2GN2A

Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
326
structure length
325
Chain Sequence
b'ITYDLPVAIEDILEAKKRLAGKIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFIRGAFNKLSSLTEAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDYSAEVVLHGDNFNDTIAKVSEIVETEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVIVPIGGGGLIAGIAIAIKSINPTIKVIGVQAENVHGMAASYYTGEITTHRTTGTLADGCDVSRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVITEGAGALACAALLSGKLDSHIQNRKTVSIISGGNIDLSRVSQITGLVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Threonine dehydratase catabolic
publication title Crystal structures of Salmonella typhimurium biodegradative threonine deaminase and its complex with CMP provide structural insights into ligand-induced oligomerization and enzyme activation.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 122
structure length 325
sequence length 326
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2006-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn2A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn2A02
4ZQCB 3AEYA 5C3UA 5I6DA 4ZU6X 3R0XA 4IL5A 1TZMA 1QOQB 4LMBA 5IXJA 1FUYB 2RH9B 4D9KA 1J0AA 1V7CA 2CLFB 4D97A 2WSYB 1TZ2A 3VSDA 1Y7LA 1UIMA 5I7AA 2Q3BA 2PQMA 3DWGA 4D92A 3BM5A 5DW0A 5DW3A 4D96A 1WDWB 4L28A 1M54A 1BKSB 4D9BA 5J43A 1V71A 4AIRA 4I1YA 5D84A 5KZMB 2ZR8A 2ZPUA 3IQGX 1K7EB 2CLMB 4D8WA 2Q3CA 1KL7A 3PR2B 1KFEB 5HBGA 4H27A 1K7FB 2RHGB 1P5JA 5J5VA 3PC3A 5JJCA 1TDJA 1X1QA 1K8XB 5B53A 5BW6B 4D9EA 3T4PA 5B55A 1TTQB 3IQIX 1K7XB 1WKVA 1CX9B 2J9YB 3SS9X 5I7WA 1F2DA 4LI3X 4L27A 2J9XB 1V8ZA 3R0ZA 3DWIA 2C2GA 3L6RA 5B36A 5IW8A 4AECA 3RR2A 1KFCB 1UBSB 2EGUA 4KKXB 1C8VB 1J0DA 1J0EA 1JBQA 2O2JA 5CGQB 5I7OA 5I7RA 2J9ZB 3FGPA 4HO1X 4XUGB 4ZU1X 1K8ZB 2CLOB 5D85A 5E0KB 4D9IA 1A5AB 1CW2B 1C9DB 2CLKB 2EFYA 3SS7X 4OREX 5DBEX 1BEUB 1Z7WA 1PWEA 5I7HA 1Z7YA 1C29B 1O58A 2GN0A 2DH6A 4D8UA 2GN2A 1VE1A 4D9MA 1UINA 4QYSA 3TBHA 5B3AA 3VC3A 5DBHX 2C2BA 3ZEIA 2DH5A 1TZJA 1RQXA 1WBJB 1FCJA 3HMKA 4WX2B 2CLEB 5JISA 2V03A 5B1IA 4D9GA 4L3VA 2BHSA 2Q3DA 1KFKB 3DKIA 3PC2A 5D87A 4JBLA 1TTPB 2ZSJA 2CLIB 4D99A 2JC3A 1K8YB 3L6BA 4HPXB 5KINB 4D9CA 2CLHB 4L0DA 3IAUA 3PC4A 3SPXA 2CLLB 5CVCA 5EY5B 1K3UB 1J0CA 4NEGA 4JBNA 5DVZA 3IQHX 1KFJB 2BHTA 4D9NA 1VE5A 5B1HA 1VB3A 2ISQA 4HN4B 1E5XA 1PWHA 3X44A 1TJPB 2ECOA 1A50B 4COOA 3L6CA 4F4FA 4HT3B 2D1FA 4D9FA 2TSYB 4Y6GB 3CEPB 3VSAA 5D86A 3V7NA 1J0BA 2GN1A 1QOPB 2ECQA 2O2EA 4OFXA 5T6MA 3VBEA 2TRSB 1OASA 4HPJB 4LMAA 1D6SA 2RKBA 4NU8X 3AEXA 3VSCA 1KFBB 1A5SB 1TZKA 3FCAA 1TYZA 1WTCA 1A5BB 4D8TA 3X43A 2TYSB 5IWCA 4PCUA
chains in the Genus database with same CATH superfamily
1ZJJA 3ROZA 5F9MA 1F4VA 1I1NA 2KJQA 4F9FA 5BMOA 1U0OC 4K9MA 4UPDA 1E96A 5ERXA 3UT6A 5B2ZA 2WYWA 2GESA 3LUBA 3X0DA 3ETDA 4HI0E 3SQMA 1BHO1 4DLXA 5KYXB 1U1CA 4EJ6A 1KTVA 3LE8A 1ZWLA 2WTAA 5L51A 3QKTA 5EXSA 3C5CA 3PUWA 3DCJA 5CCXA 5JS2A 3D3JA 2JCXA 4L8GA 6GPBA 4D8WA 3ZJTA 4TUYA 4BBJA 2D0IA 2HDWA 1H9BA 5K99A 2NSJA 3PQ5A 4R8VA 1W9HA 3AR4A 2DB3A 1L5GB 1ZINA 2E6UX 2FRDA 3Q0IA 5HF6A 3TLMA 1PZHA 3I8XA 4IICA 5DM4A 1Y1TA 3QU5A 3S2ZA 2QJTA 2VK8A 4B6PA 2OK7A 4LRXA 3RVDA 4I1OA 2ZIEA 1RQ7A 1JQ5A 1VJGA 5FOTA 1H94A 3MM4A 3N3AC 4GEKA 4G65A 4E6EA 3A4LA 2AEMA 1MH1A 1FIUA 4C2TA 2IH2A 1UBSB 1AZLA 1U0TA 2Q2NA 2OUKA 2DUUA 3B6ZA 3EVNA 3T35A 4CQNA 5AI0A 3EY9A 4LC1A 2I3GA 1POWA 2CY0A 1VG8A 1ZY2A 3QVXA 4LE0A 3ZS9A 4YUWA 4LF7B 3G2JA 1QKIA 3LT2A 3OICA 3V4FA 4P58A 2WFAA 5EHGA 3W5CA 3K3PA 3GVCA 5CDHA 2R6DA 1VYVA 3QW4B 4I5DA 3C3BA 1DC3A 3WIOA 4WDRA 1HFJA 1S2IA 4HB4A 4OH7A 2GX6A 2KM1A 3NBKA 1SWVA 2IPXA 2NG1A 4JROA 5IG2A 4MR9A 2PYDA 2A9RA 3D0KA 4PYQA 1QTIA 3EAQA 1E3QA 2OV1A 5CH3A 4AS1A 2QX4A 2HKIA 2WE7A 3QQPA 1JJAA 4D43A 1VKHA 5JS1A 3RIEA 2HK7A 4X7MA 3E6AA 5HJ7A 1RRPA 1SVSA 1JHRA 2WQ6A 2JLZA 1BC5A 1E9EA 3HR8A 1MB4A 3D54D 1T9HA 1T10A 2PZAA 1KO1A 2H92A 3GDHA 5IJAA 3UH1A 5K3OA 1HE8B 3N8IA 3NXSA 1MR3F 2RGBA 4NXMB 2W37A 1YE8A 1U0NA 2NZ2A 2VEDA 4BKQA 4F6RA 5K3SA 5THQA 2QRHA 5B1HA 2HEIA 3DHEA 2X0EA 1J09A 1E5LA 4ZRMA 5GQSA 3PX2A 2AD1A 4BFXA 2OCKA 3RRBA 1XEWX 1NQOA 4L4XA 2W2LA 5HW0A 5JZ9A 4COOA 4OHYA 5EXEA 4UHDA 1Z07A 2MYTA 4P33A 5DYTA 3T95A 2ENUA 1I4EB 4R40A 3K1ZA 1ZESA 2RKOA 1TJNA 1UBLS 2HXGA 3KYDB 1GGVA 3P0EA 3TMYA 3V2IA 4WBNA 3ZQJA 3IX7A 1JFTA 1KMQA 1DCFA 1MJGA 2JBAA 4JVLA 4OHFA 1AKUA 2QVXX 3E9ZA 3OUZA 5DNCA 4EBFA 2IPAB 2J9FB 3SM3A 4MEJA 4PQYA 3TYXA 1CJMA 1N2IA 4FN5A 3COPA 3NCHA 3E2MA 1XJ5A 1U5AA 4R6XA 3IEKA 5IP5A 5KWJA 3THYA 3W8FA 2IWRA 1PT7A 4D0LB 2VJQA 4JC5A 2W2VA 2XTNA 3D8NA 1KE2A 3SBDA 5CEEA 2IXTA 3ZHQA 2WSYB 1OT3A 1X1SA 1TZ2A 2PTHA 2WU4A 3DBLA 4M7OA 4U5QA 4CKBB 5HR5A 1GWNA 3CT4A 4JCOA 3U2QA 1JALA 5TVGA 1DX4A 1EX9A 1J24A 4XYBA 1G2PA 3W9BA 4TWJA 5B7PA 3T7JA 4I1YA 4MWEA 4TMWA 3IILA 1SKAA 4OP2A 2GPBA 3ZHSA 1U8FO 2OOSA 2WJWA 5GZ6A 4NMXB 3CYFA 4EARA 4ND2A 2ZEJA 1JFRA 4BE9A 1WDLA 2GZAA 3IUYA 2NU9A 5HUJA 3K71B 4CEJB 4WBXC 3D59A 2WSMA 4NG5A 3C4VA 1T8WA 4DLYA 1U7WA 4I8DA 5LJIA 2QLMA 1M7GA 3EA4A 1ZKMA 2ACKA 2FU5C 4HFJA 4C4RA 2HA0A 5IFLA 3HKBB 5F1OA 3I0NA 1OJ7A 3RKSA 4HXGA 2JLVA 1J7KA 2FXIA 3RIHA 2HUPA 1PBTA 2GO7A 3DO8A 2VPIA 