2GN2A

Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
326
structure length
325
Chain Sequence
ITYDLPVAIEDILEAKKRLAGKIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFIRGAFNKLSSLTEAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDYSAEVVLHGDNFNDTIAKVSEIVETEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVIVPIGGGGLIAGIAIAIKSINPTIKVIGVQAENVHGMAASYYTGEITTHRTTGTLADGCDVSRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVITEGAGALACAALLSGKLDSHIQNRKTVSIISGGNIDLSRVSQITGLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Threonine dehydratase catabolic
publication title Crystal structures of Salmonella typhimurium biodegradative threonine deaminase and its complex with CMP provide structural insights into ligand-induced oligomerization and enzyme activation.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 122
structure length 325
sequence length 326
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2006-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn2A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn2A02
2V03A 4D8UA 3IQIX 4PCUA 4AIRA 5E0KB 2CLHB 1FCJA 1K7XB 4D8WA 5I7OA 4IL5A 4NEGA 2ZSJA 4ZU1X 5DW0A 1PWHA 1KL7A 2CLKB 3CEPB 3AEXA 4QYSA 1Z7WA 5EY5B 2CLLB 1QOPB 1TZMA 1Z7YA 1OASA 2RKBA 3VBEA 2ECOA 5B1HA 1K7EB 1VE5A 5D84A 2Q3DA 2RH9B 4F4FA 5KZMB 1BEUB 1J0BA 4HN4B 5CVCA 1KFBB 2O2EA 1VB3A 3IAUA 1UIMA 1Y7LA 3FGPA 2TSYB 3ZEIA 3VSDA 4HT3B 4ZU6X 1C29B 4I1YA 3SS7X 5I7RA 3V7NA 4COOA 3TBHA 4OREX 5I7WA 3L6CA 5KINB 4D9KA 4JBNA 4H27A 2RHGB 3SPXA 3BM5A 5JISA 1JBQA 5IWCA 4NU8X 1TDJA 4D9GA 1J0EA 3FCAA 1QOQB 1D6SA 3T4PA 1VE1A 3DWIA 1KFEB 2Q3CA 1RQXA 5J5VA 4JBLA 4D9IA 1WTCA 3X43A 2ZPUA 3PC4A 4L0DA 1WKVA 5BW6B 1K7FB 3SS9X 4D9EA 5B55A 3HMKA 1M54A 2ZR8A 4D8TA 4LMBA 4L27A 1A5AB 5CGQB 1A50B 1TZKA 2ISQA 2DH6A 4D9FA 4D9BA 5B3AA 2BHSA 2BHTA 2ECQA 1KFJB 2O2JA 4HO1X 4L28A 3PC3A 5D85A 2TYSB 4D92A 5JJCA 1A5BB 1A5SB 3VSCA 3DWGA 5I7HA 3IQHX 4KKXB 5D87A 1KFCB 2CLFB 3IQGX 5C3UA 1PWEA 2EGUA 5J43A 2J9ZB 1P5JA 1CX9B 2PQMA 1X1QA 2GN1A 1TTPB 3L6BA 4ZQCB 4WX2B 3RR2A 1C8VB 2WSYB 1J0AA 1K8XB 2JC3A 1J0DA 4D96A 5B36A 5IXJA 1O58A 4HPJB 1WDWB 1K3UB 5I7AA 5B53A 5DBHX 3PC2A 5IW8A 4D99A 3R0ZA 4LI3X 1V71A 1WBJB 1BKSB 2EFYA 3DKIA 5I6DA 1C9DB 1J0CA 3L6RA 1UBSB 1TYZA 1V7CA 1TTQB 2GN0A 4L3VA 4OFXA 1TJPB 2D1FA 5DW3A 1KFKB 5DVZA 2DH5A 4D9MA 1TZ2A 2J9YB 1V8ZA 3AEYA 2CLIB 2Q3BA 4XUGB 2CLEB 3R0XA 5D86A 2C2GA 1TZJA 4HPXB 5DBEX 4AECA 1UINA 2GN2A 1FUYB 2C2BA 1CW2B 5HBGA 3VSAA 4D9CA 3VC3A 1K8YB 2CLOB 3PR2B 2J9XB 5T6MA 4D97A 1E5XA 3X44A 4Y6GB 5B1IA 4D9NA 4LMAA 1K8ZB 2CLMB 2TRSB 1F2DA
chains in the Genus database with same CATH superfamily
4XR4A 4F1JA 1QXSA 1PLKA 1O8CA 2VXOA 4KN6A 3TUJC 5KNDD 2VAWA 2OOKA 3FBWA 4EECA 3ZHOA 2BFFA 3NTOA 1MAHA 1G0NA 2HJWA 4TGLA 1KDYA 3NTXA 4N6GA 5D51S 1X38A 4UU7A 3I6MA 3HHPA 1ECBA 2ZBPA 4OU4A 1ECLA 4TRMA 4V0KA 3GVIA 4UD2A 4X00A 5DLDA 1EVQA 2AJBA 2OAP1 3CNOA 1INLA 4IR7A 2HBZA 1F1BA 4BLQA 4YLYA 5JQGF 1YQXA 2QZSA 2REQB 3PHIA 5FUXA 3WL5A 3NBFA 4ZJYA 2YXBA 4QRHA 3I3SR 3RRFA 4YUAA 4IDNA 2PUAA 2QYTA 3A1CA 2XQVA 1T4DA 4EGFA 2O8EB 4CCWA 3FSJX 1MJ5A 3G2MA 4I4TF 4CHGA 1NPDA 4ESVA 2OCDA 4AZVA 3G7UA 1F2TA 3ANMA 3N58A 5C32A 2FMIA 3BRQA 3F8WA 1MORA 2FWAA 4GQAA 2B21A 1AV6A 3HJBA 4XTRA 4AP9A 3IOMA 1G9XA 4E7OA 2YW9A 2PZLA 4DEYA 5F9FA 2VHUA 4YRZA 3UWPA 4Y98A 1M6HA 3GXOA 2C5BA 1RRGA 1I2CA 3LY5A 4KOAA 3ZHXA 3RASA 4FFWA 1Z5GA 4L0QA 1V47A 2ZPTX 4L8FA 1X8JA 5HM6A 5TVGA 5EMNA 5J63A 3GB9A 1QK4A 2BMEA 4HK4A 4RV5A 1DEOA 3AF6A 3TS1A 2RK6A 1WQ4A 1NBMA 1F0KA 1PS0A 1IHUA 3PFIA 2AUMA 2B9VA 2XDWA 3DE5X 4MLDA 3SXJA 2GMWA 2ZR8A 4PG5A 3NG1A 2GZRA 1D2RA 4NR0A 1E1RA 4Q3CA 1QP0A 5AKIA 4ZO7A 3B1WA 3QPWA 3QSGA 2YJGA 5I8PA 3IMCA 3STYA 3KYCA 4D9FA 4D8VA 2Q4TA 1JIIA 1YZLA 1TZCA 2ECQA 2WAXA 2DGDA 4P32A 4F0JA 4WBNB 5J4KA 1TC1A 5EXXA 3IC5A 3QXXA 3U4MA 1GTVA 2XUQA 4EMSA 1L9XA 4E11A 3TJMA 5G0TA 4RZUA 5C51B 4QFMA 5DBIA 3NTRA 5ALWA 4ZYZA 1I3MA 4URHA 3I05A 1FVXA 1GFSA 3LPDA 3OJEA 3QE4A 5AQEA 5H16A 4C3OB 2WZDA 1CRWG 1VCOA 4N3BA 5JT1A 3CW9A 4E21A 1S01A 2O4UX 3EDQA 4KAJA 4KPGA 3VGPA 3OTOB 1CUSA 3EVFA 1GPYA 2C54A 4RHEA 5LZ4A 2BUBA 1XEXA 3T3MB 2R47A 4KR0A 1QYVA 3NBMA 1U5BA 1VYTA 2Q7DA 4KQMA 3GUCA 1VKHA 2WAYA 5JFOA 5CB4F 4XB6B 5IRCD 1QFJA 1SXJA 3QFCA 2ZRBA 3KOYA 1FSFA 1WB4A 4LY3A 4BQPA 1PNVA 1VPLA 2IHJA 4IG9A 4TTRA 4G84A 1IHPA 1UKCA 2NNWB 4JLBA 5JY6A 3KQUA 1HKUA 4XEUA 2P4HX 3BFXA 4U1RA 2P5YA 3D7NA 1L4LA 3EY9A 4QJ5A 1BQ3A 4P38A 1KI9A 1ZM4A 4LYFA 4HSGA 5KNBH 2V3CC 1DKUA 4WNAB 5D2CA 2Z6VA 1HTBA 3IP6A 3O1HB 4PCAA 3PXCX 3I23A 3PYLA 4DDHA 4DQXA 5JNLA 2HA3A 3H8JA 1YS2X 2WJVA 5DHSA 4A27A 2I4OA 2WOJA 2Z2ZA 3PUJA 4ENRA 2P0EA 2V58A 4JLVA 1SUWA 3TOZA 4QT4A 1EP9A 2GD1O 1NA5A 4LHWA 1FRFS 3RDPA 4KUHA 1R0ZA 3MGGA 2ZUCA 5HQ3B 2IH2A 3ZHUA 3HEBA 5ALVA 4AKGA 1GTRA 1YOVB 2BCJQ 4Z0HO 4BNHA 2EP7A 3PHBE 1T9DA 1F9EA 4YFYA 2V03A 5E7IA 4D8UA 4RZHA 4M37A 5IVDA 1KTIA 5ABPA 4HH0A 1U7TA 1I7SB 5ETJA 1MTZA 1T4MA 4PU0A 2JCYA 3FCUB 1WXIA 1OMOA 4LGCA 5DEIA 1KI6A 4K6OA 1HEIA 2X9NA 3E9RA 4RFSA 1KEEA 2GCIA 1UL1X 3FMGA 4GR9A 4UHKA 1OASA 1XROA 2F9FA 3GRZA 4JENA 2ZE6A 2VO1A 4PX2A 3A3KA 1BEUB 