2GN8A

Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with nadp and udp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
327
structure length
327
Chain Sequence
MLDNQTILITGGTGSFGKCFVRKVLDTTNAKKIIVYSRDELKQSEMAMEFNDPRMRFFIGDVRDLERLNYALEGVDICIHAAALKHVPIAEYNPLECIKTNIMGASNVINACLKNAISQVIALSTDKAANPINLYGATKLCSDKLFVSANNFKGSSQTQFSVVRYGNVVGSRGSVVPFFKKLVQNKASEIPITDIRMTRFWITLDEGVSFVLKSLKRMHGGEIFVPKIPSMKMTDLAKALAPNTPTKIIGIRPGEKLHEVMIPKDESHLALEFEDFFIIQPTISFQTPKDYTLTKLHEKGQKVAPDFEYSSHNNNQWLEPDDLLKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of FlaA1 from Helicobacter pylori Reveal the Mechanism for Inverting 4,6-Dehydratase Activity.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
molecule keywords UDP-GlcNAc C6 dehydratase
total genus 102
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 4.2.1.115: UDP-N-acetylglucosamine 4,6-dehydratase (inverting).
pdb deposition date 2006-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2gn8A01
3.90.25.30 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase; domain 1 2gn8A02
1Y1PA 2GDZA 1BXZA 2PWZA 4OXNA 4XYEA 5EERA 4A0SA 1WAMA 3TOZA 1M6HA 2QRKA 3AFMA 1XKQA 2I3GA 1FDUA 5KWEA 2HRZA 4YB8A 1PL7A 2DC1A 2R2GA 3I1JA 1GV0A 2AE1A 4BO1A 2D8AA 4ND3A 2VYND 4KTTE 3FPLA 4GGOA 4BNUA 4CLDA 3MJCA 1T2EA 1DLJA 1LJ8A 4MVJP 4BKRA 5K0ZA 4FDAA 1NR1A 4WCFA 4JQCA 3GEGA 3QIVA 3EVTA 4AJ2A 2WE8A 1DIGA 1HLPA 2VRCD 1WMBA 3CIFA 3GMSA 4OQZA 1HYEA 4AJLA 3D0OA 4IXWA 2Y0CA 4NFSA 2I99A 1KETA 3E18A 4QX6A 1FDSA 2G0TA 3LT1A 3WS7A 1D4FA 1T4DA 4ALIA 1BMDA 1Y7TA 1YOVB 4WLOA 2CZCA 4P4GA 4DUPA 4EI2A 5JAMA 1LNQA 4OKNA 5AOVA 4BS9A 4YCAA 1VPDA 3QA9A 4XQEA 2O3QA 4C7KA 4TROA 5T57A 3PFWO 4N18A 1Q7BA 1RM3A 1WVGA 2QYTA 3GT0A 1N7GA 5JPIA 3WJAA 4AJIA 1AE1A 2VT3A 4B4WA 3FWZA 1ZK0A 4CLOB 1E3SA 4ZRNA 4PG8A 4EJ0A 4PGFA 2EHDA 3RWBA 3BMOB 1MP0A 2XF8A 4RPKA 2A92A 4MVJI 1UP4A 3DO5A 3HN7A 3ONEA 1BRMA 1NASA 1P0CA 4HUJA 3BIOA 3GDOA 2I5PO 3QJ5A 4BNHA 2ILTA 1T2FA 3CSDA 2ZB4A 1XLTA 2CF5A 2EERA 2HLPA 1CDOA 2X5KO 1I2CA 3PGJA 4OM8A 1X0VA 2EGHA 3DZGA 4R1UA 2NSDA 2H63A 4PLFA 3MTGA 4YT5A 3C8MA 3M2PA 1CRWG 1NQTA 2X0NA 3JD1A 4F6LA 1T2AA 3ROQA 3OJ0A 4GX0A 4BKOA 5K6AC 1T2CA 2HMWA 1HEUA 3GNTA 2IZ0A 3U4CA 1I33A 3QWAA 1XHLA 3IQDB 2LDBA 2CDCA 4IBOA 3H9UA 3W4IA 4EYEA 3IP1A 3SJUA 4HNHA 4F3YA 1ZCJA 3L0DA 1NTOA 4HNGA 3QY9A 5B1YA 1EQUA 3L9XA 3MWEB 2I6TA 1T4BA 3PFFA 1TT5A 3UCFA 4BGUA 4HWKA 3WQRA 3GGGA 1ADFA 1O0SA 2VWPA 2ZYDA 2X0RA 1N1GA 1LRKA 1Y8RB 3ZWBA 4R5MA 4L4SA 3PYLA 2IRWA 2OP0A 2BGKA 3NGXA 1I3LA 4FFOA 4GPD1 4GVXA 4LRSB 4RV9A 3IL2A 1YWGO 2Q2VA 1FJHA 5TT1A 3DZJA 1FDWA 2WDZA 3ZWVA 2RHRA 1ZH8A 3B70A 1U2DA 2BRUA 2Q45A 3SEFA 4YPOA 4DGSA 1SEVA 1GQ2A 2FPGA 1IHXA 