2OBYA 2ERXA 5IMBA 5DHFA 3NHUA 1G9XA 4EPVA 1JV2B 3DHNA 1ID8A 4GWKA 1KVTA 4CMEC 3EC7A 5BN4A 1K3TA 3WLOA 5CD1A 4JJAA 3NJRA 3HU3A 5KU7A 4IILA 3N75A 3OOHA 3S2EA 3TGWA 1PDVA 4F5DA 4ZDKA 1G1MA 5JROA 1O87A 1U0GA 2J9ZB 2PGJA 3CRRA 2ATIA 2NVWA 3TL2A 3TRIA 1WOYA 2QHXA 4G63A 3S5JA 3WBBA 1C8BA 5BSKA 3QX9A 5EA2A 1QONA 3IDAA 2ZYDA 3EGXB 4J6FA 1EP2B 5BSHA 3CPEA 2A2ZA 4X65B 2AR7A 4ME6A 1P2TA 3KQKA 3DT8A 4D9MA 2E37A 3A3OA 3HYRA 3SZUA 2CYCA 4TZ6A 3N2GA 3VZQA 2GYWA 2HA2A 2NAPA 1XYYA 3U7GA 1EDEA 4PIPA 1G5QA 1PS9A 2QTWB 3AFOA 3DKPA 2W6PA 3GJQA 5LQSA 1G8YA 4A36A 1F5NA 3UOWA 4A6PA 4PFSA 1T29A 3I72A 1QK3A 4YJDA 1QRRA 4ZV7A 3PUYA 3D1JA 3M6WA 1JBEA 5EWMB 5B3JA 3VYUB 1WO8A 4GQAA 5BSVA 1OH6A 2ZK7A 1G55A 3NV7A 1T6ZA 5CURA 4BB9A 4XEUA 2ZUTA 3WIVA 2IEIA 3CX7A 5EUBA 2BJHA 2VHXA 3M4JA 4J1NA 1TIPA 3PC8C 4KAAA 1BEEA 4ND6A 4QL3A 5BMVA 3FNRA 3E58A 1NBEA 3I01A 4RF3A 3QU2A 5FXMA 3HEMA 2OENG 4N47A 3HB1A 4PSCA 3NM4A 4J43A 3ZJYA 3HV2A 3DBRB 2AE2A 2PSHA 3FYUC 1QRTA 2VSNA 2HGSA 3HB5X 4MDYA 3K8YA 3HGQA 4IGKA 3NVAA 1VCHA 4PRKA 4PG5A 5HP4A 3TIVA 4G9BA 2HPZA 4OD0A 4DNOA 2BCEA 4PO1A 1FYEA 2A7QA 2CXQA 1H9AA 1W2WB 2B8EA 2XODA 1A7KA 1T5DX 1GQFA 3BTVA 2I71A 4LZLA 4MB0A 4CLEA 4FDVA 3ZW7A 5H4GA 1QYCA 3NXKA 1Q19A 1KJQA 2FSHA 1FNSA 2DHEA 4PX5A 1USWA 5GV8A 1AN9A 1C7EA 1PBNA 1Y5LA 2PV7A 3IXLA 2PNFA 1QIMA 2Q8PA 1TA4A 5AJVB 3HJCA 4HDNA 1MO2A 5K0CA 3T15A 2P6UA 2GEDA 2AMFA 3GRCA 4LQDA 3WHPA 2GK3A 1YS6A 2NXNA 4JJEA 4Z53A 1UMCB 2FQWA 4C0HA 1A8IA 3BHMA 3EMDA 4GMDA 3LCMA 3GRZA 3ZXXA 4C05A 1IZ7A 1KAEA 1KJYA 3KJIA 3KQMA 4O5OA 4LYAA 3K70B 3HXOA 1IN5A 4BNJA 2QAGA 3T06B 2OHOA 3P5BA 2YWFA 3P0IA 3ZD7A 2C2HA 2EKPA 1QPGA 1ORRA 1Q0LA 1XLVA 2HK6A 2X0RA 5H83A 4I9GA 3SEQA 2QN3A 3HTXA 4JGBA 2D62A 2IU0A 3OFJA 1LPAB 4Q1EA 3GGPA 5C7LO 2BD0A 3WK8A 5F9HA 3M8KA 3OZBA 5C18A 3DAGA 4MTCA 3QBEA 1ZWKA 2GHQA 1KY4A 1ORIA 2FK7A 4TKMA 4FTWA 3MWGA 4BVLA 4GOMD 5K6AC 5K01A 4C30A 5ITSA 1PZXA 3GP5A 3VHXB 3LCJA 5FX2A 4OFZA 1CR2A 4YWHA 2CBXA 2FVXA 2WD9A 4BPBA 1JR2A 1UQTA 1VL1A 1Z28A 3KXLA 2Q46A 4CL0A 1G3QA 3VFDA 2EKQA 1E1QA 5JBQA 4XX0B 5JSZA 3V34A 4C0QC 1NXSA 4Y1FA 5IVIA 3ZWNA 2QDXA 2R0QC 2CLOB 4L5YA 4E2WA 2R2GA 4LCJA 5EPEA 2XNKA 3W5UA 1C9DB 3KBOA 3UHFA 4B82A 2PUBA 1IEQA 3TI7A 1KJJA 3ZK9A 1HDZA 2O5RA 4K1XA 1J9EA 5I7SA 1YJCA 3WB2A 3FOWA 3N8DA 2I4LA 3CMMA 1XMOB 1NFFA 4CEHB 3PV0A 1K4YA 4Q3DA 4X6XA 1TJYA 1SB8A 1E60A 2O20A 4J49A 2ZRFA 4RD4A 1XNGA 2FRXA 2PLWA 2H2HA 3Q2IA 3Q8XB 5HVNA 1QDEA 4HMPA 1KERA 4RIIA 4PZDA 5I7UA 3AEZA 5KX5B 3NKFA 4KR3A 3EEIA 1J25A 4V39A 1XB2A 2A1TR 3GEEA 4E3WA 1V5GA 4GLBA 1UPFA 3V1KA 1BQ3A 1SCKA 1SUBA 2ZB2A 4J0IA 4TWRA 3FNGA 3WYCA 2B2CA 5TQ2A 3T7KA 2XWPA 4CEIB 2W6QA 4WERA 4BCCA 1WTAA 4C4AA 1PHPA 2DFPA 3GPDG 1KI3A 4X00A 5IVDA 3WGJA 4JLPA 1JU4A 3NUZA 4M21A 3IUEA 1NFQA 5D5HA 2HI0A 3CLUD 3NP7A 2UAGA 1NXWA 1G5RA 3QHQA 4IQ4A 2GEJA 4UMEA 1OF1A 3RG2A 1F12A 2WSBA 3Q8LA 1NYLA 2ZRMA 4W8OA 2HA6A 2PBFA 2PXCA 3EZLA 3AXSA 2ECQA 2FB9A 1YR6A 2C8KA 2OBBA 4GPZA 4PE5B 2VZEA 1DC5A 3VR3D 1N0UA 4A2PA 5JD5A 5CHEA 5TPWB 3G2HA 3T7RA 9GPBA 4HDKA 1REQB 3MBIA 4U1RA 2Z57A 2ZSBA 1PP4A 4P81A 1CUFA 1OILA 3Q5DA 3RREA 1MT3A 1RMTA 2Q3LA 3BAZA 3Q7PA 3AWDA 5CLIA 1JN0A 1QVRA 3E48A 1SVIA 4L3WA 4UMDA 1DAEA 4RTRA 4BZXA 3Q2OA 3UYKA 1CQJA 5DHQA 3KXPA 2QR2A 3H6KA 2PLFA 3E3LA 3WZLA 4CKEB 3SQWA 2EX0A 4GOXA 1FTYA 1OAOC 2XT6A 3AVXA 1QANA 1QYRA 3KPYA 4PYMA 4NCKA 1X1DA 2ZR8A 5EI5A 4JXZA 4O2BF 1JT9A 3MVEA 2QUIA 3ZK7A 4N4AA 1GKKA 3DWFA 5FL7D 3IKJA 1BX1A 1FSZA 1XXHB 1Y98A 3GDWA 5IAKA 2JH3A 3VOSA 3CY6A 1QH1A 2NU7B 5BN3A 2GZ1A 1G5TA 1USUA 1XYVA 5EMHA 1FDTA 3H2ZA 3EZGA 4Q4LA 3QKIA 5CB4A 2GNPA 3VTZA 1SQFA 1FNCA 3I1YA 5GVRA 5BVHB 1G2OA 1QB8A 2PPLA 1JKFA 4KFTA 4WLEA 3R75A 1MJ5A 4FGSA 1QAQA 3KL4A 2GVZC 3DGEC 4CFSA 4RM3A 1OPRA 5IBPA 3KYJB 3U7QA 2C3UA 3K0SA 1QGAA 3S99A 1DRUA 2M98A 1MO4A 1ZGGA 4QAQA 5JAMA 1NMEA 1XT6A 4NBLA 2H1IA 3WSWA 4L4YA 3OJWA 3ETNA 4DL9A 4XDYA 2F1KA 1E89A 1V1MA 5IWAB 4IPTA 3K0CA 3FJOA 3LY7A 3VYSB 2G83A 1Z0ZA 2P9HA 2XE7A 4QSMA 2IS4A 1WHTB 1OTYA 1O5TA 1T8SA 1XCOA 4WKGA 1C8LA 4BGDA 4RGYA 3KVYA 1D2EA 1ABFA 2JGIA 3FJ1A 3F98A 1EK2A 1TCVA 4GUAA 3DYBA 1TO2E 4XQCA 1R6DA 4OU5A 5B1IA 1QCDA 3KZNA 1QZZA 1W1WA 2R4TA 2BUCA 2I7TA 3U13A 3CRZA 2R6JA 2D7JA 4U2KA 4EITA 2OCYC 1C8KA 4FS3A 4BQEA 3FDIA 4CBVA 4IR7A 1UJ5A 1JFVA 2PL9A 2QSJA 2QVLA 4IHAA 4CHTA 3MCTA 5CVCA 4AY3A 2J0UA 3RSZA 5DK4A 1BOFA 4MW1A 4KK4A 3ZJ5A 4PY2A 2XEDA 3JYHA 2CWDA 3H0CA 1VB3A 2ODWA 2DTXA 1UK7A 1QCYA 1YK0A 4DSNA 2RGUA 4FWIB 1VJ0A 3G8YA 2QXYA 1W59A 3FPAA 3IMCA 2QW8A 3NC0C 3QXXA 4O1HA 3I58A 1H69A 4P31A 5LU9A 3LU1A 2OZPA 3ZJVA 3CEPB 4YH1A 5AKHA 1IBSA 3DNMA 5EP4A 4MUXA 3UK1A 3VSAA 3ZWQA 3C14C 5K0SA 1B76A 2VC2B 2BI7A 3NAQA 1Y5RA 4N8EA 3WGVA 4V0RA 3RIMA 1RXEA 4GFDA 1Y1SA 1LZKA 2CXOA 2IDJA 3DTVD 1LQUA 3FDZA 3NC4A 3QU4A 1N6LA 4FBMA 4HDAA 4MV4A 3Q7SA 4LV8B 1FW8A 2G4VA 2HRBA 2VZ8A 2O2HA 5BV0A 1KE1A 1ZMRA 4WINA 1NE2A 2NSLA 3GCXA 3JVEA 4S1TA 2AG6A 2X2FA 4UEQA 4B4UA 1P1CA 2C9MA 1GAJA 3N8NA 2HU7A 4PRYA 2ODEA 4YV0A 2B35A 5AK0A 3KVOA 3VNRA 1RYZA 4ZEMA 5TQVA 3SDZA 3EXG2 1UIMA 1N5OX 2WUVA 2E5WA 4H60A 4O2AB 4FZRA 4H18A 1FK8A 1I7NA 5DLYA 3QU9A 3GEHA 4DILA 5CEFA 1PK7A 1TLFA 3OD5A 4EF5A 4MUKA 