 1Z5UA 1DOZA 4KLRA 2ZBVA 4BC1A 1D6NA 1Z6PA 2PMCA 2FN7A 3KYIB 3ZY2A 1Y6RA 3KXIA 3MOGA 3OTQA 4WERA 3F6YA 5FBRB 3KJQA 3MYYA 4KC0A 4EF6A 3HCBA 5EIFA 3KB1A 3WOVA 1HE1C 3ZU5A 2PEYA 3B51X 4DABA 1RNLA 1J07A 2BFEA 3M6FA 2PJUA 3DDCA 3C5HA 1XA0A 2VHCA 4G1UC 3HB7A 2FE1A 3DOUA 3KVNA 2J5RA 3U1TA 2YN2A 3PNMA 2BFFA 2C9CA 4FYJA 1XZQA 1T3SA 4DYDA 3A1NA 3OX3A 4XGNA 2QE7A 3MIIA 4BEJA 2JIMA 4MYDA 1JHRA 3KPYA 1OC2A 2CMDA 1SC4A 2PLAA 1X1RA 3H9BA 4OU4A 3ANTA 3DBVO 5LR6A 1CU1A 2C5SA 4PGMA 2HBQA 4C29A 1V8FA 4ZVVA 2J9YB 3ZLJA 4DWVA 1EDZA 1LDNA 3OP1A 3TG8A 3C24A 3AUAA 3OC0A 1WXHA 3RVMA 6REQB 1PGPA 1OX4B 2GEDA 3L0YA 3I05A 3SX4A 4QYMA 1J21A 4CT0A 5THKA 3KAKA 2W2KB 4Z2AA 3EA0A 4NATA 4NX2A 5FA8A 2Z5FA 4H6XA 3JPWA 2X40A 3CNEA 4ZQHA 3UPDA 1DCKA 5IDYA 2HIMA 4NMHA 3EPRA 4PLGA 1YR2A 4Q3LA 2JGNA 1GT6A 4RDIA 3SKVA 5E1DA 3PJRA 1YCHA 1V11B 3BEDA 4JDPA 1L9XA 1G4HA 4MB0A 1IH8A 3HQ4O 4WXEA 5TPWA 3IOYA 1Z4NA 3DWIA 4EUFA 1J8DA 1A88A 3DE3X 4KZKA 1DGQA 1A72A 1SCQA 4N39A 4JC8A 4D8VA 1O0BA 3FOWA 4NBTA 3I45A 3LUDA 4OHPA 2Z5LA 4WXHA 1KJQA 3LQRA 4RD6A 5JYCA 4TYYA 2VF7A 3L7BA 3V3TA 1T3LA 1J0CA 4A8JA 3V4SA 2QI9C 3K0AA 2GN4A 3RHTA 3I76A 1F38A 1IHUA 5DULA 4GGOA 1YBAA 1YV9A 3HACA 1ULTA 4J0EA 1BU8A 4G0WA 7ABPA 3EC1A 4G0XA 3H5IA 3R7NA 1S4MA 3UOWA 5AMXA 5IK2D 2IOFK 2IYNA 4O25A 1GR1A 5FR1A 2FF7A 1AVTA 1QHHB 3I72A 1YFLA 4PG5A 4NP6A 3RWOA 2QYSA 5FADA 1O96B 2PUFA 3LK6A 3FF4A 1M5UA 3GJXC 4GBGA 1F4PA 4ED9A 1T9GR 1OA1A 1FFGA 3Q10A 4W9NA 5DT2A 1UM9A 1A3CA 2HIHA 4NEQA 4NU5A 1MFPA 1HFJA 4YAWA 1W25A