5BNFA 1KYQA 2EG9A 5TT0A 4YXFA 4RF5A 3V1YA 3R3JA 2VTDA 1R4MA 1BXGA 1XG5A 4BGIA 1UAGA 1E5QA 1G6KA 3T7EA 3LSYA 5IF3A 2XAAA 5FYDA 3QWBA 4ZN6A 5HM8A 4XRRA 1E7RA 4DC0A 1SMKA 4IDFA 3MTJA 5TS3A 3W8DA 4AG3A 4XDZA 2FR0A 3QP9A 1MXHA 1C0LA 1BHSA 1NHWA 1UDCA 1KEUA 9LDTA 1OAAA 3UOGA 3I83A 2AEMA 1NWHA 3NDJA 4B4UA 2CVZA 3V1UA 5DF1A 3GEMA 3WB9A 4OOEA 1GPDG 3JYLA 1YBAA 1R4NA 2OL4A 5CEFA 4R5HA 2CSUA 4Z0PA 3TN7A 3VOSA 3WGZA 1SNYA 2GASA 1C1XA 1ZEMA 3RJ9A 2GCGA 3VTFA 3WFIA 2J3KA 1R0LA 2J3JA 4E5MA 4YTEA 4CLRA 1XR3A 1GZ3A 1XU7A 5A1TA 1KVRA 3C7DB 1HDRA 4DQXA 2GPTA 3QVTA 3DBVO 3UKOA 3L4SO 3DXFA 4LCJA 1HE4A 2C7VA 4XGIA 4R4JA 3ASVA 1YOVA 4KUEA 1HDGO 3VZQA 2PD3A 5IZCC 2NVUA 4FOSA 5TJHA 4WNIA 4CUKA 5JYDA 3IP3A 2X9NA 1HDXA 2HAEA 4KOAA 3CE6A 3QWFA 3WGYA 2OUIA 4WCFB 2C54A 1L1FA 4JXKA 2WYWA 3BYZA 4NIMA 3A9WA 4FD3A 4PLHA 1YKFA 3AUSA 1P1JA 4HBGA 4KDEA 3Q3CA 4WLVA 3OFSA 4XGNA 4Z9YA 5L3ZA 5ILOA 1EUCA 1EQ2A 1M67A 4Q3CA 2QHXA 1EK5A 3TL2A 2OFPA 4FC6A 1R37A 1TB4A 3PI7A 1PZGA 3UCEA 1QYCA 1BTOA 5G0TA 5H83A 2DBVO 4XJTA 4Y98A 4CMIB 1TA4A 3F9IA 4Z3DA 4A73A 3FR7A 3NYWA 4DBZA 3U3XA 2EJWA 3VAZA 1JW9B 1PWXA 1BDMA 3PJFA 3ZHZA 1E0DA 4YYZA 1HRDA 5AYVA 3RFVA 2HUNA 3GOHA 1R4NB 4MVJH 3OEWA 5IDQA 4K6FA 1DLIA 1JKFA 5HS4A 3D3WA 4PZDA 4MP8A 1Z7EA 4FSHA 5CPBA 3NTQA 3N7UA 1UP6A 2FR1A 3K2EA 1B3BA 2WYUA 3KYDA 4NBVA 3JYQA 4XGKA 4FFLA 3OICA 3ZV5A 3WGOA 4IZIA 3ORFA 3SXPA 4CLEA 4GX2A 1D3AA 1YBVA 2NTNA 4NHEA 3I9JA 5KJ1A 3JQAD 5EINA 4D0SA 2GN9A 3KVOA 2VT2A 2PZMA 4W7IA 2HRBA 4BNKA 3KYCB 4UVDA 1GUFA 1MB4A 4F45A 4ZQHA 1IE3A 5KJEA 2UVDA 3VDRA 1PGNA 3D4PA 1HZJA 3DONA 1I24A 1NQAO 1Z6ZA 3OQ6A 1DC5A 4UAGA 3GVHA 3HUDA 3H4VA 4DYVA 1E6UA 1NM5A 5HBRA 2PGLA 3KEQA 4L73A 1Y8RA 2B4QA 1GAEO 4S1VA 4YT2A 3LT4A 4WJZA 5KTKA 4ZQGA 3PWSA 1A7KA 4Q3NA 2ZB3A 5TLSA 4A26A 4RVUA 4WEOA 4DL9A 2C29D 3ZCXA 3S8MA 4CL8A 2P4QA 4D41A 1LX6A 1DC6A 2TMGA 4AVYA 1MX3A 1QG6A 1PIWA 2CUKA 4HY3A 2F1KA 1ZFNA 2EP7A 3HHPA 4WLEA 2VWHA 3X2EA 2NU9A 3ONDA 4IXTA 4EDFA 4IIVA 3WIEA 1DIHA 3LC7O 1ISFA 3PDJA 4PIVA 4WCFC 1LXCA 1M66A 1HE2A 1DIBA 1VL8A 5JY1A 4QT0A 2D4AA 2DTEA 1I32A 3LZ6A 3PWZA 1ZMOA 3OP4A 3G49A 1F0YA 1TT7A 1U8XX 4CM1A 4OH1A 1I0ZA 3JQ6A 3CEAA 2D5CA 3DBRB 2DKNA 1V35A 2IZZA 4JJFA 1Y6JA 4PLZA 2YW9A 3PJDA 2PR2A 4IJKA 1C1XB 2YY7A 1R6DA 1RM0A 3AOEC 3VKVA 3W6ZA 3WR5A 1LDNA 3O26A 4DA9A 2E49A 4BV9A 1PQWA 1Q0QA 1PS9A 1Z74A 3JQFA 4H15A 5TF4A 5ENDA 2GN6A 1E1KA 4QTZA 2PFGA 3QVSA 1WDLA 4W82A 1KVUA 1F12A 3TZHA 2Q1UA 2VWQA 2ZK7A 3LYLA 3LLSA 4PLWA 5DBFA 4XCVA 4YJGB 1LDGA 1UXGA 3W8EA 2X6TA 4CQMD 3GRKA 1HTBA 2OBNA 4FFRA 3RKUA 2EKPA 2FSSA 4WPGA 1BG6A 4IDGA 2GZ3A 1NNUA 4CMEC 3DL2A 3JQEA 2CVOA 1SO8A 2O3RA 2AXQA 2OMEA 3JD3A 4BNWA 1WZEA 4DYDA 4A2CA 4PG5A 1NPTO 1XYGA 