2DCUA 1S8NA 2B1IA 3HM2A 1VBKA 4HRYA 1G7TA 2ZBUA 5COBA 3SFTA 1UBTS 2EFCB 1DT5A 3VNBA 2ZRCA 1PIWA 2PX8A 4G5YA 4C43A 5EGSA 3CGWA 3T41A 4YV1A 3GFGA 3QH4A 1HE1C 3B9QA 1MOZA 3C5HA 4FQ8A 2EX4A 4A0FA 1ZK1A 4KIFA 1I3NA 1TPYA 2VZ9A 1VL2A 5HXAA 1DWQA 3WGIA 4JYCA 1EVLA 3OOSA 1KAGA 3NKVA 1AQIA 1K89A 1VYTA 4J7XA 1QHHB 2CMKA 4F21A 3U4MA 1N0VC 4K1LA 5CFMA 2XVYA 1AKTA 1OXVA 2G71A 2LCIA 1O9GA 2PGXA 3KD2A 3O7WA 5TGTA 5HA5A 3MHPA 4BNIA 1YUMA 4S1OA 1ZONA 2NO5A 2SKEA 3LG2A 2CMHA 1XTBA 1TLLA 5ED0A 5A06A 1QF9A 1EX1A 3SF8A 1EI9A 5AVZA 2SCUA 2V3CC 4QXRA 5CXUA 5CGQB 4C2UA 4NBSA 2EKLA 3H17A 4MW0A 3CN7A 4ER3A 2V0GA 3P9YA 4IG9A 2HAEA 1OD6A 1VPWA 1BGVA 3WLPA 5JVDB 1R6TA 4KPEC 2QN2A 2AOTA 4BBPA 4KL8S 1WXGA 4RADA 2BMWA 2CC2A 1SQGA 3DAFA 1EWQA 4ZI5A 3I2GA 2M2IA 2HQSA 1HG1A 2VRCA 1EE9A 5AKIA 5B4TA 2PL1A 221PA 1X3SA 4PLGA 3CF2A 3FWHA 4P7FA 3IMGA 3AEUB 5AQ1A 4UZSA 3MRSA 1IXKA 3Q41A 4XDGA 3QTTA 4JKOA 3ZQ6A 4C5BA 2P5YA 3LUDA 1CUBA 3DDNA 4C08A 2BH9A 1KNQA 1JVSA 5A4AA 3EPJA 1Z08A 1OFGA 3MTAA 2P9JA 3HBJA 5C53B 2X42A 2AVDA 1NT4A 1SU7A 1I7QB 3CLSC 4CNBA 4RVFA 5HGJA 1R10A 4RVCA 2ZSJA 1PJ2A 3EPKA 2F48A 3U4QB 2QTCA 1AB6A 1E5TA 4Z49A 1ULTA 2FQXA 5FNVB 2Q5OA 3RUAA 3TOZA 4RYDA 3X1KA 1W1IA 2HQRA 4QXMA 4EFLA 4BNGA 2O8DA 2XYRA 1X2EA 2ZUEA 2VP3A 4R0MA 1CZLA 5I3ZA 3IUNA 4L6CA 1QTRA 1AS2A 2PZBA 4PIMA 5EXDA 4HVCA 2BUAA 2CK3D 1E6LA 4LNHA 1C30B 2OO5C 3GUUA 4O2BA 3EDQA 4FYVA 1NRXA 4D0SA 2X8WA 3LH5A 3MJTA 5E6SA 4BFCA 1YTUA 3O0DA 3HKEB 1OBFO 3AUYA 4PBSA 4EJ0A 1RAGA 3K8OE 2PN1A 3N74A 2A5DA 1BKDR 3COSA 1FLAA 3VSBA 4W1RA 4WCFB 5JI3E 4M1TA 3LCCA 1U7DA 1OSNA 2OC9A 4F5YA 2BELA 4QVGA 1YI8A 1EFTA 2DBYA 3JAWA 4WOJA 1FUYB 3ET4A 4ZJUA 1YZVA 4JWKA 1EGMB 1RBMA 3I23A 1IAVA 3A4IA 2C31A 2B3TA 2JDID 3LGXA 2JAOA 5CFLA 1H1LB 1FDVA 5KAMA 5KYYB 4ZGWA 3WKEA 3U5TA 1C80A 1IULA 1DRWA 4JL6A 1PSWA 4PC1A 2VT6A 1GGMA 3BE6A 3A14A 3I30X 5JANA 1KRXA 4NJMA 5AKEA 2Q8NA 3IEIA 3KFVA 4YRTA 3SC6A 4GI1A 1ZS9A 4TWIA 4CI9A 4DGQA 5FTLA 1C9YA 1ZM9A 4I5EA 2A33A 5JJCA 1EK5A 4EG8A 4CFZA 1K88A 1W76A 1G9SA 3I34X 2BHNA 4ZAVA 1EXDA 2BMAA 2AOXA 3C6YA 3K5WA 3HL4A 4B76A 3I3SR 6REQA 1II9A 4COKA 5JZOA 4HH1A 2JI6A 1MW9X 4DCPA 4TLDA 3TQTA 1NZDA 5B6JA 4BQNA 2GPNA 5LMNB 1UWKA 4YMSA 4BMZA 4EG4A 1EXVA 1GTSA 4HQOA 4M0LA 3OCXA 2ZS8A 4HBZA 4AK9A 1CS0B 1Y0BA 2REQA 2SKCA 1M6HA 2ZANA 4AN1A 4CM8B 4G4SP 1IHPA 3VNQA 4C4ZA 1M2GA 3KZ1E 5TS3A 4CUZA 3AR3A 1P80A 1BSVA 1P6XA 1PNVA 3WGLA 3KXKA 3RKUA 5CA1B 1OI2A 3HCRA 3BJEA 4JP3A 1GPH1 1ZMOA 2HK9A 2B3DA 3QPCA 4UU8A 3RYHB 2NZWA 5B7NA 4J4HA 4TSFA 3EPRA 4PC6A 1Y7IA 3KSMA 4YP0A 1E6CA 3JQQA 3KD3A 4KJXA 5CXQA 5DYYA 4LHWA 4JV5B 1GHTA 1VPDA 5L6MB 1JEJA 2R5WA 8LDHA 3AUSA 4M1MA 5JCOC 1H0HA 1PFUA 1R1DA 3CQ9A 3P2YA 3BGIA 4B3CA 4RJTA 4Q4HB 5G4KA 1G59A 2V7QA 1JR6A 2OECA 2V03A 3CKKA 5B3KA 2QVZX 4Q02A 2CXUA 3F6RA 3RHZA 3GH3A 3UB3A 1I0LA 1ZA2A 3CLHA 2WKSA 1S2OA 3PQ7A 4INPA 4XB2A 2QX7A 3BXEA 2FNAA 2Z9BA 1IN1A 5IUNC 1RACA 3OBBA 2P6MA 3E1GA 4DBVO 1DRJA 3HL0A 4C14A 1ZR4A 3JZAA 4D9HA 6NULA 4IFTA 1OW3B 2A4KA 2BE7A 4WXYB 1K92A 3L7CA 1GUZA 3EW7A 3OAAD 1J2TA 2VQ6A 2GTIA 3OJFA 4Q4JB 3EGVA 3RUHA 4D45A 2CNLA 1RVDA 3BG5A 3K6SA 3PQEA 2Z8XA 2NVOA 3UJ7A 2QZZA 1YONA 3E61A 1GNSA 1MNAA 3O2QB 3QXGA 2WJ4A 3QLUA 4KMMA 2VAMA 5EMJA 5F7ZA 5JI2E 1JKIA 2GBLA 2PUJA 5E4TA 3KQUA 2AI2A 1M6WA 5K8CA 1HT2E 2UYQA 4BMYA 2ZT5A 2O2EA 2DM6A 3AIMA 2OV3A 3N70A 4QEZA 4QXAA 4CM6A 1U81A 4GLFA 1RWOA 2G06A 3HDJA 3OT1B 4FDLA 4NU6A 1WD7A 4HPJB 3DDUA 1SCBA 1U94A 2GLUA 2M9MA 1RM3A 2PGNA 2YJ6A 4URXR 4ZEVA 1D8AA 1ZXXA 3GZTB 4M38A 4YBZA 5LP6B 1IB0A 1U98A 2K4MA 2QD4A 1BZYA 2Y3IA 4J0CA 2WHYA 3UIEA 3DEZA 3AGPA 2BBTA 4JLWA 4KUHA 3WL8A 3PUIA 1FC0A 2C5SA 4MS4A 3DMFA 4DWWA 2PGAA 4DUGD 2WV7A 2OQRA 4D9KA 1ELOA 3WYDA 3KFXA 4KSBA 2WILA 5DT9A 1JEAA 2OKGA 4XIGS 2CLSA 4OJKA 4J7CA 5K3DA 4ZTUB 2PZGA 5DNAA 2PZEA 3ZE8A 2F4VB 3G2IA 4BVGA 2VP4A 3DHVA 2FPRA 3TZQA 3AGQA 5KOJB 1OWPA 2DUNA 2IIPA 1K7EB 3ZNPA 3VKHA 2HHCA 4JEIA 4A0GA 3OM9A 5JG7A 3KLPX 3G9TA 4K9KA 3WNDA 3QVGA 4Q16A 2GASA 2FR8A 3L0ZA 4HC4A 2Q4BA 4MX8A 4WY2A 2FWNA 1CY1A 2W5UA 4GWGA 4Q7JB 2YRFA 3VYRB 5KYKA 4WJKB 1K7XB 1O95C 1WU8A 2E3JA 1RI1A 2PO7A 3FRHA 1WZCA 1IATA 1JG7A 1PUJA 4UTOA 4DKXA 3P9CA 2QMOA 5C8ZA 1V11B 2PBLA 2K5UA 1VDMA 3E5RA 5K0NA 3A1TA 3EWSA 4WK2B 2PKQO 2WWGA 1UC9A 2G82A 4IKEA 2MSLA 4EA7A 4QHYA 4QJ5A 4CIBA 1QRDA 1QMGA 1OLOA 4M1OA 3HCPA 3TLGB 1HY3A 4ZV4A 2ECFA 4WESA 3B5IA 1JBQA 2XB9A 4EWLA 4G97A 5HDBB 3LDGA 4QTTB 1WMAA 3WJ1A 2NX2A 3GX1A 5H3HA 5AVQA 3GLFE 4QFMA 8ATCA 2CNBA 2Q4RA 1PFVA 1NGSA 1L4EA 2Q45A 2R8PA 3CF4A 4LIPD 1NI5A 5LBIA 4P38A 5D2CA 2G8LA 4G09A 4MI6A 5K6TA 5LNK1 2BGLA 3DPIA 1ZD8A 1ZK3A 2YFKA 4I4TA 3LD9A 3I04M 4PCVA 4M0KA 2GJ4A 1XEAA 1IOLA 5EJ8A 3C7AA 3PNQA 1VHJA 4HNAB 4TX1A 5F1PA 2HPAA 2YFHA 2FUCA 3KUXA 1BQ4A 4UCWA 1QV9A 3AF2A 3VO2A 1KS9A 2XYPA 3HCDA 4LWOA 1BO6A 1KPIA 3MB5A 4IQGA 1XTJA 4P4SB 3B9PA 4N9QA 2FX3A 1LVGA 1T9KA 4Q01A 3AHDA 2H63A 1CRWG 1O95D 2IEYA 1VBNA 4JVSB 4NYIQ 4GEGA 4ROSA 5CLGA 4CCSA 3G9XA 3SMVA 3CG0A 4WTOA 2RHLA 4DT1B 1KWGA 3OTQA 2ORWA 4WKNA 5CX4A 4DUZB 2FFJA 1X70A 1ZLYA 4ZA2A 4CIXA 2B99A 2ZB3A 2C4MA 2R1VB 3DMDA 4FR0A 2HMUA 5G1NA 1G6HA 2HNAA 4DKJA 4MLDA 3FHCB 4D25A 4PXAA 