1MT3A 3IP7A 1TUBB 2WIJA 1G9TA 2OECA 4ZCTA 1KK1A 1HT3A 2DCMA 1AHNA 3DEHA 2QX4A 3GLKA 2HU8A 1XZJA 4OSPA 2OBBA 4ZVTA 3GP8A 1C0LA 1XN1A 2GLXA 4WV3A 2D1QA 1W5FA 2I2WA 2QTLA 3R4VA 4TV8A 1GUAA 8ABPA 1P0PA 2ADFA 4LW8A 4W63A 4IY1A 4MCHA 3C3KA 2JB9A 1GZUA 1VIMA 2A57A 5ALLA 5EZYB 2ILVA 5K7SA 2FMFA 2XXAB 2PNFA 5IC6A 4Z0TA 3I12A 4NHEA 1CQPA 5EMMA 4ANFA 4ZTUB 3G6WA 2XCQA 4GM1A 1O97C 2X9GA 1C9EA 4I50F 1RVDA 3FTFA 3WVNA 1HYGA 2XQKA 1X70A 2PZKA 4O2AF 4UBJA 1U7UA 3OUUA 1EB9A 5CFZA 1XVTA 1FXUA 1G8MA 1NVUQ 1SHTX 1QMPA 2W7TA 3GROA 3OZCA 4Y6LA 4BWGA 1HSOA 5JD3A 3T12A 5HF8A 4E1VA 1RC1A 5C4GB 1RAGA 5EHIA 4QQFA 4NMXB 1XRSB 3EBOA 1RWOA 2CLSA 5CLHA 5FL7D 1II9A 3LFUA 1EB8A 5JAMA 5M34A 3U4QA 4O2BA 4C88A 1DARA 3BK7A 4CUJA 1XQ6A 5JWRA 5HXAA 1H6DA 5HKBA 1MZPA 4DBZA 3ORSA 3RUAA 5JBQA 4GLLA 2GPWA 2PVSA 2HLHA 5JFTA 2AI2A 4TTJA 3AVUA 2XA1A 4ZJUA 2VHEA 4EZEA 4BX9A 5A0FA 4XLZA 5TPZD 2W2TA 2ZIGA 2X6RA 4LKOA 4MQ4A 2O8CA 1CY1A 1U3FA 2WJZB 1RWQA 5FAXA 1VJTA 2ARKA 2VQSA 4ZJPA 3CR7A 3IEPA 1GVNB 4IZOA 4MB2A 2BMWA 4J94A 2I3ZA 5BR8B 3U61B 2ZZNA 1WU8A 3COWA 2D0OB 2UYQA 1Z12A 3TLJA 3G2LA 4EGAA 5AVWA 3NRBA 4PSCA 2OOSA 1RJ9A 1Z7BA 1W1UA 4DVJA 2BKEA 4HWKA 4BQRA 1AD2A 1LY1A 2FEXA 2G04A 3OZTA 5FO1A 1FFCA 3H9JA 1U8EA 2J5XA 4C3VA 5F3WB 5JOQA 4EO9A 5AR1A 2VQDA 2Q3BA 4JI2B 1UBEA 1UK8A 4MW0A 4AMYA 5KC9A 2IXDA 3NPMA 3KJQA 3TNLA 1L5QA 1W46A 2W6ID 1AZTA 5FBHA 2P77A 4C4RA 5EE5B 1ZRHA 1JEOA 3X1KA 4LF4B 1Z7GA 1Y7HA 2JFBA 2VJMB 5AI0A 4MVJI 3UH0A 4A2CA 1G5FA 5EJAA 2J5KA 4AKEA 3WB9A 5EVJA 4DLVA 1R2QA 1YR2A 3AXSA 2H8GA 3MT8A 4JJ8A 1CUUA 5A5EA 4Q1BA 4E5NA 4BOYA 2AZTA 4YMSA 3RUIA 1CE8B 4GO1A 4QGHA 2XKAA 3HEMA 4DLTA 4MLPA 5K05A 2ZQZA 4L5CA 2GPTA 2VYCA 3CYFA 1XZLA 3UWDA 4DZRA 2WHPA 2I71A 3UAVA 2F3UA 3SP1A 2PZJA 2BTEA 1LBTA 1VYUA 1MB3A 2XNJA 1U28C 1AA9A 2BR5A 1IMOA 4UREA 2A6PA 4PFKA 1RRFA 4HRXA 4XQ0A 4K6HA 1DLJA 3WLEA 2OXCA 3RF6A 4ETIA 2VT7A 3AJEA 1XPUA 2Z6QA 1IEWA 2QMYA 3ADOA 3N6RA 3U60B 2GRJA 3VDNB 1SXHA 2PKRA 3UW1A 3QU7A 4ALNA 4AY6A 4JBYA 1E4EA 2I8AA 2XGOA 1LBQA 3E03A 5EKSA 3WJ7A 4C21A 3HM9A 4YREA 1QG2A 4IH4A 2DBZA 5EESA 1VLJA 5ERXA 3RYFA 2LE0A 3EC2A 4X45A 1RHUA 4M53A 4DV1B 5LD2C 3R8FA 2P6RA 3R8CA 1S5PA 2UXBB 2ZU6A 1BDHA 4RA9A 4KQKA 4F9TA 1RHRA 4MV5A 3O9VA 4ZO9A 2BOVA 3H1GA 1UAGA 2MTBA 1C3LA 1KPIA 3GN2A 3GLQA 3K6SA 1AXGA 3EPPA 1HG0A 2FSHA 3GELA 4F46A 3OC0A 4F5ZA 4EY6A 4RCZA 1K7FB 5J2UB 3TRHA 1JH9A 1OKKD 1JHPA 1XZHA 2A5FA 2IYNA 3HJAA 4YR9A 4YT2A 4Y0VA 5HMLA 3LVBA 1TIBA 1QG6A 3KUCA 4UC0A 2BFDA 1PQUA 4YAOA 3KT8A 1IJBA 3DV0B 2X0KA 1H9BA 2WSMA 3QYPA 2AS0A 3BC1A 4US2R 1QZ3A 1Z5NA 3SQDA 1V3QE 4M21A 3E3OA 1XZKA 3T52A 2VKQA 3C6BA 1GU0A 1SKAA 2W2LA 1WZUA 2UVQA 5JYDA 3ED5A 3COVA 1CY6A 2PU5A 4QGFA 3G9QA 2ID9A 3MLAA 4GQIA 3RM3A 4BNMA 2DTXA 4MYUA 4Y0NA 1SKQA 3VZBA 4CIAA 2PH7A 4EEXA 2J5RA 1NI3A 2O9JA 3CRZA 2CFOA 1HDZA 4OI0A 2X1LA 1WDWB 1KWKA 4E14A 4OATA 4ESEA 3P0JA 2NUAA 4DHEA 4Z4GA 3ZW9A 2JJ2A 2C2HA 2C4NA 3MWDA 1T4CB 3G9UA 3HABA 1E2JA 1SELA 2XRFA 2ZJBA 1LVUA 3BJEA 1ZA1A 1ZMRA 3GJRA 3R09A 2NG1A 2IYXA 3PD1A 2EDAA 2JAOA 4OHPA 4AS2A 1CLEA 3D8SA 1NIJA 5C7LO 5KOIA 1DGQA 1HDXA 1A97A 5K09A 1JYEA 5A6SB 2GAAA 2R00A 2FW7A 1O97D 1ENPA 3K1JA 3ZE2B 1X3SA 4IS3A 3LPCA 1E79A 1GNRA 4J7AA 5L7TA 1NBOA 5CFQA 3ICQB 2OXIA 2HO5A 2YVAA 4LDPA 3BH7A 4NENA 2RAVA 3WGJA 2JLYA 1ZR4A 1ZOIA 2DPMA 5AI8A 1D3AA 4BMDA 1GFIA 3AEKA 4OHUA 2FW6A 3DNMA 1NQWA 4ZT6A 1HEUA 1Y3BE 1KP3A 2Q0QA 4D6XA 1BCRA 1BG6A 4ACBA 4NCNA 7YASA 4QODA 3OT1B 2BGUA 3H9UA 4F4UA 1JSLA 3M6VA 4YRFA 1VBMA 9LDBA 1JN0A 3NX4A 3I0MA 5LOVB 5EAIA 1KDTA 1F0NA 1EP2B 1E3WA 4MVYA 1CHNA 2DT5A 4I4LA 1W6UA 1ZLYA 2O0JA 1VXOA 3WP0A 5K03A 3FKQA 3DDCA 4PEVA 4YJGB 5E9JA 2YIVX 4RS3A 4BPRA 4DUYB 3GO4A 2IEAA 5GM2A 1RPZA 1EXDA 1JFLA 1ABBA 2HGZA 2DSNA 2WFLB 1I6LA 3CNNA 3EFOB 3FH0A 3I72A 3QELA 4PAOA 3V8QA 3Q72A 3V7UA 4U2EA 1D2AA 3N2GB 4W7IA 1R4MA 1QWSA 2XMRA 1T9ZA 4LJAA 3SC2A 2BWJA 2CE7A 3G2HA 4UCXA 1D1TA 1GKYA 1XZFA 1HKHA 2XXBA 2IU3A 4P4NA 4Z3DA 3U5ZB 1N34B 4EEKA 2WTAA 4HGQA 4QDOA 3HP1A 1AUVA 4B09A 3DB2A 1ST2A 2NSDA 1CDDA 2Q4BA 3RVLA 1THTA 4P54A 3PT5A 4QVKA 2ZUWA 1ZMXA 4DIEA 3O8RA 4M55A 2HY7A 5LLDA 2OLEA 3KVYA 2O59A 1FDSA 1HDYA 3RAGA 4XVUA 3JQAB 4V0ME 4BLOA 1BROA 3ORFA 2MT9A 2WM9B 2WUVA 5EHNA 4IDGA 1GZ4A 4MARA 1Q5PA 1CT9A 1II0A 4HEQA 1OZHA 4WW0A 3H2BA 4X20B 1BGXT 2ZI5A 3LDHA 5FFFA 1NR5A 5BYAA 4KQ9A 2DKFA 4ZREA 3WL7A 1QH8B 2FX2A 5P8WA 3TLGA 5LP1A 1L5SA 1MCZA 1UZLA 4H3SA 2UZ3A 3EISA 3GRKA 4WOKA 1E0KA 1B2LA 3ZDCA 3X1ZA 5FOUA 2OCXA 3CRQA 4HTAA 1VG8A 3DZBA 5CM8B 4Z3OA 3L43A 1GV1A 1VA5A 1NM5A 4INZA 3DCIA 1T43A 3R3XA 4FJ1A 4YUVA 3BTUA 3OCWA 3CBQA 1JHYA 1SIOA 1X94A 2L42A 3ED1A 1IDN1 3QU4A 3L1UA 5ILOA 2UUBB 3D7RA 1SD1A 3DE0X 1Q1GA 2JCSA 5AYVA 4DHWA 2PX5A 5CA1B 4GKJB 2L82A 1VFNA 4M1KA 4QXAA 5AUPB 4PX3A 3HV2A 4CL2A 1B73A 3MJSA 4J3FA 2C5FA 2XT0A 2BGJA 1XZAA 2TECE 4P33A 3O90A 1EBBA 2AGVA 2NTNA 4MS1A 4CM5A 4YT5A 2ZRLA 2WJ6A 1ECCA 2WYHA 1ZQ9A 1W5AA 2QD2A 3KUXA 2E1RA 4AY5A 1X39A 4ZARA 3HDTA 2HDHA 3UJ3X 4OJQA 3IBGA 3PC8C 1LNZA 2KW5A 2W4QA 4GOOD 4RWZA 4XYMA 4WKGA 2WJJA 4JP2A 3RVNA 3CURA 1F1JA 5HEKA 3CX4A 4DCUA 4L3WA 1Z5ZA 3I9LA 4YJ3B 3ZY2A 3BKWA 3F6RA 2D4AA 4PZCA 4BUCA 1SZDA 2FXVA 