1DFGA 2VYNA 3K31A 4IQGA 3C1TA 3RIHA 5F21A 4G2NA 4R68A 3PXXA 4ZQBA 2YUTA 2CDBA 5JE8A 1B7GO 4PLYA 1W4ZA 1F8GA 5GZ3A 5DCUA 5ENVA 3F1LA 4OHUA 5FF9A 1PJSA 3Q2IA 1U7HA 4OIMA 5COQA 1N9GB 1GEGA 4E21A 4CV2A 1P31A 5DBIA 1YJ8A 4IM7A 3WQQA 4RPHA 3VZSA 2GZ1A 3ZWNA 4CR8A 3EMKA 3GNQA 1GCOA 1NR7A 1E3WB 1GUZA 3C85A 2VUUA 1I36A 5BSHA 2Z95A 3VH1A 4E5KA 4CM5A 5DCYA 3KHUA 1VLLA 4IS3A 1V9LA 4QXMA 4K9DA 4RVSA 4GAEA 4PRKA 1N9GA 4LVCA 3LLVA 4DIBA 4BO6A 2AA3A 2EXXA 4OMUA 3JSAA 5TSDA 3UH1A 2BFPA 3ZZNA 1P45A 5JDCC 4XQ9A 1PEDA 2J5QA 2OO5A 4PLGA 3VPFA 4DC1A 1PS8A 5CDSA 4ROSA 3ZW9A 2X4GA 5KKCA 5T67A 4QUKA 2GD1O 3OF2A 3PHJA 2JAHA 4OXYA 1YB4A 2GGSA 4LVUA 5L45A 3I9MA 1GD1O 3TDKA 4EEZA 4MVJF 3OM9A 3OQ1A 4R9SA 3OJOA 3ENNA 3M1AA 2TMDA 3V5NA 4BB5A 1PTJA 2HQ1A 4RCVA 4WLNA 3RUFA 1GY8A 2VNAA 1PWZA 5C3MA 5F3RA 4RPGA 1K5HA 2C2XA 4PVDA 3VVBA 3WG9A 3G1TA 4XB2A 1VE9A 3PYMA 3H5RA 4WCDA 4AJKA 3OBBA 3MOIA 4IMPA 4LGVA 4QO8A 2E4AA 4ZQFA 2IDZA 4FJ0A 1EMDA 2BH9A 2Q46A 3AI2A 4IS2A 4K28A 3IKTA 3WJ7A 4FOOA 1VRWA 3H2SA 4A10A 3WOHA 1WZIA 4BQRA 3RC9A 1KEVA 1ZVMA 3I23A 2E82A 2YV3A 4D42A 3ICCA 2NWQA 3ENKA 3NAQA 3DAFA 4WUVA 1H6CA 3BHIA 3IDSA 3PGXA 5CDTA 2B0JA 3L6EA 2DU8A 3BXXA 4AJEA 5ILGA 1IY8A 4PG7A 4CM3A 3WGTA 1U5AA 4OL9A 4Q9NA 3DAPA 3K6JA 2OHXA 1DBVO 2PA3A 2G17A 4M49A 4CQLB 3NEPX 3KETA 3A06A 1KY4A 5TX7A 3ASUA 1DHRA 7ADHA 4LMPA 3DQPA 3QE3A 3FSRA 4J4HA 4JJIA 4ZHSA 4F46A 4QECA 1ZJYA 2BFMA 4CV0A 4WE3A 4YA6A 5T6BA 1DIAA 3AM4A 4A03A 2FWMX 3DZFA 2GF2A 3GH3A 4FBGA 2ZYGA 5IDYA 5C7OO 3IUPA 2C0CA 4RVDA 4MKZA 3VVCA 3KEOA 3D5QA 4NPCA 3HN2A 3IAHA 4IQ0A 3UICA 4B7XA 4MIYA 3OECA 1C1DA 4KP7A 4PZEA 4D0RA 1K6XA 3IS3A 1R0KA 3NT4A 1GTMA 4ITUA 4TRNA 4B3IA 1CEQA 4IJWA 1BXGB 3ANMA 1I30A 2O23A 1CERA 2BGMA 4E6PA 3F4LA 2A4KA 3P7MA 4RPJA 4BO2A 2P68A 1OMOA 1N8KA 2ZATA 1E92A 1XA0A 2O50A 2VN8A 3GG9A 3VPHA 1JAXA 2O7SA 4NH4A 4RF2A 1SBYA 1LSSA 2JJYA 4HXYA 1D1SA 3FBGA 5C37A 1LSJA 2FOIA 4P4NA 3DZKA 3RJ5A 1LDEA 3WLFA 2EWMA 1ZBQA 5JCJA 4GLLA 4XYLA 1E7YA 3JQBA 3WNVA 4HFMA 4JK3A 3UAGA 3NV9A 4CM4A 3F3SA 4J1SA 4XYMA 2Q2WA 3MWDB 4DXHA 5H81A 1UXIA 4CPDA 4BMNA 3RROA 1NVGA 2O3UA 2D3TA 2Y99A 3I3OA 3K73O 4KQXA 1FMCA 2H9IA 4XD2A 2QZZA 4YJDA 3RU7A 4U0KA 4Q39A 5L7WA 3WLEA 1Y8QA 4XA8A 4YJFB 1ZIDA 1NQ5A 1PL8A 3OSUA 1PQPA 3RUIA 5MDHA 1OC4A 3AOEA 3WDSA 3WFJA 5I9NA 5KKAA 4EJMA 1Y9AA 3NUGA 3KRTA 4KUHA 2VZ0A 3M1LA 1ENOA 2Y67A 1ZSVA 2B5WA 3ZWMA 5L53A 2DPGA 4GL4A 4PZCA 3K2BA 1ISGA 1O94A 2PH3A 3KV3O 1LLUA 2FPIA 4ZGWA 1DAPA 1P33A 4UVGA 1Y9EA 4FS3A 4H3VA 1ZO8A 3PIDA 4MIOA 5CDUA 2Y1CA 5DCWA 5IJZA 1YONA 4BKUA 3QWIA 3UW3A 2D59A 4XIYA 1WDKA 2PD6A 2NU6A 4FFNA 2QX7A 4YAEA 5G0UA 3G79A 3BMOA 1H2BA 2PKQO 4K1LA 1P1KA 1SPXA 3RVDA 1YL5A 1YVEI 4FQ8A 1UP7A 5G4LA 