1E2EA 4BNLA 2W6NA 2FFHA 1GU0A 1M72A 2H1WA 4N03A 1ISPA 3HLTA 4LOAA 5E4YA 3OJLA 1U6IA 1QVWA 3LJKA 3MQ2A 3HNOA 5ALDA 4B75A 3HYTA 1F20A 2LXNA 3R3SA 6ADHA 4DDVA 1M1XB 1XTVA 1PEDA 3K0FB 4ILEA 1R66A 4QXPA 4MO2A 1OX5A 3PE4A 2PV0A 2RB5A 3OT5A 4L7QA 3ZBUA 1LSJA 3KZXA 3JQ7B 3AG6A 4M0PA 5ALMA 3SIWA 5JAUA 2EQAA 3H5TA 4LVNA 3FVVA 5G0SA 1MTZA 4P4GA 1EIZA 4PVDA 1KI6A 4RD2A 2X6QA 1JTFA 5FBRB 1PW5A 1Q92A 3QEMA 3I2YX 1QOQB 1WOMA 4DM4A 2WT4A 1WPGA 1P74A 3JSXA 4RIEA 1B1CA 1Z5WA 5JQGF 3WGNA 3NMUF 4WDQA 1ZCAA 1T2UA 3IDOA 3A7DA 4RABA 5JTTA 3L41A 2PWZA 1JQEA 2ZOSA 4N48A 1NDQA 3ON5A 3PC8A 1NLUA 4E03A 4RQUA 3EWIA 4U7TB 1YZKA 1HZZC 2YQZA 3GDOA 1Y6JA 3H9CA 2QUAA 3DHYA 4O4JF 4D3FA 4BMVA 3IL2A 3I28A 1P5JA 3C3PA 3L7AA 2CJPA 2Z5FA 5GMOA 3DKVA 2VDKB 1CUZA 3LVQE 4HQNA 4IGEA 4D6PA 4DMRA 3NETA 2ZUWA 3INNA 4H1UA 4NNJA 4ZAXA 4AJPA 5BXQC 1A9TA 4HXYA 1GVNB 3K9FC 1AQUA 1XVLA 4IGFA 4BX3A 1WV1A 2BP7A 1X7XB 1WUYA 3K9QO 4X1KB 1E3MA 3GLHB 3JTEA 3LRXA 2I5PO 4CPDA 2ZFUA 1MORA 1RLTA 3WLMA 1SQ5A 5KC8A 3SEFA 4M6WA 4S05A 3KQSA 4MWSA 4B6GA 1KK3A 1AXGA 1UDBA 1I30A 1P9NA 1QH0A 2YHAA 1BEZA 3WMRA 4QOEA 3HVIA 1Q15A 1AVTA 1MAAA 3QK7A 3RUCA 3C16C 4WGGA 1ZNYA 4Z51A 1SUPA 3HY6A 1X14A 2YRXA 2GZ2A 4Q4AA 2PANA 2OHHA 4L5BA 1LDYA 1Z3IX 1HLDA 3OI7A 4F0JA 5K8LA 2XJ4A 2O8VA 1KEKA 2MIIA 2R8ZA 5IKMA 2DWPA 1EWKA 3CX3A 1ODKA 4MR8B 3SYTA 3TKLA 3NHJA 5DBFA 2JH8A 4CDGA 3DE1X 3WNZA 2ZKIA 3FPFA 1J20A 2IJGX 2H5LA 1UBMS 4WZBE 5CA0B 3M1AA 2X1LA 1OU4A 3RYCB 3BKXA 4NEQA 1UWLA 2I55A 3OZ7A 4HWPA 5H5JA 1S9DA 2FFBA 4G84A 2BAGA 1Y1RA 3KC2A 4B8ZA 5B2FA 5ISMA 4BGUA 4FOSA 1P5RA 1EYZA 1XL0A 2ESRA 1Y80A 4D9CA 3OKPA 1ZGJA 1MHTA 1ETHA 3OEYA 1SY7A 5KKNB 1EXWA 2C5EA 1X7GA 4OIMA 5FWYA 5ALLA 4A5SA 4N76A 3RC8A 3L7IA 4BB5A 2NO6A 5F4BA 2OV6A 3AR2A 4Q9KA 2ETXA 1CIVA 1E79D 4U2BA 4QA9A 3V4RA 2J32A 2P3SA 2EARA 3UFBA 4BLRA 4X94A 3SLRA 3DSRA 4JS0A 4W9NC 1P0FA 2TSYB 5J40A 1TKAA 3VR3A 2HQOA 1CK4A 1G5FA 2Q1SA 3WFZA 1S2MA 3RVQA 3ZNNA 2R9VA 5G3ZA 1JRLA 3NBYC 2O3UA 2Q1UA 2Z30A 2ZE5A 1EM8A 1UL1X 3FB1A 4PX9A 1ZDMA 3TLJA 3ZWOA 4CRWB 2VJPA 1IJBA 5AXAA 1NLMA 3H9JA 1RYMA 1N34B 2WOOA 4GKBA 1N6KA 5JD6A 3PP8A 2I6GA 2DY0A 3EZ9A 3PK0A 2HSWA 3OECA 4MW7A 2JFVA 3SEAA 3ZOKA 3IJPA 2A78A 1XVTA 2XIQA 5DXFA 2CDNA 2X4DA 5H68A 3I9KA 2ACWA 1MDFA 5E2BA 5H4HA 4JI2B 4Z9AA 3A6FA 2QVBA 5L3VA 3PDIB 3E9YA 3PPIA 4JJFA 1LQTA 3QVLA 1KWKA 2EKDA 1EK6A 2A1UB 3Q3HA 4RLSA 2FZ5A 4ZVTA 3W6UA 2Z08A 1APBA 1ZXBA 2GF9A 3QIVA 3JARB 1CYEA 5LJLA 4PEVA 5FL7A 3JR7A 1FP7A 1JXQA 1OXBB 2QX8A 1YH3A 3Q87B 4EPTA 5KYTA 2DUWA 1A82A 1LPBB 5HSGA 3QLVC 4J29A 3AM5A 4HYEA 4BZZA 1V5WA 1NOKA 4K87A 3ZYZA 3D6NB 3D6UA 1GUBA 3PSAA 3COZA 3VC2A 4DMGA 2I9PA 2ZDGA 4AG3A 1GQRA 4MIYA 3D0OA 1PR6A 1NBMD 1R6UA 3FMPB 2BMFA 4E4RA 4FGJA 3IJEB 4EW1A 2ZZMA 1T4DA 3LY9A 5EL0A 2CMFA 4FDUA 2FN8A 3SJUA 1ODFA 1SVLA 5EKDA 3ZXSA 5BN5B 5HIAA 2QTMA 3F6SA 3CNBA 3MYYA 3R5XA 1DP4A 1M8JA 2DAPA 1HE4A 3HNRA 1LUAA 1Q44A 5C34B 4XDHA 4AF6A 4BU1A 3IXMA 1HYQA 1RQLA 1VXRA 1U3GA 1NMZA 1A5AB 1Y82A 3SS7X 3WO1A 2EFYA 4JX9A 4Q3AA 3ZK8A 4RV9A 4DIOA 3TMKA 5LIPA 4OXKA 2PK3A 2Q4OA 3B6MA 2QE7D 2XGOA 4FP9A 4J0DA 5FP0A 3C74A 1RZRD 3HXMA 5JNRA 4JGGA 2F2TA 2XY4A 2P27A 4H7KA 2HB6A 1M66A 3ND5A 2B4TO 4I3FA 3NTRA 3THXB 1QOZA 1FY2A 5HGXA 1U7UA 4UTPA 1CJUC 3FDXA 3ZNQA 3S81A 4WZ6A 2WAOA 3CUEF 2JFPA 5E38A 1PYDA 1GCUA 4QATA 3ZIUA 4CTJA 3PC2A 5KUTA 1FQJA 1GN9A 1W93A 2PMEA 3ZHUA 5K8JB 3NPAA 1YDFA 4OXIA 1PJZA 3G6KA 2UZ1B 1E3WA 1W88B 2F43A 3H8VA 2HXSA 1UJBA 5IN5A 4ADSG 4C4YA 3K5HA 3AU9A 3EB9A 1WR8A 2DBQA 4WH0A 2FMUA 2QV0A 1WVIA 2R00A 2JIZD 5LL6P 3K9NA 4RX1A 2Y2VA 1GAXA 2ECOA 4HVTA 4K6CA 2RHTA 1OXTA 4PSAA 3ZCSA 3B2QA 2G25A 1S01A 3D81A 2G17A 2I2BA 1NNSA 2QU8A 2AFHE 5J2UB 2XCOA 4G0WA 2NZVG 5HRUA 1B00A 1G19A 1NAHA 2ON6A 1SK9A 3DTVA 3IELA 1Z39A 1ZGBA 2IP4A 3KOYA 4Z8XA 3V32A 2CMDA 2SECE 4BUJA 1CVIA 2O7SA 2V7XA 4C3ZA 1RVV1 3HVRA 4NS1A 2QRPA 2OUIA 2OORA 2AC2A 2R7KA 2CVPA 1LDGA 1YBMA 2DX7A 1Q17A 3CEAA 1AKWA 3N2YA 4X85A 5K3AA 5H9WA 3GHYA 1CR6A 4WFIA 1L5HA 1ZUD1 3PFCA 2AIRA 4KNVA 2GO1A 4LXQA 3BCSA 1V6CA 3FVQA 1V7CA 4UUQA 3BMCB 5DWQA 4YP7A 2FP4B 4IJ6A 1JKJA 3KALA 4JLBA 2DPLA 3V1TC 1J2UA 1NNI1 4JP8A 4MRVA 3WGTA 4NCIA 4KN9S 2NO4A 3AOEC 1D2MA 4Q12A 3MTGA 1LDMA 1Z5UA 4L9WA 5KU1A 3D7NA 1MB9A 1ZJZA 4DRYA 1ORVA 2R85A 5SY9A 2XTJA 3GVHA 2QF7A 4I0WB 3GXBA 3ILYA 3TN7A 4OQXA 4AJNA 1X74A 1JHZA 2W6JD 4IEIA 4KO2S 2EFJA 3QMVA 4J3FA 4PN7A 1YDEA 3U7JA 4HJXA 4N5IX 1HTBA 2ZXEA 5CW1A 5I9IA 4V0QA 3K9LA 4HTAA 4BP3A 1KEVA 4MS1B 4EB8A 1GAEO 2GD0A 3JALB 3KJQA 3S2IA 3UMYA 1P4JA 4CU2A 3WHLA 3DB2A 1E3EA 1U1EA 3AJRA 1Z37A 1U2ZA 1XAIA 3AJAA 3FCUB 3FVRA 5AXBA 3ZCVA 3H13A 4IJVA 3NTOA 4WECA 3MTEA 1UMDB 2A0KA 1TJ3A 2O2XA 2V0NA 3JSAA 1CFJA 3G6WA 1XMSA 4MZXA 3OZSA 1M7BA 1PJBA 3A6JA 4BL5A 2V7EA 5J58A 1FVFA 4YP1A 5TT0A 3U80A 2O2SA 1BX3A 2G40A 1EFHA 5KQGA 2J3QA 1WF6A 3FFAA 2QUZA 4HO1X 4DXAA 1EM6A 1MA0A 1NMYA 3B1XA 3BTOA 2A5YB 1VMKA 2I34A 3BRWD 2FETA 3RJ9A 4AAYA 1I2AA 4EKEA 1MIOB 3N6RA 5DLEA 1RHRA 3FLAA 1M34B 1L3CA 3GA0A 3KZVA 2P1RA 3PDHA 3QWHA 4RZXA 2BDEA 3VM6A 3P9IA 1NOJA 4S3MA 2X9NA 4EY6A 1WG8A 1B23P 3EQ8A 4P83A 4M60A 4YEDA 5LA6B 1BDJA 4ZREA 1Y5NA 2F8MA 1Q7GA 3B60A 1X80B 3PEFA 