4NYJR 3O8CA 1H65A 1XMQB 3IBTA 5I47A 3PDIA 3EGCA 5DEOA 5IN4A 2QM8A 3MCZA 1RXWA 1HI9A 2VRCA 4S3MA 3UJCA 3QNWA 4MV9A 3HXQA 1JEYA 3TQOA 4AF8A 5I9LA 2ZBRA 3AY7A 5PGMA 1YNOA 2Q3LA 3SM9A 4DPMA 2NV6A 1LJLA 5I9BA 1TEXA 4J0EA 2PBFA 3PEYA 2GB4A 1G8YA 5EXPA 3W78A 3S55A 2HJRA 1JR3A 3W77A 3V2GA 3MQFA 2YXNA 5BN3A 4U2DA 3BTSA 1AS3A 5KZMB 3THXA 1M7GA 3RRNA 1K2WA 2H5IA 3L0SA 4G5GA 5E6RB 4HF7A 1K97A 2Q9BA 3F5SA 1JZQA 2C9MA 1J8MF 2ZSEA 5F2NA 4A2WA 2WWHA 2QZPA 1IOWA 5D6OA 2COUA 5AP9A 4Q48A 3NT2A 4YLGA 1KQOA 3BS4A 4YT4A 4KV9A 2OL4A 4Q7LA 3AY6A 3EEIA 1PS9A 2QLLA 1MRNA 4C6SA 2XY4A 4JB3A 5ADHA 3DG9A 4L02A 4U8GA 2VWHA 3IRVA 1M8FA 3U4CA 4UULA 3LC0A 5AESA 4DDTA 1KNXA 3IMFA 3OOYA 4X6LA 2WIFA 4CIYA 1TQ6A 1VHDA 3RLIA 1YZQA 2FRDA 3LK7A 2ZI4A 4QOFA 5JEEA 4KBGA 3HFSA 1U99A 1P4GA 1P7YA 3Q2KA 1W44A 2R5WA 2JGJA 2QAIA 2C59A 3AFOA 5IUNC 3JYLA 4XYLA 5CPBA 3B6MA 3SJCA 3G23A 4G3XA 1ZHHA 4L15A 3YASA 5L3RA 1CEXA 4DJFC 1P9NA 5A5FA 3CWZA 5DLYA 2V0GA 3WNVA 5KYYB 3MS7A 3IAHA 4I9UA 4WWHA 4DIOA 1PQWA 4POOA 1I7DA 4V1CI 3WQQA 1VG0B 4LYAA 4JEIA 1Q7RA 4OU5A 4Y9RA 2OKGA 2BKUA 1DLIA 1OI7A 4GYJA 3EPKA 2PFGA 4HAYA 1J06A 3UAZA 2BBOA 3ZS8A 1NVFA 3ICOA 3A1VA 3KDPA 3MGCA 3PUHA 5CX1B 1DTSA 5CDFA 4ADSG 1LLQA 2QRPA 1DB3A 1U0EA 2XA2A 1U8XX 4IIXA 3TMAA 1DCTA 3DWFA 4PTYA 1VHQA 1ZSVA 2JFVA 2QI9C 4QOIA 1GGFA 2XECA 3LA6A 2FZ4A 2ZRGA 3HPQA 3PVZA 4U7GA 2ZYRA 4Y6OA 2ZT6A 3H1AA 4WCFC 1OR8A 3PHHA 2PNJA 1UC4B 3CM0A 4U9HS 1UFQA 3UXMA 1K8XB 1DDOA 4JELA 3LCJA 4HWGA 1QVRA 3K0FA 4IOJA 2Z8YM 2O14A 3LS2A 3QA9A 3LC2O 2W6OA 2PWAA 1PL0A 1W88B 2J31A 3MJDA 4D8YA 4YY3B 1DCKA 4MCAA 5A4MS 3K5PA 5JRJA 3LY9A 2GN0A 2C3MA 3MUEA 2LGJA 4RKWA 1E32A 4NK5A 4X63A 4ENQA 4RWEA 4OH7A 2VJYA 4YAWA 5BT9A 2FAXA 3FNQA 4PFSA 3I5MA 4U02A 4IOMA 3FPGA 1KTVA 3FBTA 3ZS9A 4ZDKA 3FRJA 4YA6A 3LNCA 2WVHA 4UTRA 4O0LA 1AKUA 3BL6A 1E5LA 3A04A 1PG5A 2F17A 4PG4A 4QC2A 1N3BA 4Z2YA 2WG1A 2MYNA 5IBQA 2R6GA 3OJCA 4N6OA 4EL5A 2KYRA 2C7PA 4BZZA 5KDOA 1Y1QA 1YFLA 5HWSA 2XLBA 4M1QA 1J5XA 5ICMA 3JYNA 3I37X 1PS8A 3ZXYA 1YB1A 2NOAA 1R0CA 3W5DA 1I6MA 4JYMA 4ZWNA 2NU8B 3GFBA 1AF4A 1PD1A 1SY7A 4KRYA 5JMWA 3JWPA 3U3OA 1UAYA 1C7JA 3G1TA 4E2ZA 2ORYA 1E61A 3CT6A 3M8KA 1GYRA 1JTEA 2JLAA 4B6FA 4O5AA 3DF7A 2RKOA 4GUDA 1FX0B 3VI4B 4WZ6A 1X7XA 2CW5A 1OJLA 1JGTA 1QO9A 1E2FA 1IWPB 1OI2A 1X2BA 1Z6TA 1DWOA 3H1FA 3H5RA 4IWXA 4MR8A 4PC7A 4JUAA 3BHNA 3IT1A 4QATA 1R00A 4QBHA 3D3EA 2NQ8A 4IJMA 2O7QA 4H16A 4PZEA 4O4IB 5CBPB 3TK1A 4IJKA 4RF5A 3NMUF 4MWZA 3VYVA 5LYJA 3E5RA 5CLJA 5AW1A 2W5UA 1N1GA 1RWBA 4GOXA 2H18A 5DOZA 3RE1A 4D42A 3U9LA 1H3FA 4J1QA 5FOSA 3TM4A 3PUWA 3QYJA 4ENVA 2WD9A 3RH0A 2ZYGA 5H02A 1N2OA 1ZRMA 2ODEA 1GQYA 3B82A 2HHJA 2Q5FA 3GLSA 4NWIA 1LI7A 3CNQS 1JFFA 2GNOA 3AR6A 2ZE5A 3NBKA 1JJFA 4I9NA 3AV0B 3IUSA 4NI5A 5E6UB 5FI5A 1JB9A 1HC7A 1YZGA 4OAQA 5E0OA 2ZVPX 5CYFA 3DAHA 4Z7QB 4FFPA 4CIXA 4CKYA 2DWOA 3HCOA 4HCJA 3SEAA 2WG0A 2ZRIA 1DU4A 4IHQA 4TXLA 2PLAA 1PLJA 5FOWA 5G0VA 4Q7KA 2GNAA 4DV6B 3BMCB 4QLOA 2ZGVA 1G6KA 4JI0B 2DFLA 2HSWA 5CTAA 4UUQA 2C57A 1JDBC 4X41A 5KYWA 1CZOA 1TECE 2CL6X 2DFVA 4J6FA 2J5BA 4PGMA 4ZDWA 5FLEX 1NI5A 3R9KA 1OTHA 1WDMA 5HRAA 1XPJA 4MV6A 1QIHA 4P7BA 1YAJA 1DP4A 3LBIA 2QRNA 3NGXA 1A2OA 1VLHA 3ZHVA 1ZINA 2OBMA 4CF3A 4H6PA 2AEMA 3RUFA 1BQ4A 1L7AA 5EMLA 3SEQA 4AU1A 3GZJA 4C6TB 4BAGA 1HQCA 2I62A 2KE5A 4Q1EA 3P19A 5JZSA 1CUZA 4JOBA 2CFSA 1V7CA 1AU9A 4KPUA 1OWPA 4K8RB 3QJYA 3JALA 1SXIA 2IU4A 4B6RA 4N5IX 4LF8B 4IXWA 3GIWA 4O02B 2XITA 3E61A 1Y9AA 5CB0A 3E18A 2DT8A 2UYHA 1QOZA 1USVA 4MGIR 1FSZA 3OICA 3PWTA 1T1IA 2JFQA 1W25A 3LQQA 1BGWA 2F9LA 4FZJA 1WZEA 3KHSA 3H1EA 4H77A 4JLDA 4RD4A 4P34A 1Z2PX 4OGFA 2WV7A 3ETGA 4D9JA 3H9CA 2PA0A 1C0EA 4S05A 1U90A 3KYJB 4PO8A 2RI1A 2BMFA 3OPYA 1XRRA 1A69A 1AXRA 1WCXA 2BMDA 3VZDA 3ZHQA 1LD3A 2QTWB 3G1UA 4ZICA 3TSCA 5DI3A 1PQPA 4CM4B 4Q9LA 3INNA 5KOHA 5GIOE 1XX6A 3UENA 1ZRSA 2RONA 4KQ2A 3WGGA 4IZ6A 2BFBB 2C8JA 2G76A 3UMRA 2QQEA 3ESBA 3OCXA 2JDIA 4B0OA 1QM5A 2VZ9A 3U7QA 4EKYA 5JECA 5ALMA 5FL3A 1A8HA 1H5UA 1WB6A 1MX9A 1BU8A 2H4YA 3C4VA 1Z9BA 3HFRA 4I46A 4L4RA 4DMLA 2QX6A 4GP9A 2FRXA 4I4TB 4KB5A 4PLWA 5FDFA 2J46A 3OA0A 3FHLA 1ZH2A 3EQ8A 4M8IA 4OIMA 3U4HA 1L8OA 1XVLA 3WKEA 1I36A 1V35A 5CB6A 5I7FA 1AQIA 2C88A 2G1KA 1ORDA 1U2DC 3JQ9A 1JHOA 1M66A 1XL0A 3OFKA 3X1YA 3ZGXA 4IFBA 4RVGA 5JS8A 2BFAA 2GJAA 2W0MA 3ANTA 1UPFA 1Z4PX 4MW1A 4RKYA 5FULA 3WISA 5HM8A 3VR0A 3F3KA 3ET4A 3MD0A 4KQXA 4Q39A 5KREA 4WFKA 1HQKA 4R2WA 4YRAA 2PX2A 3H04A 4GYYA 4CQMB 4MGHA 1UZNA 3LF1A 1SIWA 2JD1A 4E4YA 5DHTA 3UFXA 4UNNA 1A2BA 2CC2A 2X4IA 4MQBA 4ALLA 4Z4HA 4LSGA 4JT9A 4MI9A 1DUIA 3JYQA 4Q1VA 7REQB 4XR9A 1V3VA 1J42A 3CPHA 2QN9A 4PY2A 4ZAYA 5HUQA 4A8JA 4EB6B 1SD2A 3EIHA 3KKZA 4KXVA 4JYCA 1UXKA 3JSXA 4XD2A 1P7PA 5HP4A 4FYHA 1PL8A 2JFFA 3D4PA 2I99A 1BS9A 3VR2D 1K6IA 2XZOA 3ULKA 4PN3A 4L28A 1QZTA 2Q99A 3EWNA 1GRRA 2BFFB 2ZTUA 4TKUA 3EODA 3GBVA 3W6OA 4ILKA 1JVNA 2YYZA 5JJLA 2GAJA 4KRXA 1BHO1 2OWEA 3D7MA 1TKBA 2XX3A 3FFTA 4D46A 4TWRA 1OFVA 1RQGA 1ODTC 3SLRA 3TZLA 1MOSA 4JWKA 2HR1A 1TTPB 1IONA 4ZQCB 1XFDA 4INAA 4BYGA 4DV5B 1IXSB 3CH4B 1VE7A 3LX5A 3SX0A 3S81A 2B7CA 4JC4A 2CXNA 3CINA 4UATA 3FDFA 2ENUA 1JU3A 3RD5A 1Q57A 2FB9A 3AU9A 