4YT4A 2NVUB 3KLPX 4CUJA 4JP2A 2YZ7A 5DP2A 4JIGA 3TNLA 1C3VA 2ZQYA 4Z6KA 1ZSNA 3GAZA 1X0XA 5FFFA 4YAIA 4II2A 1VJ0A 1XWFA 2VCYA 3TFQA 4A7PA 3DR3A 4PFJA 4UUPA 4D43A 1ZK1A 5DBGA 5MGBA 3GZ4A 1AXEA 3L4BC 1X14A 5I7FA 3GF4A 4U5QA 3VKUA 1EUZA 4BO4A 1FK8A 3DTTA 1QRRA 2DFDA 4JJGA 1P1HA 1QV7A 2HK9A 3PQFA 3ZV3A 4J2OA 2POQX 5A3VA 4DIOA 3H6KA 1HL3A 5HRUA 4XR4A 2JFGA 1P1IA 3PZRA 4GKBA 3BZUA 4NBWA 4PVCA 2WMDA 1KVQA 3ON5A 4CM8A 1UZLA 5JSFA 5K9ZA 2VUTA 2NACA 2NTJA 1XGKA 2B5VA 1R4MB 3ST7A 3TZCA 1JDJA 2HCTA 3RBVA 4IDEA 4C7JA 5JCJD 3U09A 4G65A 4U8GA 1S6YA 4B3HA 1PGQA 2ZJ0A 3WBBA 3ZWOA 2EF1A 1C0IA 3LQFA 5JC1A 1E3IA 1ZZEA 2NTVA 5A5EA 4IPTA 1VSUA 5BSEA 3D1LA 3KOUA 4NK4A 4I1IA 1NAIA 5ADHA 2PY6A 4CQMA 4KWIA 1X15A 1J0XO 1QORA 2Q99A 2W4QA 4EJ6A 5EQDA 4GX5A 4M89A 1K2WA 4TMFA 1EZ4A 2HU2A 3AOGA 3GRPA 1EE9A 1HLDA 4Q3BA 2EEZA 3HG7A 1LLQA 1X7DA 4XEHA 1U8FO 4R54A 4FFPA 3KB6A 3HFGA 3FNHA 4NU5A 1VJ1A 1HWYA 4Z9FA 4E32A 1H6DA 1W0CA 4HADA 4BQPA 1XELA 3EVNA 4HX5A 3SBOA 4J7UA 1IYZA 3V2GA 4IUYA 4E12A 1R15A 3LC1O 4R51A 1H6BA 2ZYAA 4O6VA 5JMPA 4NFHA 4BMVA 4CV1A 4DLAA 1DC4A 3PK0A 2EGGA 4W6ZA 5T8KA 1T24A 3DMYA 3SLKA 3WYEA 2IODA 2PH5A 1IOLA 1P77A 2BMAA 4XZ3A 1QLJA 2JD2A 3PHGA 4MPDA 4UREA 4PG4A 4BKQA 3O8QA 1JKJA 1ISIA 3GVCA 1RWBA 1WW8A 3H3JA 5JDIA 2H6EA 4L0QA 1EVZA 3PPIA 1T1SA 3TPCA 3DHEA 5DULA 4N5LA 3L07A 3S2GA 1O9BA 4RJTA 2B83A 3PHIA 3UFXA 4BNGA 1T26A 3K30A 4DLLA 4EBFA 1AHHA 4O63O 5F5LA 3DBLA 4NI5A 1HYGA 3AFNA 3KO8A 4QFCA 2VYVA 3D4OA 4OO3A 5TJ9A 4E2WA 1QYVA 4MVJG 3ZHXA 4N5NA 5A5FA 2Q50A 2X22A 4MP3A 3NTOA 4R41A 3AUUA 2WD7A 4RORA 4Y8VA 4CMJA 4X54A 2NQTA 3AK4A 3I4FA 4FGSA 3WYCA 5COBA 3UF0A 2X5OA 2GUGA 1IB6A 3E82A 5EQFA 1BWSA 3RSHA 1NXQA 1ZEJA 1O5IA 2A35A 2AQ8A 2X86A 4L9RA 1PJQA 1TEHA 4M87A 1VSVA 3O03A 5U4QA 4GMGA 1Y5RA 3JQBC 2LDXA 3A1NA 4AJNA 5JO9A 1HDZA 3GPIA 3GDGA 3DTYA 5F1OA 5GMOA 3DBLB 2G82A 2JCVA 4C4OA 5BSGA 5F5NA 2GN8A 3OETA 3HWRA 1Q1NA 3K96A 3MJVA 3W1VA 4RDHA 1NPYA 2X7HA 1XCBA 3OMLA 1ARZA 3LU1A 1A4IA 3WGQA 4TRRA 3Q6IA 2NNLD 3KSZO 3F5SA 4CJXA 1SOVA 4EUEA 3E48A 2B4TO 4W9NC 3UCXA 3V2UA 1H6AA 3WGIA 3RUEA 3VZRA 1PGOA 1GZ6A 3B6ZA 1C0KA 1N92A 5IFLA 3GGPA 2B4RO 1F17A 3CUKA 4FC7A 4XQGA 3WGHA 1QKIA 2YFHA 3OIDA 1EUDA 4WNCA 3W4JA 4B7UA 4TKLA 5G4KA 5B4UA 3PLRA 2W2LA 2DQ4A 1DPGA 1RYEA 4HFRA 1DSSG 4J6FA 4ALJA 3WMXA 3VH4A 1Q2XA 2D5AA 2EJVA 3B1FA 4P22A 2JHFA 4IJVA 4JROA 1EDZA 4S3MA 4XJSA 3OQBA 5THQA 2IEDA 2VWGA 2DM6A 1U4SA 3R1IA 2Y0DA 1ONNA 3TJRA 4XWYA 4R01A 3BMNB 1PQUA 5GZ1A 4ZA2A 3L9WA 1ZW1A 1QMGA 3GAFA 4P8RA 3BHMA 1IHYA 4CLXA 3EW7A 3HJAA 3JCZA 1LUAA 3BHJA 3U4IA 2QZ9A 1F8FA 4TSKA 2O4UX 4YRDA 3DOJA 3I9KA 3IKVA 2CVQA 3KSUA 2VHZA 2W90A 3MJTA 4ND2A 5CG1A 5C5IA 4QQRA 3DBHA 1H9AA 2YHUA 4ID9A 