1DEKA 1XZCA 2UVPA 3HO6A 2BDUA 3BWMA 1CUGA 2VF8A 3I9V1 3V7UA 4TYQA 4LDZA 4KE9A 5T5QA 1LS1A 1W5TA 3CJTA 4IVPA 5J2TB 4RK7A 4MRAA 4KBFA 5LUBA 3AQIA 1ZL0A 1E8DA 4UU7A 5AP9A 4C5AA 3G0HA 1DHTA 4TSRA 2P67A 3PG5A 5BWOA 1CE8A 1WPQA 3KOWA 3MCZA 1CUYA 1DAKA 2RGNA 4QVKA 2CK3A 4QYMA 2IHVA 5K0BA 5JQGB 3IOBA 3KSUA 3VRHA 1E7SA 2AT1A 3DVAB 2G28A 3E5NA 1XC7A 1ISIA 4R31A 2IYLD 3FFWA 1IC6A 4TQUS 3C7DB 3O8OB 4XGQA 3WMFA 2NVUA 4AY4A 4CODB 2DFKB 2N46A 5F5LA 2OHXA 3JQAD 1CULC 4RFLA 2WNSA 1P7PA 2GXUA 2JD0A 3CKYA 5E0OA 3EGIA 2FA9A 2H0RA 4B35A 3U19A 3AB3A 3PLAE 2W8BB 4HFNA 3IP8A 3JQBA 4I50F 3GMDA 2VHJA 4ZODA 1FU4A 2Q49A 2YICA 4ICIA 4MS3B 4EG7A 1C1XB 1XWFA 4ZO6A 4Q82A 1J5PA 4HH3C 1DNPA 2CZCA 4DCUA 2VF7A 1QDLB 4EY5A 3Q8KA 4MNTA 2CE7A 4ZYYA 2EJWA 5KJ1A 1JG6A 1TQ6A 2VHQA 4M9CA 2JDIA 5ER6A 2BTEA 1OGIA 2ARKA 4O59O 3WLAA 1F4LA 3AESA 3MLEA 2QOEA 1S3FA 4UPEA 4IMPA 2HWWA 1HEIA 4H7HA 3LV8A 2OZLA 3RABA 1EUDB 3LL4A 5DW3A 3SK0A 2BZ1A 6Q21A 2BKXA 1R37A 1SC3A 4FVTA 2J1LA 3COWA 3FOFC 2NN3C 3VPSA 2PRYA 4B3MB 1YKFA 5JXWA 1H4SA 3JQRA 1Y4ZA 3REFA 2AFHA 1JEYA 1BCRB 1HDYA 3SVTA 3GGSA 4NEHB 2FW1A 4LDAA 1A7UA 1P7CA 1PL0A 4BCDA 3PUVA 1FU8A 1U04A 1V9CA 3A1WA 1N2BA 3SXUA 1OFVA 1YRAA 4RMHA 2FW8A 3SLKA 3NAGA 4FR2A 5E7JA 2XWQA 4ZVOA 3PE6A 3OHMA 3BRSA 9MHTA 3OEWA 3P9RA 2VYND 1NI4A 5DT2A 4IIBA 4K3VA 4XLTA 1BHSA 3GFQA 4HN9A 1L4FA 4P3NA 1P8JA 2ZT6A 4YXFA 5A2GA 1MJHA 2B92A 2NQTA 2YHIB 1WB6A 4GIBA 1CUVA 4U4AA 4LJYA 1ILWA 3BWEA 1XXLA 1V16B 2R65A 3B5JA 3FTNA 2NPOA 1WXHA 5E0KB 3BFJA 2JF0A 3LRPA 1KEUA 3T9BA 3TR5A 2JIBA 3V7YA 5HE8A 2GXQA 3VU0A 1E5DA 3MWYW 1SC9A 5I7HA 5ENDA 1EWTA 1QE3A 1LRJA 4MUNA 2ZPTX 1S6YA 3OCZA 2AOWA 1ZVKA 1XMPA 2ZSHA 1YHNA 3V9PA 4Z4HA 1WQ1R 3MJEA 3PDJA 2AR9A 4BFLA 2M32A 4IDDA 3K09A 4EZIA 2E4UA 3AI1A 3L0BA 4NX2A 4KPFC 3WAJA 4QPJC 2P2SA 4HPWA 5FT9A 1OZHA 2X8BA 1U9IA 5IJ0B 2OCAA 1PFKA 2X41A 3NALA 1UIRA 4YA6A 2R4UA 3GRPA 4P5PA 4DG9A 2FPLA 8GPBA 5LP1A 3P52A 4IDNA 2NZ8A 3RH0A 4DLKA 1QO7A 2GS9A 3GT4A 2YJZA 5IDXA 4H4CA 5K3BA 3MD9A 1M2NA 3GEDA 3TVYA 4KE6A 4ZOLB 5DN6A 4BDSA 4FB5A 5JJLA 4MEBA 3WI7A 1CJBA 2CV1A 4UJ3A 4F3TA 2I3AA 4FGLA 2R6ZA 1SCAA 3HN2A 3EVFA 3PNLA 3Q9SA 2WTXA 3PEEA 5BURA 3M6MD 2BYTA 4NRDA 1Z88A 1E1DA 2GBFA 1DAFA 4ETIA 2IX3A 4P0QB 3RVJA 1OFUX 2IXEA 2OESA 4LF6B 2XCLA 1VBFA 4NCBA 1RYEA 4HEA1 4OQPA 4WCVA 2RGRA 3ORHA 1UOQA 4A10A 4OY3A 3HYCA 5FA6A 3LQ2A 4QUIA 4PR0A 3HA5A 2YMPA 1C41A 5AK5A 3UTDA 4MI9A 4DV5B 1E1KA 3IAM1 1D6SA 4EG0A 1BN7A 1F17A 4EO9A 4AKHA 4XJXA 3ND7A 1XU9A 1VMIA 4HEHA 1BU5A 3PF9A 3HXPA 5E2IA 4MVJE 5BRJA 1F2UA 3O31A 4OLBA 3DH0A 4HZUA 1GU1A 3PQ4A 4GRIA 4KXYA 5TEVA 1TF2A 3RRZA 3VC1A 4DUGA 4H35A 4MCAA 3WMXA 1GPWB 5CNIA 4RMNA 3WDLA 4EHLA 2FWJA 2WEKA 4YALA 2CBGA 3G5LA 3T3DA 3IBGA 2O23A 1JJFA 3Q7RA 5KX5F 1GZSA 5E9WA 4ZVNA 3A1DA 3NHLA 2X23A 4P2BA 4B4DA 1A2BA 2CBZA 3S5UA 4QLOA 1M2WA 4RLFA 4I4CA 2QK4A 5DGIA 4X6YA 1TK9A 1OV4A 4M7RA 1IZZA 3Q7TA 1W36B 1IZYA 3EHEA 3I3OA 2FSGA 1BS2A 1GXSB 1XDZA 2WAAA 1T9BA 1X9HA 2C8LA 4FW9A 1P7ZA 3GOHA 4H1TA 4R5HA 4PG6A 1FQKA 5I7EA 1OFIA 2NYVA 3CH4B 1V1RA 2VDOB 4F3YA 5FWXB 4DJEC 3JVIA 2D7DA 4B3TB 2VQDA 3DBHA 1QS0A 2RGAA 4NAUA 3LQKA 1AKRA 4Y6RA 5FFMA 3KYCA 4DHEA 2ZROA 1QCCA 1RJFA 4Z8YA 3DNFA 2AF4C 2QTLA 4HNUA 1ADBA 4QQ8A 4XVRA 1AO0A 4WOPA 5A02A 3RE1A 4LBYA 2HCTA 2QLTA 4RD6A 4AI6A 4KYTA 1VP3A 3TTXA 4N41A 3LLSA 1DKPA 3I9JA 3PPVA 4ZCMA 1EBBA 2I9KA 3W4IA 2OCGA 3L8MA 4IYJA 1ZNXA 1RAFA 3MAGA 1RCUA 4G5FA 1H3EA 4CMCA 3KJGA 5EEHA 4A2QA 3TQFA 3ZE6A 4INJA 4QTXA 1FRZA 2I1VB 1G0OA 1I36A 1TX4B 2FWPA 2I7CA 2WYUA 3DOHA 2BSXA 1GTVA 1BXGB 1XUOA 2ZJ7A 1SZPA 4P8RA 1ULZA 3D8BA 3LRTA 3OM0A 4YAJA 4ZJZA 1N25A 1KEWA 3G7UA 1X9GA 4K05A 4KOAA 5EWLB 2ZTVA 3SIXA 4YV2A 1CQXA 3BMQB 3L77A 4MPRA 5IUJC 1BHQ1 1T3SA 2A0UA 3OFKA 4ZI7B 1ZN2A 1O95A 4RNCA 1RS0A 3E0QA 2P77A 4WFQA 1FA9A 2NWQA 1VLJA 4AUEA 4CKXA 4XYGA 2JJMA 5KJCA 4KX5A 2H85A 2AQKA 3AFMA 4L08A 1FFSA 2ZB4A 4IXNA 3FUUA 2UZ4A 1OBOA 4IDBA 1Z12A 3F3YA 2P4EA 4ERXA 3JQ6A 5CM9C 2HJGA 4PZPA 2TECE 1R88A 4CYMA 3LGSA 4LX0A 4NZMA 3RFUA 5HNKA 4B84A 4W82A 1B3BA 1NE7A 1XWWA 1L4BA 3SZGA 3HR4A 3W8EA 821PA 1II0A 1Y4DE 5BV1A 3HA3A 1XDUA 1CEQA 1W8DA 2IZ5A 1RYFA 2LE0A 3EARA 3DUFB 3RHFA 2OFWA 4R54A 5C31A 1Z7GA 3C0KA 1T4MA 4WHMA 4ZHSA 4EO4A 2JLXA 1KMHB 1Q6YA 3LKZA 1NBME 1AUVA 2YXDA 3P5SA 5EJ9A 4YJHA 3IP6A 2YOFA 2ZUVA 3F74A 3X2FA 4JUCA 1LW7A 5BNWA 3LXUX 1AK1A 4PBTA 1J06A 1EAYA 1L7PA 1KFBB 4O4IB 3ROTA 4FCWA 3OWXA 3F4BA 1N1DA 4NBNA 2I67A 2HL6A 1CRZA 1RWMA 1U4SA 2EKBA 1FX1A 2JFYA 4M3NA 5LZ4A 2QX6A 3T34A 2B83A 1E0DA 1E0KA 1C3OB 3MWKA 2GJ8A 4Y2GA 4AX8A 2C3YA 3VR5D 2ASVA 1SIWA 4D97A 3OMLA 2NQ8A 4LRQA 4XGNA 2DEUA 2O8BA 3GLRA 1OHHD 4XD7D 3N2KA 3ETEA 4RHFA 1Y9JA 4CJXA 1UT8A 4W8HA 1HE3A 5GOZA 3LFHA 3OY7A 1PT6A 2NYAA 3GRUA 2IL1A 1KYZA 5DULA 4TKVA 1ILEA 1GR1A 2NNLD 4RYLA 2CHQA 3CSUA 3LFUA 1I6MA 5DOZA 3DMHA 3WL7A 5CFPA 2N42A 5FOSA 2HWKA 2IF2A 4KRXA 4EG5A 2DHCA 4BX2A 1ZCFA 1RU3A 3FZYA 1O9BA 1VMDA 5LP6C 2FWAA 4C4OA 3L1VA 4FOOA 4NONA 4FB4A 4QVIA 4MKXA 3JASA 1NVEA 3IERA 2FMKA 2BEWB 1P9LA 1N2GA 3ADPA 2IYUA 5JMWA 2UZ0A 3VO8A 4H17A 2C5HA 4YRJA 2Q4EA 2ZDHA 1K75A 3C98A 1JE1A 3DVRX 1YC5A 3F6BX 3HP4A 3KSRA 3QFHA 4ZT4A 3VYVA 2ZB7A 