4E70A 2RH4A 2ON6A 3BFKA 3JQQA 2SCUA 4AKHA 2GKOA 1CY4A 3JQ8A 2D2IA 2I55A 3INTA 1N0VC 1F2TB 1EQ2A 3QOXA 5GOTA 1BE8A 2YWJA 3A1TA 2H4WA 3O9ZA 4RE6A 2ZRHA 1ILEA 1M6VA 4EX6A 4MQ5A 4GKKB 4IUCS 3D31A 3T1NA 2OTCA 4EUSA 2XZLA 3K2EA 3MPUA 1T9AA 4CMAA 3ZCQA 3ZGVA 1ODCA 4LVCA 3ZU4A 4C4TA 1NIPA 5AOCA 1SCNE 4TM8A 1G8HA 4RETA 4LX8A 1BJRE 4LGMA 4MUFA 1BWRA 5JADA 2W2VA 1NXTA 3C3AA 3O4IA 4PZ0A 4R9SA 1JDPA 5HG0A 1VPVA 3IFSA 2ZB7A 2FZEA 1IQRA 2P1DA 3SYMA 3BRWD 4CM8A 1L4UA 2C3YA 3KYCB 3IT2A 1ETUA 2QRUA 1ZIPA 2JFWA 3DBVO 3V1TC 3WFIA 3EF1A 3U49A 1CF2O 1GDHA 1KBZA 4M1TA 4V2UA 2CMGA 1DFHA 4HWPA 1COZA 1O94A 3BIFA 3KTAA 1EUZA 4OXRA 2ZBQA 4GS5A 2NYRA 1G8FA 1P9RA 3AFMA 3B8HA 4W8GA 4Q01A 3ZWKA 3DBLB 3EZFA 1NP6A 3FWPA 3Q15C 5GY7A 3VVCA 1PZFA 3GAMA 4N41A 2W2PA 3M6LA 5KWJA 4DNFA 1P2VA 4MKXA 3H6GA 1U5BB 2EBFX 4NFSA 3N0TA 3LW7A 3PNYA 2C7RA 1T36A 5AI9A 1YS4A 1U5AA 3AFHA 2QMEA 4IEEA 4UVHA 3GEBA 2LW7A 3CR3C 1SXJB 1LVHA 1VDMA 4H27A 1UZAA 2YWEA 2E37A 4Q3KA 1J9GA 4LXTA 4PPGA 2PX0A 2W4IA 1A2KC 5JISA 1DBWA 2FUG6 1VLVA 5ES4B 2YMLA 4ND6A 1ISIA 1O87A 4Y18A 3R9WA 2FUG1 2FQ1A 1P39A 1XK7A 2ZUUA 3RHFA 4LRWA 1ZYUA 3OKAA 3JZAA 2CXPA 1A8IA 5KHLB 2D7DA 3DQZA 4MO9A 4OK3A 4YCAA 2VN8A 4NARA 1Y9ZA 2XHEA 1KKUA 2A59A 5D7NA 5B55A 4D9EA 1WMFA 4YAFA 2OILA 3JX9A 2ORWA 1FFXA 2YFYA 1CCWA 1UPXA 1RJFA 2AYZA 3A8TA 4QICA 5HCUA 3D6FA 1YVPA 1CUXA 1NF2A 2P69A 4ZXFA 5IVPA 4EB8A 4WPGA 4ER3A 1FUIA 2DWQA 2OP1A 5FI3A 2Q4EA 4XE5A 2R8YA 4GKBA 3VQTA 3OA2A 2VSFA 3ELWA 2H2IA 1GUBA 3E5MA 4YRJA 1A5BB 1E0JA 4I36A 4E12A 3DWGA 1K6MA 3KLNA 3UJBA 1KI6B 1Q11A 1H4TA 1LPSA 1Q20A 4RFSB 3MTJA 1YFZA 2RGXA 1KEEB 3DMGA 2EGUA 3HYRA 5TT1A 2I7XA 1WJGA 2HCJB 2G5CA 3DMNA 3M1AA 3OLVA 4IKPA 1TQ4A 4QOEA 3HP4A 2K6GA 3L8GA 1YV9A 4TWBA 3B6ZA 2H0RA 1D6NA 2P6PA 2HCRA 1R3UA 2AX3A 4KQEA 4PFQA 1Y98A 5D1HA 3GF4A 5FUQA 1P0CA 3IMGA 4XIYA 2PRJA 4YAEA 1D7OA 4WXYB 3WIOA 2YCBA 2DR0A 4K1XA 1SHLA 1XU7A 1JHQA 3JR3A 4TV8B 3IQZA 4E3ZA 1HZZC 2H63A 5GONA 2FUEA 1YQDA 4Y2XA 1GZ6A 4RUKA 1DKLA 4UU0A 1YDEA 2IZZA 2MYTA 1OWNA 3PIIA 4BRSA 1W96A 5JBIA 1ZXBA 2GQ0A 1ORHA 3OU2A 5SYAA 2ODBA 1GGEA 2V6FA 3GRCA 2F67A 1ORTA 2XQGA 3ZIDA 5HIMA 4TV9A 2V5VA 1C3XA 4R7GA 4I5DA 5BV7A 5DBEX 1FU8A 3AP3A 2IOHA 2Y6UA 3WJAA 4G0QA 3A1FA 2Q7XA 5A1JA 3GMSA 3E53A 5AVKA 4JMLA 1M34E 2PMCA 1ODJA 2AN5A 4RA6A 4EJFA 1P2GA 3WLOA 2YVQA 1FP1D 3SQOA 2VRBA 3TO5A 5K3EA 3SKVA 4BO6A 1CG6A 1HPLA 4XW2A 3DEKA 1I9CA 4GF5A 4DQUA 4U9UA 1W93A 3RT1A 3UMVA 3BXZA 1JE0A 3K9WA 4KUGA 4O2BB 3U4QB 2ZYTX 4N3AA 5FOQA 3B2QA 2QRHA 3U6BA 3TAXA 3IDSA 5AH0A 4BMYA 5HKKA 3ER8A 3QVKA 1QQAA 2YJZA 4Y2YA 3V33A 5LJLA 4OUDA 1ZD3A 1N75A 2I76A 1O4WA 3I01M 1JG6A 2WKRA 4BJHB 1BE6A 2IXBA 5A3SA 5EJMA 5DNCA 2X4GA 3CMMA 2G1UA 1P80A 1QFMA 1PL7A 3DKVA 3PC6A 1LA2A 2R66A 4P3NA 2O8CB 2WAOA 2OV8A 2QT9A 3DWEX 3KAQA 1C7EA 1EGMB 1M0SA 3Q12A 5B3JA 3VSDA 5A06A 4B3SB 2KHZA 3W90A 3FETA 2O54A 4OO3A 2KLHA 5J4YA 1Z74A 4GRIA 1ZD1A 2LKDA 4FCTA 3W79A 3QIVA 5KJ6A 4HAVA 4M9QA 1RZUA 5C3MA 1JAIA 5BSGA 4R54A 3L3BA 1RJ9B 2FX5A 4Z9YA 5JD6A 4K8OA 4ARZA 2EL7A 1X1BA 4G0OA 4LMRA 1EWTA 1I1HA 4OQFA 2E6UX 2HPHA 2P1RA 2X42A 1G4AE 2AR7A 2ZJOA 4HS9A 4V0MA 4TS3A 6ADHA 3DE3X 1KC1A 2Q0XA 4R69A 5G40A 4E88A 1ADYA 3DMYA 2LZ0A 2GKGA 4PQFA 2WYUA 2A9KA 3T5GA 1COWD 4RPJA 1TKRA 4CF7A 3KB2A 1LK5A 3LC1O 1KVTA 1TL7C 3P2KA 5EMJA 3KR2A 4BGUA 4EY3A 3VX3A 2H0AA 4KPFC 2NZ2A 4TVOA 4YJHB 2A5JA 3SHFA 3Q5EA 2X7HA 4MV8A 5J4LA 1W36B 4Q15A 1C7QA 3UB4A 5JYEA 3OQ6A 1EDBA 2ZUTA 4G0UA 2GD6A 2BZSA 2ZRJA 4C06A 2P4UA 5JUWA 4OJMX 3O3MB 1DJNA 3GEEA 3H5LA 1PFVA 3HRIA 3N0WA 4J3JA 2WHPB 1H2WA 3AR8A 4U0KA 4ZYXA 2PS3A 1T34A 1Z4NA 1JKIA 2QU8A 1VJ0A 3QBDA 1V45E 3S1LA 1HE8B 1D09A 1XRMA 3IHKA 4Y6PA 5JMOA 1KSFX 5CBKA 1ULZA 3RSQA 2I2DA 2M32A 2WFZA 3KWMA 4N54A 4NCJA 3TIXB 2OYSA 4KE8A 4DDVA 2C5EA 4R1PA 5BUCA 1E4EB 3K8QA 3RJ5A 2C4WA 1CR2A 1FOEB 1BJKA 2BHNA 3HI6A 2YQZA 1SN7A 4ZV7A 3RYFB 2JRLA 4D0SA 4GL2A 4OFXA 4X24A 1R10A 5GGXA 1W5BA 4KFRA 4MI1A 4MVJD 4DKJA 3ECSA 3OF5A 1NT2A 3HCNA 3LL4A 3P2OA 4HDAA 4RA9B 3WG9A 1YVRA 3NHSA 2QQ0A 5DM70 1FNDA 4GGOA 4KLCA 4WZZA 1CIPA 3K6SB 4TL6A 1FJ2A 1MKYA 1UXOA 3LKDA 1XDBA 4FHGA 4UHEA 5JAQA 4EEZA 2O5EA 2D7CA 1Q95A 1Z6GA 2PMKA 2VHWA 5EIXA 4L76A 4PO3X 5HX7A 3RAFC 1W4AA 3HWWA 3D3WB 1S7GA 2GGSA 2BFDB 4AZ0A 3I64A 4P4UA 4YECA 3GLGE 1IE3A 3OLWA 4PZYA 5IJ0A 4H7JA 3IAS6 2C9OA 3OJOA 3HCRA 1FCJA 3IAS1 4M8LA 5IULC 1P75A 1Y0BA 3DMHA 4RELA 4IYRA 2NN3C 2RGAA 2GEVA 1YGYA 4BLWA 1KAOA 2CLLB 1XCGB 4RNDB 1LTQA 4DIKA 2ZTMA 4FBLA 1ZD5A 3F2VA 3SEFA 2PGLA 1VE5A 2RH9B 5HMMA 1J0BA 2ZVDA 4TVKA 1VRVA 1V41E 1NYLA 3N74A 4WACA 1N3YA 5DH9A 4KREA 1T5OA 2GD0A 1NF9A 1ONPA 2X8LA 4O8CA 5K3AA 2JKVA 2NUAB 1UJNA 3MWDB 3RU2A 4ZGWA 4A6DA 2Y1LA 4ZOBA 5EJ7A 1E8DA 1PW5A 3ZJTA 4TPKA 1I6KA 4IQ8A 1Z26A 2Q2WA 2Q9CA 4GI7A 5K0TA 4UZFA 2LP4Y 2FR0A 2PEZA 3UJ7A 3CF4G 4DA6A 4MW9A 3L0YA 1IM5A 3KOZA 2ZVQX 3I39X 3BWYA 5JVDF 3DYVA 3DAFA 4PLHA 1TCVA 2FEWB 2Q6TA 4EWLA 5BR4A 1T4BA 1R9NA 2D1SA 2DUWA 5B6PA 4KX5A 1BKDR 2G72A 2WIKA 3E9NA 5C8VA 4NENB 1FYEA 4NMHA 4UEKA 1DHRA 2V6MA 5EWLA 3BGDA 3M2PA 2WJ3A 3AF1A 3EXG1 3L8EA 3V55A 2CK3D 5HOEA 3AEKB 3HH8A 1WS6A 4P9NA 3A37A 4QO8A 4TMWA 5A4FS 2JCGA 1BCRB 2O2SA 3PFWO 2DUMA 