3E8XA 1YL7A 2NQ8A 2XXBA 4YDRA 3ZW8A 1DRWA 4LK3A 1K3TA 1BVUA 3A4VA 4CMBA 5IAAA 2GR9A 2X9VA 2H5LA 4TQGA 3T4XA 1X7GA 4GMFA 2J8ZA 3NX4A 1YH3A 1GQQA 1ZMTA 2ZIZA 1RPNA 4R16A 1NBOA 3UN1A 4BNIA 1MC5A 3ONFA 4JBHA 3ZU3A 2R00C 4NG5A 4W99A 4AL4A 5BSFA 5CDGA 8ADHA 1E77A 1NVMB 3AUTA 2DBZA 3B1KA 1GYPA 1U2GA 4KZPA 3U0BA 1J4AA 3PYXA 3B1JA 1EVJA 3E1KA 3NT5A 1Y81A 2CNBA 4FW8A 2VZ8A 2BI7A 5A03A 5C7IO 2I9PA 4OSOA 3IMFA 3TFOA 3HB4X 3ROPA 2AQHA 4Y6PA 1E7SA 4EZBA 2JAPA 3KBOA 3P2OA 3PHHA 3ZWXA 5DDIP 1HSZA 4M55A 4Z0HO 3WWZA 5AVOA 1U3TA 3ADPA 2AG5A 5KVCA 1QYWA 4NBRA 4FGWA 4N7RA 1FDTA 5BR7A 1DXYA 7MDHA 4JGBA 4CMEA 2UYYA 3AY7A 4ZD6A 2Y1EA 4MP6A 3RC1A 2DBQA 5CEEA 1NWCA 3DBHB 3OH8A 4PG6A 4BGEA 3AJRA 3BA1A 3LT2A 1ZK3A 2Y1FA 3RFXA 3W6UA 3BTVA 1UUFA 4IMRA 5B4VA 3QRWA 1SAYA 2W2LD 4HFJA 4CUZA 5EN4A 3WX0A 3GA0A 3RD5A 4DQUA 3VC7A 1MGOA 4R1TA 5L95A 1E1NA 4KDFA 3ROKA 3WBFA 4YT8A 3HDJA 5TRTA 3LDHA 3R0IA 4ND4A 3SJ7A 2RH8A 1A72A 5G2OA 5I8ZA 3WMWA 3VTZA 2VRBA 3E9QA 5JFOA 2X1HA 3IC5A 4J3FA 4LISA 3FTPA 4MKXA 3H65A 1WP4A 3QHAA 4FB5A 3C7CB 5JW6A 3X2FA 2Y68A 5KVQA 1XIVA 3GR6A 4YJHB 4CV3A 2FZWA 4DIFA 2GNAA 2C5AA 2EP5A 3MJEA 5JXWA 1Y5MA 4ONEA 2NVBA 2VTEA 4MJLA 5CFZA 1DB3A 2VNSA 3GN1A 1E3WA 1ZKMA 1ISJA 4UEKA 1CIVA 1E6WA 4PLVA 4B3JA 3OJLA 4B7CA 3SC6A 4FN4A 3DAGA 2J3HA 3ZNPA 3C24A 8LDHA 5IDXA 2RHCA 2A94A 1PJ4A 3F6YA 2FHSA 4I08A 2HMVA 5DOZA 2PLAA 4JP3A 2YV1A 4E13A 1YQDA 2D0IA 2WEKA 1NVTA 2V6GA 4YEDA 5KNLA 5EESA 5IDWA 4XYGA 1UJMA 1Z7BA 3FNFA 1YJQA 2FN7A 1GADO 4NJMA 3RUHA 3JQ7B 3DDNA 4ND5A 3D5TA 1N5DA 4CODB 3EGOA 1I01A 1U3UA 4ZJUA 4IY1A 1PJTA 1EVYA 1TVEA 1HE3A 1VKOA 1A9YA 3ZU5A 4YJHA 4YWJA 1V3TA 1PZFA 1F06A 3JQFC 1S7CA 2JCYA 4TRMA 5EL0A 1UH5A 3K92A 2PKRA 2O3JA 1GV1A 2VRCA 4AFNA 3COSA 3NDRA 1BW9A 1U7TA 2Y1OA 5T64A 3ITKA 3KLMX 4UEOA 4E4YA 2XOXA 4R3WA 3C1AA 2P9CA 2X8LA 2RH4A 3JQGA 4UUMA 4XB1A 1GUYA 3TQHA 4BNTA 3N74A 2DFVA 1EEHA 2RBEA 3EUWA 4D79A 4JLWA 4WLUA 1IPEA 4GH5A 4U6SA 1MC4A 1YQXA 4FIZA 1NQOA 2SCUA 1YRLA 2Q3EA 2WYVA 1VM6A 3F46A 2VUSA 1CQJA 4XDYA 2Y0EA 4HP8A 3D7LA 1GEEA 2V65A 4GWGA 5TC4A 4J90A 5L7YA 1H93A 3KSDO 1PU2A 4OOFA 4YAJA 3EK2A 4BO9A 3F5QA 1UXJA 1B8VA 1BW9B 1CETA 5B12A 4IZHA 1KERA 4ZICA 1I2BA 2WD7B 2DUUA 1JAYA 4QEDA 3ANLA 5F1KA 4KWHA 3O4RA 3W8FA 4NJOA 2UAGA 4E5PA 3FTNA 4OAQA 1KC1A 1ISHA 2C20A 1SC6A 3DHNA 1I3MA 1XEAA 1YQGA 4BNJA 3HB5X 5G0SA 4RVGA 3RUDA 3Q0EA 3UXYA 1LRJA 2CY0A 1SCUA 1A7AA 2WWRA 1F14A 4INAA 1EE2A 3PWKA 3LF2A 5A04A 1V6AA 2O2YA 1DRVA 3UVEA 2NU8A 2X5JO 4I5EA 2BKAA 1C14A 2HMTA 3E9MA 2X23A 2B36A 4A27A 1GR0A 1H9BA 3S2FA 4CM4B 4HV4A 5L4LA 1V8BA 4GSKA 3STHA 3NDIA 3B20A 3RUCA 1PR9A 3IJPA 3ZNNA 1I2ZA 3ZWYA 4YBZA 3DFZA 2C82A 3BMCB 1RJWA 4CMGA 5GZ6A 4P38A 3GEDA 2G5CA 5IZ4A 