4I6EA 4AJ2A 4F85A 5G53C 4F12A 1P2VA 3S44A 2D7CA 5GJCA 3HY3A 4I1PA 2KQUA 1XLTA 3BCUA 2H4FA 2P4SA 1VJ1A 4QNRA 4JYMA 3JRXA 4XD2A 4R2XA 3UA3A 4RTQA 2GFIA 1UXOA 3ANNA 3QOFA 5KYUA 3D4NA 3RS4A 4U8GA 3WJ2A 2FDCA 1ZC4A 5BUQA 1AE1A 1WP4A 1G16A 1L5VA 1Y4SA 2IXAA 4L5AA 5BQ5A 3IAAA 3UFXB 3GEIA 3TLCA 1F0PA 4O5AA 1RABA 4ZO7A 2AK2A 5NULA 1T8RA 2PVSA 2XUAA 3PL1A 3D3EA 1E8MA 3R7WA 4YRRA 4Z2AA 4EGJA 2WA1A 1AZWA 4TZ0A 3AWIA 6YASA 3W2EA 4OFBA 2HTFA 2J3DA 3WAKA 1DDGA 3QLJA 1A9YA 2LPMA 5AJTA 5EESA 4DCTA 4ZCIA 4M7PA 5IN4A 3VHLB 3PT5A 2V5AA 1YVUA 1E1MA 4B6FA 5JIBA 3LCUA 2K87A 4B0PA 3IT1A 5DVZA 2IX9A 1E79A 2MINB 5E2AA 1D2CA 1P4RA 3PJEA 4M87A 1I51A 4TLCA 3OX2A 1NMXA 2XMRA 4OQNA 1MX1A 2WUGA 2X8JB 4TVBA 1W73A 2PT5A 4ZVVA 4X1YB 3K1AA 2Q07A 5E6RA 1XMIA 1GPAA 1DAPA 3OF2A 5KQRA 4OTZA 1KEEA 1WNTA 3GLGB 3L6OO 1I6LA 2X0NA 3N7AA 3ZBTA 1Z82A 3VBEA 3HPRA 4GGOA 5E4JA 1GGHA 1MEOA 1XIVA 3CX8A 2M1ZA 3D43A 4G89A 3ETLA 4L4UA 4ZEXA 4ALIA 4PLYA 4WFKA 1ZU5A 3ZWPA 4RACA 3BIOA 1ZEJA 1PWYE 4ZVRA 3BD7A 3PCTA 3THSA 2GFHA 3KOUA 4NPCA 3A36A 3OJCA 2OP0A 3PHGA 1E7QA 2XYHA 1W0KD 3AEQA 4H15A 3ZDRA 4GOLD 3BBPA 1EUCB 1FQOA 1DEOA 2BCGY 2ZBDA 5F51A 1KR5A 4UUBA 4CIAA 4XDZA 1XEXB 1VMEA 4MDFA 4D4HA 3DAOA 1LJUA 1IY9A 1RRKA 4JB0A 3QKSA 3CKMA 4XB6B 3VPAA 1JQLB 1UFKA 3DR5A 4K9PA 1JG2A 1BKSB 4NBKA 4OHPA 4S24A 4DV2B 1N6NA 1OZAA 1JPJA 5COQA 4D1YA 1ANKA 2B1JA 1TB4A 3GLSA 3S40A 2IYAA 4YUYA 5IHXA 3L7KA 3RYIA 2AEFA 4NQZA 4TTQA 1SM4A 4UAGA 3HDQA 1UK9A 1MA3A 1ML3A 2CF6A 1K3FA 2F3QA 3BK7A 4HEQA 3AHIA 5D01A 1ONBA 3MJCA 1MPXA 1V43A 5DHSA 2CHFA 1NBMA 3EEQA 4DDMA 3LUKA 1LTHR 4KWIA 1FTSA 1G41A 4HNGA 4DNXA 2P2ZA 4DBLC 5MN4A 4IF6A 5EVJA 5EE9A 7ADHA 4I9UA 4F92B 5EIEA 2O06A 2XDQB 5IEBA 5JRDS 3HP1A 4KK3A 1KYYA 4WWHA 4FFVA 4HAOA 1HE2A 1N6PA 1SHJA 2FDRA 4AN4A 3SU8A 3V8MA 1VPLA 2C04A 3C3XA 4IJKA 4UM9B 3O6VA 5CH8A 2ZAGA 4MUIA 2PJRA 1UP4A 3E9QA 1G8PA 5KTYA 2IU4A 1JZSA 3AIOA 1FUIA 1NLYA 5IKOA 1G6KA 1QIJA 3EXFA 2VH5R 4RF4A 1I9GA 3M49A 2YUTA 3EDYA 4Y67A 3IOYA 2ZBQA 2IZZA 1J2EA 3NCTA 1F14A 1ZN9A 3QELA 4WXPA 2EBHX 1JGTA 3FROA 1PL7A 2JB9A 4AJJA 1Z7WA 2WUFA 4UVEA 4N65A 1U3TA 1X1CA 1YS7A 3DYVA 4RQBA 1KSGA 3WWYA 5LU8A 4XIFA 3LBIA 2AN5A 2A9PA 5CLLA 3VR6D 3GQVA 1UINA 4OXRA 4K6FA 1N57A 4U6NA 5KQLA 4W5QA 4KPYA 3HZZA 4F2PA 3UB2A 3AFGA 1Y1QA 1B8NA 2IVFA 3E5HA 1OX4B 4ZAGA 4DPLA 2I66A 2BEJA 1F8UA 3ELWA 2SKDA 3Q85A 2A86A 2CD9A 4WT7A 5GPBA 5KNBA 3OCVA 1GYRA 3FPLA 2H4XA 4UEOA 5G02A 3GQBB 3PA6A 4JKYA 3QKUA 3EFOB 5EIFA 4INOA 4D99A 4YMLA 4TS3A 3IE1A 1E2KA 421PA 1BXRA 2JIZA 1DCMA 2QM0A 2BFBA 4NHEA 2XCUA 4LISA 4JDUA 1D0IA 3TG8A 2NVBA 1IYZA 1QBGA 2HLPA 4UE2A 2HWUA 2IOFK 4POAA 5FD8A 3HJAA 1SH7A 3TD2A 1E2QA 2A84A 2BI4A 4LYFA 1FF9A 1PKXA 3LWBA 4CI0B 3U44B 1X7WA 5CR9A 4JVMA 1KQNA 2D2VA 1XAHA 5SV2A 1ESEA 4JI7B 1Z5ZA 2ZUFA 1C7ZA 3MSXA 1P3DA 1LVUA 2PNJA 4PG4A 3WTBA 2I33A 1I4WA 2E6KA 3VPHA 4UC0A 4TLLB 3WS7A 5IU6A 4G86A 4M2LA 3U4DA 4BNFA 4DV0B 2PEYA 3OTHA 1Z4KA 3L84A 1BU8A 3IV6A 4KV9A 1LPSA 1XNHA 1QGUA 1IJFA 3MNFA 3OFVA 4IIJB 4R1OA 3RSSA 3ZE7A 9LDTA 1C14A 1UKAA 4O3MA 1SXHA 3SD7A 4DVJA 2VA9A 4J0FA 4EI7A 1Y81A 1PFQA 2BFEA 4LDRA 4RM2A 1ORHA 4ER5A 1E59A 5G3YA 5AJWA 3R0VA 4PLTA 1ZGAA 1SO8A 1PCXA 1Q1ZA 4GD3Q 4YJFA 4L6IA 1WY5A 2CJFA 5AESA 3KUCA 4LFCB 2ZWIA 3PFIA 3M4NA 1YKSA 1Y6QA 2R1TA 5HFNA 1H8ED 3R74A 1KEZA 2WTMA 4KI7A 1RD4A 2O1WA 2W6JA 4UBOA 1N5KA 1TVKB 4N3AA 2BZ0A 2UUPA 1AXRA 1NMQA 2VXYA 4AJOA 4HMQA 4CIYA 3BRCA 4LK2A 3CMCO 1YNSA 3K96A 4ALLA 2WYIA 2O8FB 3D0RA 4TYNA 1JYEA 3NDJA 4YDQA 3VH2A 4RENA 1IQPA 2HBRA 1XF9A 3LC0A 1N7HA 5CPFA 2RG7A 5AVUA 1E18A 5JE8A 3RJTA 5EXXA 5DKFA 3BWCA 1DUVG 3ELYA 5C8DA 5FI0B 1QNLA 10MHA 3EA5A 4EECA 3UCXA 4Q66C 3V6MA 4BQSA 3WLEA 3OZAA 4FMDF 1I7DA 3D3QA 1PTJA 4OAPA 4A2CA 4FEAA 3TUIC 2VJMA 1ZM7A 4K6HA 1NP6A 3UJ8A 1JAXA 3DXXA 1NASA 5K3FA 5BV8A 3GJ3A 2O6HA 2HEGA 2YZKA 2FZKA 3ENNA 4I55B 1W4RA 4JIMA 4DZRA 4LDJA 3T4EA 2O7QA 3TQIA 3QX8A 1NVDA 4ER7A 8OHMA 3PD0A 2QLBA 3EYAA 4OO3A 1U1IA 3M6XA 3IC5A 3IVRA 2Z6UA 2B34A 4CKCA 4WAUA 2WICA 1E32A 5K09A 2JFBA 3E7DA 1DOAA 1GRCA 5TPZD 3VZCA 3BQNB 3V5NA 1D2HA 4D9JA 3FZQA 1U8XX 1VA5A 1ULAA 5GINE 2HC9A 1EQAA 1XZFA 1UPBA 2FUKA 1YB4A 2WWXA 2YJNA 3H05A 2RHOA 3OWHA 3QY0A 5B3AA 4CW7A 4RC9A 5I4KA 3GJ7A 1ZNWA 5LMCA 3MWDA 1FMFA 1P2BA 2GJ9A 2GKGA 3NHYA 2OXIA 2E4WA 2P9BA 4BO4A 3CV3A 3W2IA 2BEKA 1Z9BA 4ZOCA 1SBQA 2VNAA 2CEKA 3G8CA 3DKIA 4YMIA 4J2TA 2P6PA 3ZI0A 2B4QA 3W0LB 2PIDA 5K6RA 1ZSNA 3HZHA 1U8EA 1MJGM 4S35A 4L0DA 5JPDA 5EKSA 2ZTLA 3IT3A 1MT0A 1X8LA 2W2NA 1JILA 1Y1KE 3E5MA 5D1NA 3UHJA 3QG5A 1CJTC 4N39A 3JQFC 3TLAA 1BWRA 3MBOA 2C94A 1C5KA 1V95A 2IZ7A 3L04A 4F4UA 1GFWA 3JQAA 8ADHA 4CCWA 3EJWA 3GZNB 3SQDA 3T9EA 1P1JA 5ECYA 3DYIA 1M2FA 3JW8A 2I1WA 5GVSA 3D3NA 4R5MA 4BASA 3PPXA 2OAQ1 2QJRA 5BUCA 1G21B 1LNSA 5ICFA 1QHIA 4C1BA 5JAOA 5D6OA 1A1VA 4KQJA 1Z0JA 1GTJ1 2GYYA 2F3RA 3T99A 4M86A 3VAAA 5FPKA 4KRYA 3NHZA 4B9EA 1WETA 2WVAA 2BOVA 4HB3A 4PZCA 1JXOA 1WSAA 1OFHA 1UP6A 4UU1A 3MINA 3QUCA 3NTLA 3BWDD 1V3TA 2MR5A 4X63A 1O1YA 3KJEA 2L17A 2C0CA 2JFHA 5AW8A 4PSKA 5C1DA 1EU1A 4KO3S 1DX9A 4U5XA 4Q5IA 5GGXA 3MQFA 2ZT7A 3MW8A 1SG0A 2ZKLA 3M81A 3BICA 4NPHA 2NU8B 4I8IA 3ZV3A 3R6WA 3S6JA 4CU5A 