2HK9A 2FDRA 1KOGA 5DCUA 3K94A 3DV9A 1R6BX 4I08A 1E77A 4RLFA 3JWEA 3H17A 3KQYA 4QOJA 3ROKA 1DBRA 5B3AA 1KDPA 4UZSA 4DCNA 3SQXA 1J9ZA 1E3WB 2BHRA 1WDKA 2JLQA 2X23A 1TCBA 3ACBA 5FNVA 3QXCA 1R9JA 5J5CA 4ZI7F 3N75A 1K3FA 1IY0A 1K4MA 3EOBI 3DDUA 4J03A 3I9MA 2PX6A 2QENA 3EGXA 1T2FA 1L7PA 1B76A 2XQJA 3N8GA 4HGNA 4XCXA 3T38A 1JHDA 2ZBDA 3TLYA 2HGSA 1L5NA 4BBZA 4QREA 1OV6A 3TRIA 1ZVMA 2GUWA 1WTAA 3SC2B 2C9CA 4EG8A 5AVYA 2VEOA 4CG2A 5KJCA 4KQGA 1QANA 4DWVA 5JH7F 2ESRA 2YWHA 3BFPA 1FZTA 1CETA 3BXHA 4IMJB 2ZDQA 1TU0A 1ML4A 3N5KA 4HXYA 3Q4GA 4F1KA 2EYUA 1ODKA 1EESA 5JJ5A 2HH9A 3AONB 1MQSA 2P9ZA 2F9MA 3QVTA 5CA0F 1VP9A 2HKIA 3ZCXA 3PPWA 1HFWA 1TNDA 1OT3A 5CH5A 4C0QC 4ZJZA 1F9AA 1BHQ1 4TMFA 2H00A 5A0VA 4PG6A 1JBKA 5EJ4A 1FYFA 1SQFA 1TQHA 1EDOA 1G98A 1YHYA 1L5VA 4YRKA 2R751 4KV7A 2JVKA 3OF2A 1R5NA 3W5SA 3DT8A 1U0FA 4OYRA 2I1QA 4PAWA 2B34A 4UHJA 3ITDA 3TLGB 4C07A 3M1LA 2PFKA 1NN3A 3DVAA 1BQEA 3G68A 4UM9B 4NE9A 1W49A 1JJIA 1JKMA 1P18A 1UWLA 2ACWA 2WVJA 2YYAA 5HQJA 4XRGA 1QJCA 2H9IA 2WU8A 3H9QA 1EKXA 1N8KA 3MYRA 5BWOA 4WZBE 4F3RA 1Y9DA 4UM8B 4C2UA 3RFXA 4JWTA 2PUDA 2VDWB 3FPLA 3FSRA 4C01A 3EZNA 1V9CA 4MPPA 5D84A 2LIPA 4MVJG 3IKLA 4NFYA 4DM7A 2QRGA 3CCBA 4PG7A 2LCFA 1DG1G 4CDMA 3B51X 4HYQA 4RDIA 3U1VA 3V1LA 4ZVVA 2GBCA 1RT9A 3WE7A 4AS3A 1A9RA 2V4ZA 4URZR 1ZIDA 4MS1B 1DC6A 1EZ4A 2HIGA 4Y9SA 4D9KA 3BBLA 3PLAE 2AD5A 4HRAA 4JJIA 2ZB4A 1IC6A 3DDWA 4RIEA 5LXTA 2FN4A 4MKGA 1Y6ZA 2I4RA 1E1YA 2RKWA 2WD7A 1GPJA 2C4VA 3HNOA 3MT0A 1CUAA 3P0EA 3R0IA 4Z99A 5DSXA 4DMCA 4GMKA 1Y5IA 5AXDA 3AUKA 4YCLA 2IY9A 4MQMA 2EFHB 3EDCA 4FYVA 1EWRA 2X9QA 3C3CA 1Z2NX 2GYYA 2QRKA 4O3FA 4URFA 3WXBA 2J9FA 4ARAA 5KTMA 2FW9A 3NC0C 1JX6A 4C2AA 2V98A 3DFKA 2HUNA 3C8DA 2BHLA 2HK6A 1EFRD 1VJGA 4YEDA 2V1XA 4IJ6A 1FLDA 4I1SA 1OXUA 2Q62A 2WKWA 3LG2A 3PVCA 4TZKA 3ONFA 3PDIB 1FDUA 4CQLA 2AXQA 4L27A 1OVGA 2IBSA 3WYBA 2H9AA 2ZJ0A 4JROA 1E98A 3C7KA 1DBPA 4QIHA 1JEYB 4J1TA 2IYFA 1OROA 3QI2A 3P71T 4IZIA 4L5YA 3W2TA 3AW8A 2ZVJA 4KYVA 1IYZA 2QI9F 2VNKA 3IGFA 3PTLA 4J90A 4EUKA 4JT8A 1ZBDA 1TJNA 2XTAA 5EZ5A 1EFAA 5JMTA 1OQAA 1ZW6A 3RYIA 3ZXUB 3IV9A 4RVDA 4B5LA 4BKPA 1LX6A 3PUVA 3WB0A 1VMDA 4MITA 4MYCA 4JLAA 4LY9A 1QSGA 4BV9A 1T9GR 3TL6A 3VXKA 3THXB 3FNIA 1LDMA 2EP5A 2ODNA 4X71A 4M0MA 3MTQA 3ABIA 4GPTA 4CKZA 4M38A 2XUPA 3WL8A 4D25A 3UXYA 5TF0A 2ZTSA 1ZONA 1M73E 1IATA 4HC4A 5GGYA 3KU4A 5EGNA 1FB5A 3RUDA 2J59A 5AVQA 4S1PA 4J16C 2GKSA 4Z86A 3U9SA 3LQ1A 4OJNA 3QVGA 1TYDE 2MJLA 4EZIA 5BP7A 3SX4A 1NVGA 4YP1A 1MW9X 3EIOA 4NBLA 5FHRA 3S3TA 2WSIA 5L7WA 4L78A 1MO6A 4U7WA 1TLTA 1HM5A 1L3CA 1N5RA 1YH3A 5FXMA 3UK2A 1VM6A 2NP7A 4C4SA 3FSGA 4XUGB 5CNMA 3AB3A 2OT3B 1RHJA 1DC3A 1G38A 2SKEA 5DGCA 2DE0X 4CLDA 5CK5A 1GN8A 1NW8A 1W48A 3CLUC 4S04A 3A1EA 3PITA 1F7UA 1KI7A 4QDJA 3I92A 1T5TA 3JWJA 1G6HA 4NEHB 4S1VA 1CV2A 2DWPA 3H2YA 3DMTA 1QU3A 1VB5A 3DL7A 4ID3A 1DQRA 2C4MA 2I1VB 3K09C 4QPCA 2QD1A 5B4TA 1DJOA 2NM0A 2ZSKA 4WXEA 1N5IA 4AO7A 5B37A 2GI4A 4CMHA 4O4JF 3FHOA 4TL8A 3UPDA 1FDOA 3OEHA 3QYFA 3VNRA 4YP0A 5A03A 3SBOA 2PL5A 4NEGA 2O8BA 1OGIA 2G5TA 4KXNA 2HZBA 1Z4KA 3ZGZA 4I5FA 3ZDXB 3BJMA 4KVAA 1X7WA 3RTAA 1Q1AA 1ZH4A 2DFNA 3CLHA 3K1ZA 4WOPA 4NAVA 3WIDA 1I51A 3GGSA 2CN1A 3AB7A 5CVCA 4F21A 1PNQA 3K8YA 2QM7A 4DSOA 3E82A 3PP8A 4H15A 1OXXK 2EKZA 2DP4E 1Y9JA 1WA5A 3C6XA 4N3GA 3LPMA 5B1SA 3K0FB 3ZJ4A 3A06A 2YYSA 1PNTA 3LQRA 2QUZA 3O84A 3PRJA 2X14A 4HDMB 1ZIOA 1MDBA 3C3WA 4PXAA 4EF4A 2GT1A 2P68A 4RIHA 4U4AA 4D0LB 3L7CA 1YL6A 4BRUA 1ZZEA 1X8KA 3KE8A 1FPMA 2XYGA 2RMKA 4LTDA 4WA7A 4OI1A 5BNWA 2BCGY 1YB6A 5FB3A 1TZBA 1EX6A 2CNBA 2OE2A 2VDPB 3DHEA 1P81A 4ALMA 2AFHA 2ASEA 3SNKA 3HVKA 3QLUA 4YLEA 2P4QA 2X0DA 5B64A 4PLPA 2GWRA 2VP9A 3B1XA 4C0AC 4HYEA 3N59A 3CEAA 4EG3A 3X43A 4HMQA 1H66A 5E95A 2J30A 5EQTA 3HKEA 4DRYA 4JX9A 3UC9A 1UBCA 1TU4A 3OFND 4LZAA 4OXKA 1GJRA 1F14A 4AMBA 2IBTA 2BGTA 4YT8A 4GVXA 1Q0UA 2I6SA 2NSHA 2X5OA 4TSRA 1GDTA 2AK3A 4DV3B 3TVTA 1BVUA 3UMGA 3PDJA 4HXFB 5C7IO 1Y42X 2OQIA 2FE1A 4Q00A 4QBIA 1UPCA 4LWQA 4LDZA 3SE7A 4Q9HA 4GXTA 3SR0A 1EXVA 1PBNA 1A5SB 1D2EA 1YB7A 2H1WA 4MKFA 1MJGA 4U6SA 4FHCA 4C1BA 3SAJA 4BNVA 2GM4A 1F20A 2A9OA 4P82A 4BQNA 5C81A 3MLEA 4DIUA 1CD5A 1C30A 2Q2OA 1DT3A 3GZ4A 4I9FA 3I2YX 4OGLA 3K9NA 4AL4A 4B3DA 4BJ5A 2FEOA 4H59A 1L7MA 3EY4A 1GL9B 3T1TA 3EVNA 1J0DA 1GCAA 1LNQA 3CG4A 3GGGA 4KW7A 4DQLA 1X7XB 1XTQA 1DMRA 5DRTA 3AVYA 5CFOA 4MR8B 2KSQA 4BUJA 3ON5A 1Z36A 1K92A 3W5AA 4LI3X 4EYSA 3A9VA 1U7OA 4RENA 3THWA 1VZ2A 3EQ7A 4C89A 5K3FA 1L0BA 5AVTA 1V9LA 1RLJA 3Q7QA 3W0LB 2IGBA 1GKKA 5LYJB 2BY4A 3CSDA 2C4HA 3BWMA 4ODIA 3ZHRA 4DNXA 4Y2VA 5JYBA 3D0OA 2JRCA 2CDRA 1ZM3A 1WLSA 4FSXA 1J09A 2OFOA 4KNVA 5KNCA 3DO5A 2IUTA 5LVAA 3NCTA 4I55F 3HBFA 3I9FA 3C1OA 2H2WA 2VLBA 1XA4A 1ZD2P 5E4YA 5FFNA 4BEBA 3T7KA 4RY2A 3MRVA 3QTBA 4EY4A 1YRBA 2BDUA 2ONYA 1M0TA 4KHZA 1O2DA 5F77A 1I01A 3LSYA 4AC9A 5IBCA 1Y1RA 4JBGA 3PFNA 2D00A 3HJCA 1HFKA 1SBHA 2C9BA 4FFNA 3A2MA 4MP8A 1KAHA 4BXOB 3R7AA 1XWFA 1TJ4A 5CIWA 3LY8A 1IEXA 1RE0A 4FQ8A 4HNQA 4UTVA 2DR3A 1ZNXA 4M2LA 2IKQA 4P4LA 4WK4B 4XGNA 3NHMA 5TIIA 1VSTA 2R6DA 1P7CA 3ANLA 1XO1A 1U02A 1OJ7A 3HO6A 2QY6A 3LHIA 3Q3IA 4B3XA 4PF1A 1L5KA 3M9LA 1HMYA 5EY5B 