5L9AA 4J43A 3TSCA 2RCYA 3PVZA 2O3SA 1NYTA 2BFAA 3GVIA 4MO2A 3UGKA 1QV6A 1ZNQO 4OSPA 3JD0A 4IGEA 4A5OA 4BNXA 1E3EA 2CFCA 1UXHA 3BMQB 1V0JA 1CF2O 4BNVA 1ONPA 4D3SA 2NM0A 3BMQA 5CAEA 1VKNA 2QW8A 3KZVA 3BTOA 4OQYA 2Q1WA 4L4XA 2P5UA 3U49A 2QQ5A 2FSVA 4UULA 4DREA 4UUNA 3ZNQA 3HSKA 2P5YA 3OEYA 1RM5A 1HXHA 1ZXLA 1U4OA 3FBTA 2Y1DA 4TZTA 4Q3EA 3HDHA 2IYPA 3VDQA 3JQDA 3VZPA 1LQUA 2QYSA 3T4EA 1P1RA 3DHYA 5KVVA 4OKIA 3E03A 5AQ1A 6LDHA 1CWUA 4WLFA 3PQDA 3S1LA 3PJEA 4DPMA 5JDCA 1XSEA 4KMSA 2C59A 4NU6A 1A71A 2X58A 1V3UA 1YBMA 3N58A 2OORA 2BI8A 3WICA 4Y67A 1J5PA 3V1TC 3ZV6A 1ADGA 2AHRA 2Y1GA 3CKYA 4QFDA 4Y6SA 2NV6A 3GZNB 4J4TA 1YS4A 2A9FA 4J49A 4XIJA 3ZWCA 4NMHA 2VOJA 3F1KA 1LLCA 1P3DA 1ULUA 4BMSA 1W6UA 2AMFA 4L8VA 4KUGA 4L75A 3WYBA 4KQWA 3JQ9C 3GHHA 3ICPA 5DN9A 3GQVA 1LI4A 1T2DA 3JQ9A 4J7XA 2F00A 1PGJA 3E6AA 3PIIA 5ER6A 2HKIA 3H9QA 4AJ1A 2JL1A 1JA9A 4R1SA 4WECA 1ZK4A 4GLOA 3SLGA 1EBUA 4B4VA 3NRCA 3H9GA 1Q0HA 2HJRA 5HTOA 1Z75A 4RF4A 4ZVVA 5FWNA 4MVJA 4BV8A 2Q4EA 3FI9A 3QVOA 3RI3A 5I7SA 1DJQA 2JKVA 2QRLA 4BB6A 5L40A 4O59O 2OP1A 1M76A 3PP8A 5J23A 2ZTVA 4CLRB 1VJTA 3JQCA 4TKMA 3WSWA 2P9GA 3O9ZA 4KTVE 4CMCA 4L4RA 2C2YA 3LF1A 3CTMA 4IQ8A 3D64A 1R16A 3GPDG 4FFMA 3JTMA 5K6AA 5CPFA 1ID1A 1X7HA 4RF3A 3JQGB 3KTDA 3VH3A 1W73A 2GRAA 3BMNA 3K5PA 4J16A 3ZI0A 4CLHA 4I9UA 3EZLA 4RLSA 4CM7A 2VOEA 4G81A 4AJOA 4BGVA 3ZU4A 2AE2A 2VZ9A 4RVFA 4AJJA 4CM9D 1ML3A 2C7GA 1EK6A 1DEHA 1LTHR 2HO5A 3INRA 2ZTMA 3G1UA 4UVHA 2VQ3A 1I5RA 2PTGA 3Q9UA 4BOYA 4G5HA 3VPGA 4BNMA 2OOSA 3U4HA 2JFHA 4DMLA 4J9UE 2E37A 3AUAA 4WK6A 3AI1A 2GSDA 1TLTA 4LN1A 4UEJA 1QLHA 5ER9A 2R00A 3I9OA 1ADCA 1MG0A 1E6EA 2WJPA 3AW9A 5JY6A 1Y8QB 4DPLA 4W7HA 2QG4A 4NJMB 4J0FA 3G17A 4GGPA 1TI7A 4XRGA 3QVWA 2X0JA 3I4CA 1AGNA 3NTRA 5BQFA 1PR3A 1LDBA 5LDGA 4YRAA 3M6IA 3SC4A 2Y05A 4I9HA 1CQIA 4U7WA 3U9LA 1TT5B 1N7HA 1P9LA 3RAJA 5LDHA 1X1EA 1MFPA 3DWFA 1V3VA 3DOCA 4RGBA 5DNAA 1GL3A 1DAOA 4B8ZA 4MVJE 1DDOA 1ONOA 5IZCA 4ZU3A 2WM3A 3CMCO 1DO8A 4M1QA 4H7PA 5JAQA 5JDIC 1YGYA 4BO3A 4YRBA 1Z45A 4M54A 3RASA 2WSBA 2Z5LA 4RQTA 4Y9DA 4D3FA 1M6WA 2FZEA 1BDBA 4PLPA 1SZJG 4CQLA 4XQCA 4YAGA 1XQ1A 3UUWA 4DWVA 5B4TA 1WWKA 4BHTA 3KYBA 1I3KA 2AEJA 3R6DA 3Q1LA 4BO5A 1I3NA 3FWNA 3UHAA 3G3EA 2DTXA 2DT5A 1YDWA 4BUCA 4CR6A 4MDHA 5JMWA 3F47A 1FDVA 1KIFA 3AU9A 2AQKA 4WEQA 2YFQA 3FR8A 5I8WA 2HMUA 3U4DA 1NFFA 3MOGA 4J2HA 1Z82A 2FY8A 1HYHA 5I9MA 2ZCUA 4NZ9A 5ES3A 4RZIA 1PJLA 4R3NA 1QSGA 4RQUA 1OC2A 1A9ZA 3TZ6A 3K8ZA 1GZ4A 3ZNOA 3HE3A 2HK8A 2FR8A 3C3XA 5C7LO 1WXDA 3OA2A 4NK5A 3EC7A 3VHRA 2UV8A 5KJFA 3DEYX 1HKUA 4R69A 3DOOA 2AQIA 4U6QA 5U9CA 1I8TA 3TWOA 3H9EO 2BGLA 4M86A 2Q49A 1JWAB 4GSLA 4BNNA 9LDBA 2CD9A 4JBGA 3HDYA 3TZKA 3I9LA 1E3LA 3DMTC 4PLTA 