1SA0A 3IQGX 5C9ZA 4HDRB 3U3MA 2BL4A 2LV8A 1SOWA 3PRYA 4LY9A 1IY1A 2XNSA 3JQGA 2I1QA 4W63A 4KQKA 5EHXA 1WCIA 4XUCA 1Z8HA 2E7ZA 3NONA 4KIWA 3HWX1 4EFNA 3PICA 4TUYB 5IVPA 1DC8A 1XQ6A 4P92A 2Q50A 2PH1A 3EN0A 2FWIA 2ZJ6A 3AUUA 2RH8A 3GARA 3L43A 4FMPA 4OYHA 4TMKA 5THXA 3VZPA 5AT1A 3AUAA 4KVAA 1G20B 1XDBA 5ILOA 1W7AA 2CHEA 3PGA1 2X22A 4L27A 1TGYA 3QYJA 4WXHA 2XYGA 5JAIA 4CMIA 4QOIA 2WPDD 3DE6X 1HA3A 1S2GA 3DCYA 5IT0A 1Z16A 3E4DA 5G1PA 2Z2ZA 3H1BA 1NBWB 3ZE1B 3S1AA 1Z0AA 1UDCA 3C6MA 2W0MA 5F76A 2EW2A 3KEMA 3RC7A 1U0LA 2ZREA 1X3LA 1N2CE 4KFRA 5DEOA 5DDIP 4DTCA 1FDOA 1EDZA 2ZVPX 3FMVA 3H18A 4YNBA 3WWDA 4GNKA 4G0VA 4B73A 2BW0A 3WIDA 1H65A 1YQDA 4OREX 4W5NA 4OMCA 4TROA 3RFXA 3UANA 2A4MA 1G3MA 1QQ5A 2GN8A 2RFLA 4H1VA 4URUR 1QHSA 3ZY4A 5KYGA 3IPRA 1RZVA 3PVCA 1R9MA 3KAKA 1GA4A 2A5FA 2HW8A 3A9CA 3T5AA 2CXHA 2ERYA 2ATEA 2YIVX 2ZRBA 3MG9A 3SZLA 1BVYF 5DSXA 3X1MA 1LBEA 4RMIA 3WB0A 3CJQA 3OJOA 3A4MA 3I01M 3U0BA 1N2OA 1XRPA 2DH5A 1LNZA 1YGYA 3HCCA 3L8DA 4IDGA 5KOHB 1JQDA 2DCMA 1YWGO 2VP2A 2WW8A 3WTCA 3ABQB 2FJUA 3KT3A 1YI0A 3IAFA 2B0JA 4F45A 5A4JA 1TKCA 5LQMA 1AUOA 5CX1B 3UO8B 2NTJA 3Q40A 2E4YA 3QEKA 2PKYX 4XYMA 3SOPA 3FFXA 3I42A 4J7UA 3H9EO 3IUPA 4P22A 4HPXB 5AM2A 2VJOA 4N7RA 4U7DA 1VRWA 2V4UA 4E5NA 1OLUA 3AZQA 4K2HA 4KOEC 4ZOAA 3C15C 5J63A 2GZMA 2VDQB 4PZAA 5E7MA 4AY5A 2D4AA 3U40A 4AW9A 4F6RB 5A2QA 1UFQA 1FP4B 2EYQA 3OCWA 2JGKA 1VE9A 3FD8A 4R8LA 3ROEA 4F4FA 1T6XA 3CRQA 4YBRA 1ULHA 2GZSA 2Z98A 1IL0A 4G25A 3OCYA 1TLTA 5T64A 3B1ZA 3GJYA 2IEGA 4BXOA 1OLXA 4JK3A 3HK2A 3TE7A 1SPBS 3VTAA 4CM9D 1NFRA 1I9CA 2B8JA 2VHWA 1PT8A 3EXHA 3GCWA 4OK3A 4V0LA 5DU2A 3CF0A 5EQJB 5AW5A 3ZS8A 2RHRA 4AG5A 4EYKA 1J1UA 4FHGA 4R2MA 3H1AA 4IWNA 5ELLA 5FOWA 1ZIXA 4RZIA 4FQ7A 4A16A 4EDFA 5AD1A 5AW2A 2A0WA 2G7ZA 3ZV6A 1AGXA 1EFLA 4U0JA 2AOUA 3ZZ1A 2EW8A 4ABYA 3JWJA 3THYB 2BISA 2R7LA 5B57C 3WO0A 1ADGA 5BWMA 4JYZA 4M53A 3ZY3A 4YAGA 4CLRA 3ZE2B 2HRDA 1PDWA 1E9AA 5P21A 3RYFA 3OQ6A 1EE1A 2RAPA 1D6MA 4R05A 2A0YA 2H1CA 4Y0NA 3TR0A 3U4HA 2O52A 5J43A 5KVCA 3U5ZB 4EMBA 2UXBB 2WU1A 2H65A 4D4JA 5DNVA 2ZPUA 2HRZA 4N7BA 4G1MB 3DLHA 4AUMA 1JU3A 4GS5A 1JI0A 2WTBA 1A97A 3FGZA 1H4TA 3LXXA 5F7OA 1RWBA 3IBFA 3L0OA 4A0RA 4UNNA 1DS6A 1PJCA 2AXNA 3KEQA 4QDUA 1CZRA 3LPAA 4KXVA 1L4YA 4DRXB 3BGDA 1ATZA 3U17A 2FPUA 2IZ6A 1I4TD 1O7JA 1SK8A 2ZSFA 3DVLA 2IUTA 3JATA 3I6IA 1FS5A 1MAWA 2HF2A 3OE7D 4TL6A 1KDYA 1GG9A 3DLBA 3INRA 2ZI5A 1EDBA 2WI8A 4AD8A 2GEKA 3AKCA 4H3SA 3LZ6A 4B6RA 3HU2A 3LK6A 1R4MB 2F1RA 2ZB8A 3UW3A 3R2JA 2BGGA 3AHGA 3KNZA 2ZBVA 2OYSA 3DTYA 2QGFA 4DV1B 1MO5A 2WJHA 3T0GA 2VR1A 4OVKA 3EZXA 2FWMX 3VVLA 4DMUB 1I80A 2CVFA 2C07A 4MYCA 5L3QB 4OHZA 2BHLA 4CF5A 3PKJA 3FE2A 4FNAA 4F4CA 4HWRA 5J5CA 1R6XA 2HLDD 4G8CA 2QR3A 5K8IA 1HYHA 2EJVA 1XA4A 2HOQA 1FTQA 3AY3A 4TYMA 4DN6A 2WB4A 5F23A 3CH5A 3DJYA 3G17A 1YCFA 4YDRA 1K7YA 3N3BC 3W90A 1YR9A 3RFFA 4GPTA 3MTBA 1GSIA 5BW5A 4LJ8A 4E22A 1LF5A 3L8YA 2DXIA 1PK9A 3WL5A 3Q12A 1QPBA 1JHUA 1L4NA 2XF8A 5HZHA 1NLFA 5LDGA 1S8AA 1Y7HA 4LYEA 3GJ6A 4HWTA 1TCCA 1UKBA 3RTDA 4ZZIA 4OLHA 1TJ4A 1EFKA 3R0IA 4KN8A 4TYYA 5LWHA 4NFYA 3MTDA 4REQA 5KVVA 2DSTA 1N2CA 1VECA 3EOBI 4OL0A 2FEMA 2XGGA 4L07A 4TT8A 3TZKA 1QFJA 2GN9A 3GBSA 4ZU3A 1M3SA 1UADA 1YQUA 4OBXA 4YCAA 3WE7A 4XM2A 4G5RA 2Z3VA 4GVPA 4F56A 5ALWA 2NIPA 3GJTA 4F8EA 3BDAA 3D3WA 3VR1A 2IITA 2KS6A 1B8VA 2RG1A 3F3SA 3NNNA 4I5FA 3ZHOA 2NZYA 2GD6A 3AZOA 3NWEA 3GPIA 1VHLA 5A62A 5D7BA 3OE1A 4A8JB 4AQYB 1WULS 3PPYA 2CCKA 4RK1A 1G2IA 1NF9A 4OP3A 1OZFA 1T2VA 1Z5PA 2G5GX 2JVIA 4KH0A 4X3OA 5JSYA 3K7EA 5IZCA 4EDHA 4CCAA 1ZVJA 1T2DA 3B6EA 4JMPA 2F8SA 4E33A 2B36A 3S3TA 1QE5A 3ABSB 3VR5A 4ZRNA 1Z5OA 1HDRA 3A6DA 2VYQA 2WMDA 1P39A 2DQYA 4G2TA 1OHHA 4J0QA 5K8TA 4LNUA 3L3BA 1K86A 2D1YA 2J6HA 1GAWA 4BQOA 2AJCA 1FLNA 4FKZA 4I81A 4HDNB 5FYQA 3FOCA 3UV6A 2A9JA 2A6PA 1KXJA 1L4GA 2DECA 3DZHA 3NNDA 4G8DA 5BSTA 1ZRSA 3KLNA 2O0LA 2GHTA 3D6FA 3HI6A 2LR0A 2WYOA 4CF4A 3AI7A 4OMDA 4KLNA 2ENWA 3R3YA 5ARCA 4MV0A 1VJCA 1YXMA 2IELA 1QQBA 1N9GA 1KGSA 1W2HA 1E6EA 1M2OB 2CHGA 3IJ5A 4AN0A 1CB7A 2WJPA 1EK0A 1RNLA 3FTFA 1T5SA 2VL7A 3IKMB 2Q9CA 5SICE 4KGZA 4M7WA 1JEQB 4Y2JA 4BO2A 4DBLE 1W4ZA 2AMJA 4I1UA 2BZSA 4H1HA 3MMSA 3MERA 1CU1A 4D4MA 3E8SA 2EFDB 1O8BA 3KLMX 3UUEA 4E21A 3R7NA 4B3FX 2Y0BA 4R7GA 4LF4B 3LA6A 4PZ9A 1ZITA 3GAFA 1Y8ZA 3H65A 2ZYRA 3DFZA 1H5UA 5HF8A 3VDQA 3O3CA 4F84A 4FFPA 2D2IA 4MUMA 1MOSA 2H51A 4C9BA 3BEDA 4P35A 2PXXA 3ZGOA 3HFSA 2ZRQA 4M9ZA 1UK8A 3IP5A 4D74A 4EJSA 5JSZB 1ONPA 1YU9A 2RDMA 2FSVC 4ZQFA 1BEUB 5JO9A 1X19A 5L3SA 3BEOA 5C81A 4N6NA 3HBNA 2GM3A 5A5DA 5LFAA 1NF2A 1SCUA 2X3UA 4R1MA 3WX0A 1P6UA 3TH5A 3RWBA 4BOYA 3KAPA 2ZVDA 5FI5A 2VTBA 4IIUA 1E6WA 2ZULA 3HSKA 3EQZA 3A70A 5EG5A 1KH3A 2QXTA 2XXJA 3FKQA 4M83A 4RY0A 3RI3A 4DEYA 5LC1A 2HJWA 3O38A 4GX5A 3U81A 1AGNA 1YQTA 3H04A 3UY4A 2Y99A 2Q3DA 1E1NA 1F3OA 3B2NA 3O9ZA 3PNYA 2HJVA 4V0ME 4KIUA 5D87A 1PEYA 2IUYA 3GA5A 4UHFA 4G2NA 4BTVA 4DM3A 3W8RA 2A0XA 3M0EA 4V3CA 4WL0A 2Q3HA 1CB0A 4UREA 1E0SA 1GG8A 4UXJA 4WUVA 3IIMA 2ADOA 4XQGA 3QLTA 2ZSIA 1OUMA 2YY7A 4N12A 4IIYA 1NQAO 3MGKA 4GH5A 1P31A 2HU2A 4XRRA 4B33A 1KRHA 2ZE6A 2AK3A 3W5IA 3G0OA 2I65A 4Y9RA 1RMQA 3A0RB 5JYBA 2ZU6A 