3RSHA 3ZD7A 5KYWB 2FF7A 4KMRA 4ED9A 1Q91A 1WUYA 3DONA 2EHDA 5L9AA 4JXJA 1GG8A 5K3CA 1XEAA 4CIWA 5M7EA 1JSRA 1GG2A 1L4MA 1BMQA 2DBQA 1AK1A 2P0AA 4RIIA 3SMQA 5CCXA 4FLEA 1NY5A 4WOCA 1T6YA 3CF2A 3VJLA 2IW1A 2VF4X 4CDRA 3TN7A 3CZMA 2GM9A 1H42A 3FOCA 2NU6A 1D4ZA 3AESA 4Q1AA 1ZHOA 1SA0A 1XV5A 2B92A 4QOHA 3PI6A 3C3EA 2XAAA 4J6EA 2FQWA 3ZOZA 1BRMA 3JQBA 1TX4B 3IIJA 2AZ4A 4FKBA 3T7EA 1FW6A 4EFNA 4A82A 4V24A 3HFJA 1Z7EA 5K4HA 2AMJA 3DXFA 1WNTA 3D3JA 3AUAA 3F3SA 3JALB 3VPCA 2X5JO 1LPPA 2K2WA 4OBBA 5EL0A 3R3VA 4TWZA 2GCOA 1U3GA 1TJ3A 2ST1A 3B38A 3EGIA 1S8FA 3GRFA 4P1ZA 4BHTA 1UOQA 5JATA 5DHRA 2G0TA 3CLUD 1T0PA 3K1TA 3BGVA 1A95A 3AUFA 4XD7A 5DI9A 3UJ8A 3CUWA 1E0DA 1R88A 5EIAA 3UWSA 4ARIA 4J2TA 4GPAA 4OHVA 3PDHA 1AKRA 1JPNA 3EZ2A 3K0CC 2VK1A 3LBAA 2G5PA 4NPHA 4FGJA 3OPYB 4QT0A 2FFRA 3QE9Y 2I7CA 1E9RA 5HFNA 2PZGA 3A6KA 3H5AA 5DI3B 1HDRA 3E7XA 4ZAXA 4YXWA 5TDHA 3VU0A 1DQSA 1XAIA 3BE6A 5KOHB 3D8TA 1FRZA 3TQTA 3QM1A 5LP6C 3RROA 3AY0A 3T7TA 4KRGA 5EJEA 4OTZA 1YC2A 2EL9A 1WCIA 2XB8A 3KTDA 3VNAA 3U7QB 1SUFA 4C0WA 3C3BA 1KYQA 2X58A 1E1NA 1THZA 4U0JA 5G1PA 4ZEVA 3DOCA 1W0CA 2EFJA 2VPQA 4K9RA 1G4HA 1E89A 4PLGA 1C8BA 5H82A 2JFPA 5ITVA 4GX1A 2WWTA 1FFGA 2WNHA 5A71A 1AZLA 4ZYYA 1WY7A 4DDUA 1LQ2A 1AN0A 1XPRA 1TM4E 4R1MA 4S1OA 5CLGA 3D59A 4R8SA 3LYUA 1Q3KA 3BE5A 1NKTA 3CNHA 3G5TA 4LXUA 4PYKA 5AJVB 5H9WA 1S6YA 2ZCUA 1V71A 4KC0A 4BNJA 5I6DA 3OVMA 4BECA 2FH5B 1UDXA 4KVFA 4ZVOA 3V1KA 621PA 3HB7A 4OYYA 3L1HA 4D82A 1OY1A 1X80A 2EIXA 3IERA 3RARA 4FWTA 1N6KA 1UWKA 4QAQA 1ZY2A 2IEGA 4IGKA 4HZGA 3VTAA 5F51A 4EUNA 3AEYA 2CLIB 1NVAA 3A3OA 4MIOA 4UCWA 3UFXB 4GMDA 4F97A 2EGHA 3K73O 2B8WA 1DKQA 1F0PA 4Z7NB 2F64A 3JS5A 2Y0DA 4YMVA 2O8FA 2X9VA 1E2KA 4M76B 3DLCA 3ILXA 1NY6A 5CW2A 4J9VA 4BDSA 3JRWA 3F71A 5AJWA 3NBQA 3W6PA 1M34A 4A8JB 3RFVA 1WB9A 1VL2A 3E58A 5KQGA 2JNWA 2YASA 2NAFA 3B2NA 1HY3A 2LD4A 2WW8A 2J33A 1PYGA 2DUJA 3KLMX 3AJ8A 2DECA 2JFUA 4HB3A 4M0LA 3WBKA 5G4KA 3ZPXA 3C70A 3HA3A 4Q7QA 2ZXUA 1N7HA 3TECE 1UM9A 1U3TA 2Z2JA 3ZTYA 4UTOA 3G2NA 1UXJA 3ZBQA 3ICEA 1BDJA 1NJGA 1VIDA 4TKUB 4B3JA 5GINE 4QU0A 3K05A 1JSZA 5GZ1A 2XQIA 4KR7A 1V8FA 2HA6A 1XD9A 3RKSA 2OZEA 3IMKA 1Z6ZA 2RARA 4UNPA 4K3VA 4UHFA 3MTEA 4Q4JA 4ZHQF 1GZDA 2EJCA 4I8XA 3R7FA 5G41A 4G4GA 3TI7A 2A5YB 3GFRA 3FOEC 4RPLA 2EKLA 1IY2A 4RQUA 2YWCA 2H06A 1EQAA 1G7TA 1Z13A 1ZJ5A 4WUTA 1T9HA 1UC9A 1GEEA 1Y1LA 1FP2A 1Z3IX 3QA3E 4ZRNA 2SCUB 1AKYA 2JJYA 1JBQA 3JQ8B 2VHCA 1WPXA 1YB5A 4KLRA 4M49A 1UPBA 2C58A 2RHCA 3GUZA 3ET5A 3HE3A 3U3JA 3WC4A 1M6VB 4ZOAA 1OLSA 3WFZA 3ZGNA 2FYTA 4PHHA 3ME5A 4RGQA 1KORA 3Q3HA 2QW0X 3M49A 4HWOA 3S8EA 4Q4CA 3PWSA 1YOBA 3N8DA 4V39A 5D6NA 4LDAA 5E2BA 5J40A 3WIEA 4TYQA 1MH1A 2Z56A 4I1OA 5DXFA 1O0BA 5T4HA 1DRUA 2C1EA 2C9YA 3EYAA 2Y9PB 5ALRA 5ILGA 3UAOA 5IBPA 4EJ0A 5ED4A 2WPDD 3K5WA 3BWDD 1M5UA 1Y7TA 5REQB 6CHYA 4O1MA 4CM8B 1JAZA 3ADCA 1KIFA 5ITZA 1GILA 2C2YA 1W47A 1Y34E 4X1OA 3MA0A 4DNOA 4MWBA 3RI3A 1E5VA 2XRZA 3QVJA 2QPLA 3AU8A 3I83A 5FUBA 1E3MA 4H7IA 1Z25A 2EJVA 2Q21A 3KTFA 4ID9A 5HE8A 2J9ZB 1CR1A 2Q1WA 3EDYA 2JBHA 2OXFA 3KTAB 2ZANA 3WMFA 1KERA 3OLZA 1JR6A 5JPIA 4OB8A 2V3VA 3I4CA 2OCGA 3M5DA 3C3PA 5AUQA 4HVAA 1SB8A 1XMVA 4Q7MB 3GLFA 4B6GA 4O1IA 4P4GA 1QVAA 4RK5A 4DWWA 2ZUBA 3MB8A 3O2QB 4XB2A 5HKLA 3GCXA 1P60A 4YCNA 3G3EA 1YKFA 4WXHA 1OIXA 3U4AA 5JJKA 5LMUB 4FFSA 2AV6A 2EJWA 2YRXA 1EHIA 1RWMA 4OP2A 1V11A 3P0FA 3SF8A 3JATA 4RQTA 3TZCA 4JI4B 4LF9B 2DHDA 3UAGA 2D1FA 4XX1A 3TB4A 5JC1A 4B8YA 1W6RA 4H08A 3GDHA 1C1HA 3E9YA 3LRPA 4RK6A 4DMUB 1QWOA 1UBUS 2ZJ3A 5YASA 1UEXC 3D54D 5LBIA 5SY4A 2FZCA 2PS1A 1G6OA 3JQDA 5BSUA 2UZ0A 3GN1A 3V8EA 1WW3A 2FFAA 4ER7A 1BA3A 1Z6QA 3CZ9A 3TSZA 3VTZA 5CHEA 2GN9A 4IF4A 2OQ2A 1U8FO 3C87A 4HQ0A 4P36A 4RH3A 3T1YB 3K30A 3FKJA 1DFIA 2C5SA 1CQJA 1RI2A 1UMKA 2G67A 2RGEA 3PNMA 3PNVA 1GAQA 3KQTA 4PYOA 3ZWAA 2X0RA 5HUHA 1RLMA 1YQTA 3QW4B 3ROXA 3G0HA 4FBGA 2AMFA 2XUOA 1NYTA 3WYCA 3I30X 3BERA 4FUQA 1J4AA 2VI5A 3K6KA 1Q2XA 4IL5A 4Z9AA 5K0BA 1AE1A 1TQDA 521PA 3RG2A 3PE6A 3BXXA 4GM4A 5TY0A 1EJ2A 3VU1A 4TXNA 3R0JA 3V1NA 4D6YA 3T9AA 3LQYA 2ZREA 1FFAA 5ISMA 3NB0A 2FVYA 4XB1A 5EJ2A 2Z4SA 1CQWA 4BU1A 3EXFA 5I9NA 1HYQA 1JT9A 1USUA 3NOVA 2V59A 4JJ6A 3LI2A 4I1YA 4Z9XA 1FQJA 3SS7X 1RI3A 1NBIA 2GD2A 4MLZA 1B42A 4RLHA 4BNNA 1XNHA 3C43A 1UODA 5AHRA 3R7SA 3C24A 3OURA 3PRHA 1NDUA 2VJOA 4WN9A 2AOXA 5GONB 2X0EA 4KKVA 3VZQA 3FZEA 1L5RA 1P0QA 2H7XA 1SG9A 4C29A 2IHNA 1LPOA 3BVPA 3SZ3A 1AKEA 4AUKA 4TWAA 4I19A 2VATA 3O8DA 5DCYA 3EGWA 1WETA 1J49A 2QV0A 1PFYA 2O3SA 4BKQA 4F9FA 3A58B 4TV9B 1SBYA 5EHGA 2A1UA 1W9MA 1DPGA 1KA9H 3O1JC 4ZVMA 3WKCA 3X1MA 3HZOA 1E20A 1UOEA 2G9UA 4FNAA 4ZV9A 1MN6A 1GCUA 2IUFA 3UAXA 2B1GA 4PRYA 3T4UA 4G4SP 3QEKA 2JIBA 2B4AA 1WEHA 2A86A 2KI5A 4ESOA 4YIHA 1RMYA 1ZJ6A 3FUVA 4OQLA 1XK6A 1F4LA 3DM9B 3A6FA 1GG9A 1JAYA 2I03A 3LUBA 3FZYA 4CT0A 1K0FA 2BHSA 1HFJA 2OKCA 3KALA 1XTBA 2OD7A 3L82B 3MJRA 4H31A 1F5NA 1CHDA 1G8PA 3LP8A 4Q3DA 3S2EA 3SVZA 1NXSA 3VZSA 3GOHA 5JAOA 5K6AC 5KQSA 5TV2A 1GL3A 4PQRA 4XQ9A 4D0GA 3U26A 3ZE0B 4EHFA 2ZT7A 5F64A 1J20A 4OUDB 3BQNB 4CL0A 2XD9A 1QIEA 3UJDA 2ZTHA 3BIWA 1NMEA 4HFMA 4N5HX 1H2RS 1KDRA 3GLHA 4PGHA 2EW8A 1I2MA 4Y1RA 1L2TA 4QQ8A 