4K6CA 1WPQA 1D1TA 3E5RA 1GCUA 1WMAA 2PGJA 3GDFA 3ZWAA 5G0VA 2BELA 3JQ7A 1ORRA 3E9NA 3GZNA 3H8VA 5A4DA 1P74A 1FF9A 5GY7A 3EAGA 1MLDA 3PHLA 2IXBA 2FPPA 1L7EA 3H3FA 2XPCA 3NJ8A 4OXKA 5FI5A 4GI2A 2B37A 2DLDA 2IYOA 1JVSA 3LVFO 3CPSA 3H9JA 3AWDA 4ALLA 2EW2A 4J0EA 1VC2A 3AY3A 4MIEA 4CQMB 3CH6A 3I6IA 4TVBA 2RAFA 3JQ8A 5JLAA 1KC3A 1I10A 3ZHBA 1E7WA 3SVTA 3EYWA 2Z1NA 3JV7A 4O1MA 3PZBA 3NT2A 1XQ6A 4YQZA 3I5MA 5KOIA 2G1UA 2P4HX 3JQ8B 4E3ZA 2FMUA 1KY5A 5KCZA 4JNKA 3KYCA 4GX1A 5JS6A 1XDWA 1E5LA 5ICSA 2Q2QA 1PZHA 5I7VA 3INTA 1LBEA 4ZQEA 4WGGA 3I52A 1YL6A 3JD2A 3WTBA 4WKGA 4XYBA 4J1NA 2DVMA 4MOWA 4NR0A 5L7TA 3ULKA 2YQ4A 1HT0A 4BKPA 4I8XA 4E0BA 5BT9A 1PX0A 2DBRA 1H5QA 2GLXA 1DJNA 1Q0LA 5HA5A 3WNQA 5JBIA 3DZHA 1JU9A 5L51A 1IZ9A 4LMRA 3I6QA 1GPJA 3KUXA 5A9RA 5JNLA 3U62A 1LEHA 1XU9A 3DZBA 5DZSA 4E5YA 1H0KA 1GU7A 1MUUA 4IDAA 3QQPA 4FJ1A 1R12A 1EDOA 2W2KA 4MVJD 3QVXA 1LU9A 5ITWA 3AM3A 3PQEA 3H7AA 3S2EA 2DTDA 5AXDA 4CMIA 5JC8A 5ITVA 4GQAA 5A3JA 3L77A 1LDYA 4E31A 2GERA 1B0AA 1L7DA 1SB8A 3P19A 3M2TA 3PTZA 4JCOA 4TWRA 4BL5A 1UR5A 3K9QO 1NFQA 1JN0A 2YYYA 3H2ZA 5FI3A 1YB1A 5AXCA 1ENYA 4B79A 1LRLA 1KBZA 5A06A 1R0SA 3ADOA 3JYOA 3GVPA 3KXDA 4JN6B 5EJ2A 4N54A 1MXFA 4IJUA 3TF5A 4ALMA 1DC3A 4DBVO 2E48A 1LC0A 1LSUA 2H1SA 4EW6A 4CMKA 3JQAA 3ETDA 3NKLA 4AICA 1J49A 2IE0A 3JQAB 4TVOA 3OIFA 5LCXA 2E6UX 2JHGA 2AEFA 4BNZA 1T25A 1AN9A 1X1TA 2UUPA 2YQ5A 4K26A 3W4KA 5I7EA 4E2ZA 5L4SA 2VYVD 1Q7GA 3ABIA 3E5MA 4R9RA 4Z9XA 4UVIA 2P91A 3ANNA 3MEQA 5A9TA 5IXYA 2V7PA 2PGDA 1E3JA 2EKQA 1DFIA 1YE3A 3FN4A 4J1QA 2EKLA 2HK7A 4UUOA 3PDUA 1HETA 2B35A 3IIEA 2CMDA 1D8AA 4F6CA 5JO0A 3BTUA 1J6UA 4PRLA 3T7CA 5DP1A 1LQTA 3A14A 2HDHA 3NGLA 4BNLA 2OZPA 3TOXA 3DC2A 3JD4A 1K89A 2D2IA 1K0UA 3RFTA 5BNIA 2FRDA 4D3DA 3O8QB 3D3EA 4I5DA 3RBZA 1RM4A 2NU7A 3DMTA 3QLJA 4ALKA 4YVFA 1GYQA 3PRJA 3A28A 3GN2A 5EMHA 4EUHA 3GHYA 1LLDA 2W2KB 1N1EA 4DPKA 4Y6RA 4RLHA 3S55A 3IUSA 4IDCA 2Q1TA 1G0NA 2XXJA 4D44A 4RL6A 1CJCA 2O7QA 2DUWA 4RO0A 4D7AA 4E5NA 1PZEA 2JCXA 1Z73A 5ICMA 1MV8A 1SEPA 4DQVA 2DPHA 1ZXBA 3EY4A 3FRJA 1VL6A 2Q1SA 4IINA 4Q3DA 5A05A 5TNXA 1KEPA 3CZMA 4XX0A 4WASA 3Q11A 4JBIA 1HF3A 5F1PA 3VH2A 1BSVA 1LSOA 2OGUA 3GFGA 1LC3A 2JD0A 4I5GA 2PK3A 1NHGA 1IUKA 3JYNA 4D46A 1NFRA 1UXKA 4B8WA 1C1DB 3FNEA 3HNPA 1OZAA 1DHTA 3ITDA 1ZK2A 4EGFA 5A9SB 2JD1A 1ZJZA 3H5NA 3EHEA 4YACA 3R3SA 4YAKA 1A4UA 3PJGA 1JLLA 5H82A 1DIRA 2DAPA 4B4OA 1VL0A 4NFYA 2ET6A 3ZU2A 4UVEA 1H2HA 1PJ2A 3DB2A 3GMDA 1JQBA 4H16A 5T8KC 1QR6A 5JYEA 3CXRA 3ZWWA 4BNYA 4O5OA 3WIDA 4NDNE 3FPCA 1GQYA 3OA0A 1B3RA 1HDOA 2PZKA 1WDMA 4CMHA 3PLNA 5TIIA 3KYDB 1HZZA 3ZGYA 1O6ZA 1FXSA 1RYDA 1MA0A 1UDAA 1U3WA 1UDBA 3JYPA 1EVIA 3NJ4A 4LCEA 4IDDA 4EEXA 1ENPA 2YJZA 1E7MA 