5MHTA 5GONF 3PJRA 2P9FA 1BE8A 1OZGA 1DJPA 4A92A 4WOBA 1E5QA 2HSZA 3O74A 1U8TA 1BTOA 3EVDA 4G4SO 4MW9A 5AO9A 2G09A 4G0PA 3ADBA 2FQ1A 1Y6FA 2Y1LA 1PGPA 2WSIA 1L5ZA 4YRSA 3B52X 5JQWA 1FFDA 1C1DA 3C2QA 3ZKWA 3EXEA 1QR6A 5JECA 5CU7A 2RI6A 4H16A 1WEHA 1BRTA 3EFEA 4EPRA 5EIXA 3KDSE 1KR2A 2GN4A 1K2VN 3U3RA 5H02A 3T5MA 5KPDA 4CXMA 5CT4A 4KVZA 4HDKB 1ZVMA 3UOGA 1A95A 2P9EA 1BE0A 4NU0A 1ORWA 1VCIA 5ITZA 1A9ZA 5J4VA 1S4MA 2X0KA 2D3WA 3AJ9A 4L75A 1WMDA 4DR6B 3B7PA 3KB2A 4QARA 4B6SA 4RTOA 4NR0A 1WHSA 4JA2A 3N7UA 5FBKA 4WA8A 1CQJB 4IM7A 3AHCA 4II2A 5ESWA 5HZMA 5JUWA 4NZYA 2VXOA 2J45A 4UBJA 3CTMA 5A0FA 3BIFA 4LF9B 3IP1A 2CJWA 1E3DA 3MWLA 1K9VF 4IVQA 1SBTA 1AV7A 1XEWY 4RPKA 1RQGA 1JDBC 1KHTA 1VGRA 4RKQA 2AG1A 3F8WA 2NXCA 3NKLA 1XD2A 3H1PA 4RELA 4X6UA 1FXWF 5AI8A 1DCTA 3T1VA 2WHEA 4WLOA 2YW2A 1BW9A 4I36A 3PSHA 4OGWA 4ENQA 3CPHA 2DSNA 3ZWXA 2B7BA 4YJ2A 4DEVA 4ILKA 1YVPA 3NV9A 3CM0A 3FBGA 4WQMA 3ZXIA 3C3DA 1UP7A 5EP2A 4GYYA 4AXBA 1H3FA 4R84A 5D8DA 2DWCA 3RBVA 1JQAA 2GK4A 1FP2A 3MJRA 4YMVA 5AW3A 1UZLA 1XRQA 3S8MA 1U2DA 2DWUA 3NHPA 3GGJA 1I7PA 4IFIA 3BWYA 5EP1A 2FE1A 2JGAA 4D4KA 5KQPA 4LV6A 1DAMA 1U0FA 4QUBA 1KPHA 3TAHA 3CVWA 1XZDA 3E8XA 3A2NA 3URMA 4RBNA 1J70A 2Y1OA 5I8ZA 1O94C 2QUKA 1JAHA 3FSEA 5DLQC 1ISRA 4DCSA 4J4TA 4UDOA 2PL3A 1SG9A 4Y1EA 5MDHA 1T2NA 1CW2B 3BTUA 4G41A 13PKA 2NV6A 3OEED 3L40A 2BMEA 5ECWA 1R9JA 1HH4A 3ZI4A 2LBPA 4TRJA 3VR6A 1MCZA 3AO0B 4Y0VA 2H9YA 3ROGA 4LYJA 3IV9A 5DMXA 2RJOA 3P4YA 5ES3A 2C57A 1QGYA 2PLRA 4Y9TA 4L95C 4TXMA 4LGMA 2RK3A 4LYYA 3EGDB 3ME5A 3N05A 2YV2A 2EW1A 1YOVA 2IY8A 4CM3A 3RUPA 1R8JA 2V8BA 3L7MA 5J5AA 1EFPB 4DLNA 4BLOA 4DDUA 2P3OA 4J16A 4BLUA 1UEJA 3C3YA 3L7DA 2WD7B 3WYFA 1NVBA 2WIDA 1PUXA 4KHZA 5I8PA 4QQNA 2AKEA 5CIWA 3GDFA 5JTUA 4G9EA 1UZMA 2JC3A 4YAEA 5IBRA 4YRAA 5CH5A 1A0OA 1DL5A 4G0NA 4CLXA 3H5LA 1AT1A 1KK0A 2FX2A 5B7GA 3PITA 2ZU0C 2ISSD 1IOVA 2IYPA 2PKRA 2QPAA 4NZNA 3UTCA 1HNZB 1C0LA 3P20A 3PJDA 1GRNA 1VXOA 3X44A 1W75A 3LDFA 4BVJA 1XJWA 1MAVA 1LTKA 1ADJA 4CETA 1CDZA 1NY6A 2AMVA 2Q2WA 5J4LA 2B5VA 4BNHA 1OI4A 2P1DA 1O94D 2ZJ4A 4O8ZA 3DR3A 3TL3A 2VNIA 3KOZA 4AFNA 4F3KA 1OWLA 4H3HB 2GARA 3VU8A 4OAOA 2X9LA 1MD9A 1H2RS 4X7PA 5A05A 1PG0A 3PQ3A 1I5RA 4UQLA 3ZWYA 4KGVA 4YFYA 3B9BA 1UM8A 2UVDA 1RI2A 2WWFA 3D7MA 3OT4A 1VE6A 3FLMA 3EWAA 3IEUA 3WXMA 2GVNA 3G5TA 5I5GA 5GM1A 1T15A 1R3UA 4V0MA 1A71A 2JH9A 1J0AA 1O08A 2XUZA 3F47A 4Q1FA 5L7YA 2D1TA 2I1LA 2BBOA 2FN7A 3C6ZA 1H8EA 2I91A 1WXFA 2B4KA 2BKEA 3N2ZB 3PEYA 4R0VA 1JEDA 4QUHA 1PGJA 2XLCA 4GL2A 3SBEA 1R0ZA 3NPMA 1G66A 3G7NA 4RANA 3UXHA 3BX1A 3GEPA 1PX0A 1P1RA 1LPMA 3GB9A 3KK0A 1EK1A 3CU5A 3FI9A 3PPWA 2EFHB 1YDHA 2RI1A 4GG1A 4P4NA 3RBXA 4AUNA 3LS2A 3GUHA 2Q0XA 4R8MA 1U2QA 1TT5A 2XBMA 2QQGA 4FC6A 4TWAA 3GD7A 1FFWA 3I92A 3ELBA 3GRAA 3VR5H 3TNDA 4FFLA 4HV4A 3IVXA 2D06A 1R8YA 1LFDB 1T36A 3OU7A 5FPSA 4GC9A 4RA6B 1BNCA 2CXRA 3KE8A 2JKYA 2PYZA 3Q72A 1HNXB 1VYUA 5HUQA 1X1AA 4AJHA 1BOOA 5DTEA 1NBOA 4BB6A 1K9SA 2AJTA 1EFDN 3ENZA 3JWPA 3KTOA 2J3IA 4BIMA 1V0JA 2HF7A 2G63A 4PZZA 3L0DA 4M46A 2HJSA 3CFYA 3DB1A 4LVCA 1J2JA 4RDHA 5IM5A 1V25A 2RB4A 3PHCA 5JAQA 4RCZA 2OD9A 3RVRA 3JU3A 4DRZA 5A6VA 1VLMA 1GQQA 1X7YB 2XKAA 3ABZA 3AR9A 5H81A 4E15A 2COEA 5L7WA 2ZWVA 2WB2A 3SF8B 1D9XA 4DPMA 1XZNA 3EY4A 2QS9A 2VHEA 1V7ZA 3GN1A 3IPLA 5TPZA 1G17A 4WOCA 1CQZA 2JFNA 2XSZD 5GONA 3SYKA 4FYIA 3F49S 2PL5A 1PTKA 2V4MA 4K46A 4Q03A 4EVSA 2AN4A 3R3HA 4Q9HA 2OXTA 5IYZA 3QJGA 4YJKA 2BTQB 3DEKA 3GFSA 1QIKA 2XB4A 4Z3OA 1YF3A 4KDCA 4LVOA 2PPVA 4YJGA 3KQYA 1PJ3A 5DZSA 5EKXA 2P7IA 3LT1A 4CMGA 2NT4A 2G04A 1TM5E 2F3PA 4ZO9A 1HETA 4CQJA 2K7ZA 1N5JA 1Y33E 1YL5A 3EXAA 4WY5A 2DG2A 3H87A 4D6YA 4JBIA 4K9QA 1SJ9A 1VHWA 4OI0A 2IQ5A 2Y6VA 2ZJAA 4ZZ1A 2YHBA 1GLNA 4MH0R 4HH0A 4G5SA 1ZIPA 1IHOA 4EVQA 2WU0A 3C8UA 4Q3BA 1T24A 1P1IA 1U8YA 1MMFB 1SURA 2XQKA 3CNEA 3F3MA 1KMMA 1T5HX 3ADDA 1A04A 1OWNA 2YC2C 4YRNA 1P44A 2WG1A 3IA2A 3AUFA 4R68A 5CJ2A 4EA8A 2VPYA 5F3RA 2ETVA 3NIBA 5ARDA 5JZMA 1IWPB 1GUFA 1IY8A 1TCAA 3NRCA 3L8HA 1U3VA 4DCGA 1XMVA 2H31A 3FSJX 2MOKA 4O2BB 3I2KA 2I4MA 3K4HA 3Q10A 4KWTA 4P3XA 4BNMA 4B3IA 2GERA 3EUEA 1BG6A 2AZMA 4JI1B 2WINI 3GJ8A 4MZDA 2QJOA 2XMSA 3SQNA 4PG8A 1NC3A 4O0MA 4WCDA 5JRZA 2BC9A 2X14A 3EWNA 3A10A 3E70C 3MS2A 5JLJA 2GUGA 3U9SA 1LBSA 3RADC 2J09A 4LYHA 1BDHA 1A4RA 1AKQA 2V0CA 4QM7A 2CLFB 2EL9A 2A57A 4G1FA 3SQLA 4XWKA 4AO8A 5EJ6A 3FPSA 3VDRA 1E69A 2R66A 2Q3BA 4Y8VA 4TZTA 3PU6A 4B46A 4EG6A 1ZJ4A 1N2HA 2H1SA 4KXFB 1P9OA 3F67A 1BXKA 3HYNA 2XD9A 3BJIC 1U5BA 2KPOA 1PNTA 1Z8DA 1DKLA 3EBLA 1G42A 1PD0A 3WRYC 4TYPA 1E62A 2YFQA 4BNWA 3COJA 1A76A 4O1IA 5JDIA 5LYJF 5JJIA 2H3EA 2G9NA 1VLQA 3IAHA 4BVHA 3R5JA 4NJMB 4JEUA 2ZLBA 3KETA 4DIBA 3IMEA 4IIDA 2OD2A 3A2MA 1T9DA 4GZ5A 3HJNA 5C4GB 1R64A 5D6NA 4C7MA 2HD4A 5MN6A 2WPDA 1KIAA 3BGVA 4ITVA 2X40A 4FPXA 3O8CA 1XKQA 4TVOA 4A6EA 3KQLA 1L4KA 1Y4AE 2WP0A 2WTEA 4JQSA 3PUXA 3FBWA 4HAYA 2W6MA 1T0UA 4RE6A 1Q84A 3DLIA 3BMXA 4DQVA 4L9SA 2C4WA 4M8LA 2C7QA 2CNOA 2OSVA 2REQB 4BUCA 4TMTA 1A96A 3ZWMA 1C81A 1GPUA 1PVVA 4OQDA 5ENVA 1M76A 2C4NA 1BH2A 2VP6A 1UM9B 3A9RA 3D2AA 5BN1A 1AA9A 4Z3KA 5E9JA 3JS5A 4C76A 1IE3A 2VHZA 3P9ZA 4R7ZA 5E8JA 4IEEA 3RIGA