2QUKA 5BSRA 1MQAA 1XP8A 4DM3A 5KNCH 2A4MA 1UPAA 1C4XA 2XVAA 4IGIA 3U6KA 1IH8A 4XYBA 3RIHA 1HYBA 2BFPA 3VOAA 4BMPB 4B31A 2YUIA 3STUA 3W8NA 4UXJA 3EZ7A 2VJPA 1USWA 3Q87B 5ES3A 1BKSB 2QVZX 3LFTA 3OJWA 3KV3O 4A8HA 1AGXA 3B9QA 1NFFA 2PS0A 2BT4A 5HIKA 3GJ5A 1QYCA 3R1IA 4FNOA 1E1QA 3DMDA 2OHOA 1WAMA 4L3VA 4LJ7A 2LCQA 3B48A 4GNRA 3I34X 4UQPA 3H75A 4Y9UA 4FXPA 3KK0A 4CV3A 5CR9A 5IKEA 3UMMA 1YO6A 2ZRQA 4IUYA 1N2CE 3PIRA 1U6IA 1KS9A 5BQ5A 1JHZA 4R4JA 1O08A 1ZVQA 4LQLA 4YRGA 1MO3A 2XMSA 1PT8A 3HSSA 4N82A 1NOKA 3G0OA 3DDSA 3LRXA 1WXWA 4GZLA 2X0JA 3AHFA 4MV3A 3INYA 4NLLA 2PK3A 2QN3A 4A73A 2CLMB 2PRZA 4JI6B 1MJHA 3ND9A 3H7AA 3KD2A 4NE2A 2NZVG 4IW3B 1TIPA 2I8CA 4URUR 4JLSA 5ARBA 5C18A 3DFMA 3U1BA 3C8UA 4REQA 2X8AA 3U62A 4G25A 2X3YA 3CISA 4ZOLF 2JFXA 1YZTA 2YXDA 3CEPB 1ZCBA 1ECJA 4RKRA 3K20A 4G6ZA 2P9GA 1ABFA 4GU5A 3BAZA 4OIFA 1E1KA 1T8WA 4FYJA 4GW3A 5T5QA 1O6CA 2QVYX 3PQ4A 1JDTA 1H5NA 3JYOA 4IQFA 5PNTA 4CMGA 4II2A 1XTVA 2COEA 1Z4IA 2WG2A 3I2JA 1PU2A 3DTVD 4RMHA 4RGYA 3N2KA 1P2TA 2O7NA 4YQFA 1FSSA 1NNEA 1BSVA 3RANA 1Z88A 2WTNA 2Q8NA 3ONNA 3TPZA 1QCDA 2ZQ5A 4KMOA 3ETLA 3P0HA 2P2CA 4PSDA 1C7FA 1N2GA 3D4IA 4U7TB 1V8OA 1J8QA 5JS6A 5IK2A 5HGXA 1N25A 5KB3A 2R8PA 2FEAA 1P6UA 2B94A 2G71A 2HCFA 3B3QA 5DXJA 5JARA 3PD7A 1K7SN 4RKFA 3ZDQA 4ICIA 3ABOB 5ELLA 3UIEA 3MMPA 1GYPA 4D9IA 4LZZA 3BXFA 4I14A 5CYPA 1U6JA 2HNAA 3ILSA 4XWKA 1X1RA 2GJ8A 3A31A 2NT3A 2ZS9A 3GJ3A 4JLOA 1POXA 1QUFA 4GBED 3PNLA 1QV7A 4D4MA 2E3JA 4TSKA 5BUSA 4FUTA 1EM6A 4JIMA 4AZ0B 5EJ6A 4KXLA 5EOVA 1Q3HA 1U3CA 1N36B 1W52X 3HXPA 5IJ0B 4PLYA 1UAAA 2IP4A 3OESA 1HFEL 3UJ6A 4DC9A 5BVHA 5IDQA 3IKMB 1UF9A 3TPCA 1EG7A 3F7NA 3RREA 1W9HA 4UAUA 4W1SA 4HGOA 1L1FA 3IHLA 1CUGA 5FT9A 3BL5A 4M7PA 3X44A 1DIRA 1J6UA 3VYWA 1CJUC 1A8SA 4W9NC 1BFDA 4DGQA 5LQUA 3WWPA 2ZB8A 1N1EA 1U80A 2IIQA 2I6FA 3EPRA 3IIEA 3LXUX 3KCQA 1I8TA 1Z5VA 2DHCA 3TB6A 1OX6A 3UWMA 4RPHA 4KIFA 4QX6A 4IDPA 3WLRA 4B33A 5AUOB 1KY3A 4HX5A 2OG2A 2CNDA 3ZI0A 2Y1WA 4WASA 3SWWA 1HDGO 1H6BA 1OUMA 3G8CA 4M1EA 4ERNA 1A1SA 3IT0A 5C8DA 1GZ3A 4X0EA 5AI4A 4MW4A 1N77A 4OI4A 4FMBB 5EGSA 1Y1PA 3VR4A 4BWYA 1H6AA 4J75A 1I32A 1KIAA 2E87A 2YV5A 2X8WA 1BXGA 3FAKA 3VH1A 5ICFA 2PPLA 5JPCA 1U4OA 1KWGA 1TFUA 4L2IA 2UXCB 2TMKA 2B2XA 4P0TA 4QXPA 2WICA 3T5BA 1QDUA 5EWLB 2D5CA 5ILQA 3TEJA 4BKUA 3P9ZA 3K0SA 4UCQA 4HH4A 5BSEA 2PBZA 3WQSB 2AF4C 2GN4A 1G5QA 3W06A 3L0BA 4D4GA 5HILA 5IMSA 2ZM5A 2XYRA 1OXBB 1KU6A 5L3SA 1NYQA 1UR5A 2OD9A 5DHAA 5HS6A 4NBTA 2CWDA 2JZOA 3R6WA 3GCGA 1TAQA 4ZIRA 2XUAA 1B0UA 4F11A 1L4BA 4DQ0A 1L7BA 3RFFA 1G21A 4RABA 2ZQYA 1I30A 4ZQBA 5FNVB 1NL3A 2N1MA 4RFVA 3VKFA 3WLFA 4CGZA 2VYFA 2C77A 4FEYA 3WA7A 3EGXB 2NO1A 1DX9A 3NHAA 3PTZA 4LG1A 1KHTA 4TT3D 2LUOA 2PCJA 2SNIE 4IKOA 3F7MA 2V5AA 4MP6A 5MGBA 2QVXX 3AFNA 1XHLA 4QTUB 4R2MA 2V3WA 2VJCA 4NIMA 3WSWA 1KVSA 3BMNB 4J1SA 3AC0A 1GKUB 1VHJA 3D1JA 3RJTA 4CMEC 2W6IA 4PRKA 4UEWA 4MIEA 4EELA 5KINB 4BY9E 2CEKA 3OEYA 3IAEA 5DM60 1XJQA 2DRIA 3CVUA 3MQ2A 3LHFA 3UK7A 1GTMA 4KQCA 4M7OA 4WCVA 3V8PA 4EMUA 4LNAA 5DM1A 3N05A 2FHSA 3LGXA 3RSFA 2R7MA 3T7JA 3L8DA 1ZCFA 4DCGA 1M6YA 2W4MA 5JBNA 1ZGCA 5GJCA 3NV7A 1P8AA 5FTWA 1OV4A 4QZVA 4ZAVA 2BBSA 2X5KO 2PUGA 1RYBA 3SBEA 2Z2XA 3ZCTA 2BEWA 2B8JA 3UKDA 1Z4JA 2Q2QA 3GZTB 4CU2A 4D9HA 4YNBA 5K8JB 3RHSA 4FOPA 3K8OE 4EMTA 2IYQA 2XJ4A 4RLSA 1RBMA 5AHOA 4ZYVA 3DVAB 4PBSA 2W22A 3WV4A 5HTOA 1G5RA 1NV8A 1DBSA 4WGFA 3S7TA 2X77A 1SRQA 4RD0A 3BZWA 1NYRA 1SVNA 2Y05A 5EQDA 1KJ8A 2FP4A 4J3NA 2RHWA 5LSAA 1QIFA 1FA9A 4XYEA 1Z2EA 4L73A 4AWBA 1W8IA 2XHZA 4KTVE 2ZUEA 2X8BA 4X92A 5FYQA 4BKMA 3ZZNA 4EF6A 2Q6OA 4BGDA 4DREA 2AOTA 1ND6A 3PHJA 1P2BA 4RZXA 3C97A 4BB6A 5EJFA 4OM7A 4OHWA 3U3DA 2JC3A 1T2DA 1DAFA 2EKBA 3ZHYA 1K8RA 4EI8A 3AMVA 2IYUA 1QHEA 4R5HA 1XCMA 4Q9AA 3OQBA 4O0MA 2QWXA 3KKKA 1CY7A 3FCEA 2BGKA 1RLOA 4HSEA 4WVLA 3ID6C 3H4TA 5E3IA 2ECKA 1MXHA 1OILA 3GMDA 4WA8A 5LXTB 2D5LA 2P27A 3OQPA 4MQFA 2FR8C 4HQKA 4RVCA 2WD7B 3ONEA 2B5WA 5JXJA 1SVIA 3AUSA 1T1SA 2EFEB 2ZTVA 3FDIA 2RAFA 3JR7A 2QF7A 4LJ5A 5G4LA 2JCXA 4TSFA 3SC3A 5CDSA 1B6GA 3ONWA 3TWOA 3NIGB 2J9FB 1T8TA 3CLKA 3VISA 3EN0A 4ZZ0A 3TGWA 5DP1A 1DSSG 5T67A 1Q0QA 5T64A 1QFXA 3KJHA 4NV0A 4A2PA 1XDUA 5G2OA 4FFOA 3BB4A 2ANBA 3G2PA 1ZX1A 3TFQA 1LRJA 2A0XA 3HJUA 3VR6D 4F2WA 2CMDA 2P5UA 5C8ZA 1QNLA 4CQLB 4KCGA 1PEDA 1N7GA 2O06A 4BGIA 3FIJA 4RL4A 2J7PA 3H83A 4J7XA 3QTTA 2I2XB 3T5PA 1UKEA 3OF3A 4LMPA 1TM7E 5DN6A 1MV5A 2OO5C 4HRYA 3RU9A 2JJMA 4MNTA 3FF1A 1O57A 2AQHA 4M83A 4C08A 3ENKA 4JYZA 3DA8A 4G0PA 2W2OA 5FTJA 3E3NA 3RYIB 1SVOA 3QE2A 4B34A 4PNHA 1TAUA 2C61A 1JU9A 4Y1GA 4EO4A 2W6MA 2CDNA 2XBMA 4AM8A 1P7VA 5FKJA 3P4UA 1ZI9A 3VHRA 1G6Q1 3RTGA 3IV6A 4F4FA 1E1CB 3NWBA 5AK4A 1GWNA 3I04M 5CT6A 2FZGA 4G9GA 3A9SA 3FGPA 2RSLA 4BCBA 3BCHA 3Q3JB 3ER9A 1SIUA 2FSVC 5K6TA 3RS8A 2WILA 1QQ7A 1JPUA 1VPEA 3TW6A 4OREX 3V4LA 4ZA2A 3R41A 4ND3A 3QVGB 1VJ1A 4TYPA 4PTLA 1R6VA 1CB7A 2ACEA 2IP2A 2PXCA 5AM1A 4TX1A 5BPHA 1KZ4A 4D81A 2PY6A 1VTKA 5EVCA 3EE6A 3RU3A 3AKDA 3KB1A 3Q9SA 5K3BA 3SGLA 1G3UA 2RC6A 3CTPA 1ESEA 3U48A 1MENA 4DSNA 3JQ7A 3EARA 4LVOA 4S1NA 3RHTA 1FP6A 2C96A 1DJPA 4AJNA 2H48A 2RH8A 3OJXA 3OTGA 2DERA 3FNGA 4YN3A 1K9VF 3WK7A 2HK7A 2VDQB 1P9WA 2Y1GA 2E48A 3I09A 4ND5A 4F1WA 1YDGA 5FHQA 1PJ4A 5CGQB 5DTRA 1E66A 4RMIA 1YD7A 3HYNA 3NT4A 3ROMA 4EHKA 1NU6A 2PUJA 5SYMA 1SHKA 4G0XA 3FYSA 4FN5A 2Q0SA 3VAAA 2ZJ2A 4R8MA 4B74A 1GO2A 5IHPA 2YFQA 4K6FA 4TXMA 5EE1A 3LX8A 5AOBA 2I9KA 2ZS8A 2DEUA 2O5CA 4PCLA 4TTVA 16PKA 4LTNA 3I53A 1VE9A 1H4QA 4YJ2F 5TEWA 2QLTA 2WT4A 4EY5A 2BSXA 4AKSA 1X7WB 2JVJA 1XEFA 3M34A 5A3JA 1SC1A 1ZH6A 4Q7JB 2NO0A 4RW0A 4N65A 5DJ5A 2OXEA 2XUFA 4C7JA 3VBCA 5M3BA 1OA0A 4RVHA 4TQAA 4QLBA 3PGA1 2RHDA 2HM7A 2B35A 2IT1A 5AKEA 4KDFA 1JL3A 1MVOA 1WU7A 3D5TA 3FAZA 2XBLA 4W5WA 5SZJA 3HA2A 2FSPA 4HHEA 1XPOA 3DZGA 5IFKA 2JGNA 3SQMA 1PJCA 1P2DA 1R5JA 4NTZA 5E7MA 1VKOA 3MAJA 4EB0A 5C37A 3TMKA 3RFUA 2WDPA 3UM9A 1VKJA 4DOMA 2PEYA 2AFHB 2LRHA 3MMSA 4PPNA 3WYGA 1NRWA 1MC1A 3NNDA 1LC3A 4X44A 4OX9Y 4GICA 4QHSA 1XKXA 2ZIWB 3D64A 1DIAA 2MHCA 2E9SA 2GM3A 1G4UR 2W83A 2YWDA 3DAYA 3PUKA 4QUDA 3X1DA 4FD2A 4YR7A 5C8XA 3DF9A 1M5TA 2G4VA 2OORA 3IE2A 1A72A 3V3TA 3ZCSA 3MF4A 1U63A 3PGJA 1AMOA 1DCFA 4G86A 3ZGYA 4Q4LA 1VMEA 3ZYZA 2JCVA 5IJWA 3FLBA 3S28A 3REQA 5AT1A 1V39A 2AFIA 4G24A 3FVQA 1G8KA 1YI0A 1GPWB 3Q5DA 1AQ6A 1HEYA 3E2IA 2H16A 1IN6A 3LT1A 3QVUA 3PFHA 4FNMA 1DRWA 1Z68A 1NPYA 2QZ4A 4MQUA 1C30B 2ZCJA 2MSKA 1WE2A 4J0IA 3TBKA 4E31A 5ESDA 3RQIA 2FWMX 3VDXA 4GBGA 4DBLC 3BXPA 3GEDA 4FGUA 1Y7LA 3OLXA 3VJMA 2A4KA 5AJXA 2JZNA 3GEIA 2JI9A 2O50A 4U7DA 2GK4A 4DSTA 2NSYA 2VHJA 4RV9A 1N4AA 3LXRA 3COJA 3E5NA 2C8VA 4UOQA 1C1XA 1W85A 4LY6A 2RJOA 1LCIA 3KFVA 3N86A 1D6MA 4URWR 4GX2A 1C4OA 3V1YA 3A6GA 4BP9A 2OZLB 1EAYA 2XTMA 3NIDB 4P3YA 4CU5A 4LJ8A 2GEBA 4CT5A 1IULA 2R8RA 4QFDA 4HDNA 1TFRA 2P2NA 1DRKA 1UMDA 2YZNA 1KFEB 3QPCA 4HQFA 3A9UA 1TVKA 3QJGA 2Q41A 4KYUA 1NN0A 5FPSA 5JWHA 4OL9A 3DYBA 3S27A 2QVCA 1H2XA 4EHJA 3U37A 1Z6YA 4WN3A 1CEQA 1Y5NA 4FQ7A 4IINA 4NCHA 1B3BA 1KZ6A 1RZVA 2WWGA 3WO1A 1H8ED 5DIFA 3DKKA 2PIDA 3PT9A 2A9QA 1THMA 5LP6F 1RE1A 2A8YA 4WZAA 3NWPA 4CLEA 4HWSA 1NASA 2IXAA 3HXOA 1QRDA 5K2OA 1HTWA 1NMYA 2HTFA 3FYCA 3MWJA 5K0LA 4PLVA 1KHHA 1M3SA 3IIKA 2LKCA 2XEXA 2Q5EA 3CSUA 4J0FA 3SZMA 1KP9A 4JJ7A 3VKWA 4A23A 4K46A 4QUAA 5I7HA 4LF6B 4GPBA 2P6OA 1P91A 3WRXC 1NTRA 2DX7A 3VR4H 1SKYE 1XQXA 4D43A 1CUVA 4AY2A 2MR6A 2ZWOA 1SIBE 4KK3A 2W2QA 5LQSA 1Y82A 3OJFA 5IYZA 3LQ2A 4I99A 1IUOA 4ZCRA 3B5JA 1J0AA 2YRFA 1E2DA 1JP7A 2X7XA 4XYGA 3CR8A 2X7JA 1D2CA 1FUEA 4KO4S 2FOLA 4E5KA 4I8DA 3WB2A 3WGZA 1PZXA 1TC2A 1DC5A 2NU6B 2B1RA 3AESB 1X7GA 5JCXA 2XUZA 3CEJA 4DM4A 1SA0B 5FBRB 4CF4A 4B4WA 4A15A 1MLDA 4JI1B 2GJ4A 2FLKA 2RHTA 2FJUA 4CFSA 3RYTC 2B4RO 1NF8A 4IH9A 3NHJA 4OQZA 3NETA 3ROTA 1VBFA 1Z2AA 4HUJA 2GCOB 4NONA 1JJVA 1HF3A 3WWDA 2IH5A 2PKEA 3HXTA 5AHXA 4RZQA 3ZUGA 2OBNA 1W19A 2HW8A 3CKYA 4MZDA 2F48A 1LGYA 3E84A 4TVBA 2P5TB 1A76A 3IQEA 5BSHA 2CLOB 2J4DA 2QD3A 4IXTA 2QJWA 5D8DA 5JLAA 5EHZA 5BXYA 2PRKA 2PO7A 4DXHA 3TAHA 4CQJA 2BISA 1MHTA 1NNUA 4GMXA 1G41A 4ZT3A 3PR1A 2QL5A 4R1UA 4L08A 3NXSA 2O8DA 3PUZA 1MQ9A 4LS3A 1HT0A 2E6KA 3GWZA 4EBBA 1A2QA 1ZK2A 1X6VA 3SSMA 4X1YA 1WCIB 3QXGA 1QLJA 4OFWA 3O82A 4G0WA 3EXAA 5FYDA 1CUFA 1IJFA 4F45A 3BHMA 1I2ZA 5COQA 1Z75A 1SG6A 3R3UA 3N7UA 3DL4A 4HBGA 1NQUA 3L18A 1V25A 3FCYA 4RTSA 1D9XA 2LNDA 4FMPA 3QKUA 1X8XA 4JJZA 2MINA 2P8SA 4MUBA 2PKQP 5C1IA 4IICA 4FTWA 5FUWA 4P81A 3K35A 4FGSA 5AI5A 3WY9A 3AV3A 2NWQA 3S99A 2XKJE 4QTTB 1IAQA 1RWKA 2AFRA 4HQRA 4QEZA 2UU9B 1E3SA 2IEDA 2FX3A 4C3UA 3DHYA 1JG2A 4GIBA 1LW7A 3CVWA 1H3EA 1X80B 2AG5A 4LFCB 1GQRA 3ETEA 1I0LA 2ZBEA 5EHQA 5AW7A 2FMHA 3RWOA 2A9VA 4DLKA 1KJWA 3HUTA 1J0XO 4JKOA 2PL9A 2FU5C 1F8YA 3E6AA 3IPYA 4A2QA 3OMWA 1PFGA 2QMUA 3CB4A 1JJ7A 4CDGA 2O8FB 4Q19A 2IXEA 3FWYA 3LLVA 1M34B 2VSXA 1KKLA 4XUCA 2YDXA 4KMSA 3L8YA 4WGGA 3PL5A 2BJVA 4FU0A 1GPBA 2ZJ6A 1OAAA 2GR9A 2X2OA 1N8SA 2V7GA 2HB6A 3V7FA 2E4WA 2PE5A 4BLUA 5KC8A 3PXBA 1NLZA 1QBKC 3HB5X 4ZRMA 4I3FA 5G4KB 3GQVA 1UM9B 1CPYA 2HLPA 1JFSA 3OC6A 1MAWA 1L5ZA 1X7YA 1JHVA 2QU7A 1Z8FA 2DBVO 4JNKA 5AJHA 1CBUA 1G7CA 3SXPA 4A5SA 1UKVY 4Q24A 1PDOA 1PWEA 2XNKA 1JEEA 1XTTA 4HUQA 2HMYB 2W6QA 3KBBA 5ER9A 3RIGA 3T9DA 4S0XA 2PQMA 1XR3A 1U1CA 3IH5A 3ND6A 3WXMA 1QCYA 3A6HA 3U9TA 1EPUA 3EBLA 5CXSA 3KLBA 4Q4JB 2GJ9A 5BWBA 1T2EA 4M46A 5A7HA 5IXJA 3QG1A 3NDPA 4AG5A 2GBFA 4RYLA 4E5SA 2PUBA 1J8FA 5BWLA 1E69A 2WF6A 4C9BA 1E6WA 3MJVA 1YFJA 3CNEA 2X9LA 2FEKA 1OYOA 1MR3F 3I58A 3PDCA 4L4XA 2XNDA 2Y0PA 3M7IA 3JQAD 2AF3C 2R60A 2XR1A 2ZAYA 2H54A 5LJIA 3DFZA 5FLYA 1JBEA 2PMBA 3ZXSA 5F7XA 4JAVC 3ZJVA 4JNCA 1B26A 1FJHA 3JQEA 4P31A 3T1VA 1OLSB 4PQGA 3F78A 1KQFA 1UWVA 4U39A 1N1MA 1TPZA 1XAJA 4MYDA 3D0QA 5DGHA 4CFZA 1CXZA 4V38A 4YVFA 1D04A 2C20A 1EP1B 3JPYA 4D4LA 4E5PA 4RAQA 4OXNA 5ULLA 1AKNA 5KUTA 2GRAA 4JHLA 3WSVA 1G5TA 1PQYA 3BIOA 1E9BA 3FNRA 5BV0A 1QF7A 4Z9BA 5F2OA 2NMVA 1RI1A 4XDZA 4WEOA 5E8JA 1K66A 9ABPA 2CYCA 1SRRA 4AICA 5KVVA 4JI7B 4JXKA 4BC0A 4B3MB 1ZK0A 5ITZB 1LQTA 3IXLA 3RS4A 5TX7A 3O91A 1OPRA 2Y92A 4F4CA 2X3FA 5HF5A 2JLBA 3T5CA 3NDBB 2CLKB 1NWHA 2Z1MA 2A88A 3ABRB 1XRNA 1U8ZA 3NTLA 5F33A 1L7RA 4CEIA 1PT9A 1VL0A 1CZKA 3OHSX 3DJFA 3D8BA 3ESXA 1RI5A 1Y7PA 1ZVVA 3PICA 5FD8A 4M0EA 2PIAA 1SPBS 2CDBA 3KEQA 4QJ4A 3GLFB 2HA7A 3PSHA 4IHAA 2BGNA 2G1PA 3I8SA 3A9RA 3KSDO 3V6MA 5BURA