2ZCVA 3GUYA 2VHVA 2ZB8A 4CL3A 1B8PA 3L6DA 3WXBA 1B15A 1IL0A 1E1MA 4W9NA 4DTIA 4GVLA 4XKJA 3FCOA 4J4BA 5KVSA 1G0OA 2ZJ1A 2Z1MA 1NPDA 3OJEA 1ISMA 4LRTB 4IDBA 4NQZA 3QSGA 2P9EA 4L74A 5CEJA 1BVRA 2ZTUA 2OBYA 3GFBA 4J91A 4P4LA 2GZ2A 4MKRA 4MVJM 5JAZA 2Q4BA 2YDYA 2YHIB 1R66A 3FNGA 3GK3A 3RQSA 1GDHA 5KJ6A 3P5SA 4ESOA 1N2SA 2IEBA 1BGVA 3RU9A 5KJCA 3WGGA 1JVBA 1PGPA 2UUOA 4DVJA 3MJ4A 5JCXA 4RZHA 1IPFA 3VPXA 1G1AA 4URFA 1ADBA 1SB9A 3ZDFA 2BFOA 1GYRA 3EDMA 4QO7A 1T1RA 4BVAA 3C7AA 2BD0A 5I9LA 4EUFA 2O3TA 2VHYA 4CR7A 3DBRA 3GGOA 3ZN2A 4M8SA 2PZJA 4GBJA 3MCVA 2PKQP 2I67A 3S2IA 3G0OA 2O4CA 2EIHA 4DLBA 3GLQA 1O8CA 4FR5A 1PS0A 3GUCA 5G4KB 2ZTLA 2W98A 3QW2A 2OXIA 2VHXA 2EV9A 5HWSA 3RKRA 1KS9A 2ZB7A 1H94A 4NBUA 1ULSA 1YB5A 5B37A 4EITA 3AY6A 3HFSA 5CP8A 2V6MA 3BMCA 4YJFA 3DZIA 1DRUA 3WQSB 4J7CA 4CM9A 2WD8A 5A9SA 3ROMA 5CHEA 4GWKA 1TXGA 1MG5A 4GKVA 4J9VA 4OJNA 4II3A 2J5KA 1CYDA 3RCBA 1HDYA 4E2XA 5KIAA 1B26A 4BIIA 3TRIA 1OOEA 1U3VA 2O2SA 3ZWPA 3HZZA 3FHLA 3ZH2A 1BXKA 1OFGA 5IXSA 3MJSA 2RIRA 1ENZA 1O89A 4CM8B 4AJ4A 2PZLA 3FD8A 1PJ3A 3TZQA 5AXBA 2GYYA 1A5ZA 1KVSA 2CDAA 3GY0A 2Y93A 1WLYA 2QIOA 5CG2A 4XR9A 2NLOA 1JKIA 1SOWA 3OHSX 3ZHYA 3VPSA 1WNTA 2I66A 4FCCA 2FP4A 4RPLA 2V6BA 3GVXA 5IN5A 4IIUA 2P2SA 3AU8A 4FJ2A 1IULA 4Z3KA 1QYXA 2VHWA 1ZUD1 4CMAA 2ZQZA 4WOJA 2I3AA 2AW5A 4FPXA 4ILKA 1K6JA 4NBTA 2QRJA 3HQ4O 1UZMA 3L4BA 1U9JA 4L76A 1X13A 1YDEA 3RUAA 3GNSA 4OGWA 4YJGA 2YDXA 3D3WB 1KEWA 1ZSYA 2PD4A 1M75A 2HJSA 1UZNA 5TGDA 2WE7A 1A27A 1QXSA 4QSMA 1UAYA 3LK7A 1GFSA 1MFZA 4CLOA 2J6IA 3INGA 3LT0A 4N5MA 2WTBA 1B14A 1LDMA 4TRJA 4PCVA 4R1NA 3WSVA 1PSDA 3FF4A 1HE5A 4AJHA 1OI7A 1HSOA 3D4NA 2HSDA 1W8DA 2I76A 4ZRMA 1E7QA 3CINA 3U5TA 1P44A 3P2YA 3OJFA 3QWHA 1DOHA 1YO6A 3Q2KA 2IXAA 2NVWA 3QV1A 3RC2A 1P0FA 3CZRA 3AM5A 1U5CA 3BAZA 4WOKA 2UDPA 2D1YA 5DT9A 3RC7A 4ALNA 4MINA 1E1LA 2BF7A 2JFFA 4BO7A 3GG2A 4OYRA 4AJPA 2BLLA 3HADA 2CF6A 2O48X 4PLCA 2X9GA 2GN4A 2B69A 4BO0A 1IZ0A 1LA2A 2YV2A 4JX8A 1NP3A 3CMMA 5BNTA 1C0PA 2V6FA 4E30A 1U1IA 5LC1A 4DMMA 3RBXA 4YR9A 4D45A 4Q3AA 5T5QA 2PNFA 4LSMA 4Z0TA 1QYDA 2YHIA 4J1TA 5JAIA 5U1PA 3L6OO 3OIGA 1KVTA 2ZKLA 3TL3A 1KOLA 1JWBB 3BTSA 5CDYA 3AI3A 5COAA 1YXMA 2NADA 4U0JA 1NX6A 2C07A 2G76A 5THKA 2W8ZA 1OBFO 2J5RA 1EFLA 4NNJA 1NAHA 1EFKA 4DRYA 4I9NA 2J3IA 4BO8A 3O38A 4YQYA 5G0WA 2IZ1A 5EIOA 1M2WA 2EW8A 1AHIA 4CM6A 3DFUA 3MZ0A 2R6JA 3HDQA 3PEFA 1O95A 4O0LA 4W4TA 4IGFA 2PV7A 3F4BA 1P1FA 3I9NA 2BHLA 1D7OA 4HFNA 1K6IA 5AXAA 4PN3A 3SX2A 1EBFA 1B16A 3LC2O 5L4NA 3EZYA 1QP8A 2Y66A 5TQVA 1AUPA 2NUAA 4LW8A 4BNFA 5FEUA 1B8UA 5A02A 1Q7CA 3IOYA 1PJCA 4E33A 2GO1A 4I5FA 1B2LA 1HDCA 4TZKA 5HS6A 3V2HA 1DFHA 3H5AA 3ZV4A 1AXGA 2AG8A 3V8BA 4HKTA 3ETGA 3WWYA 3Q9NA 3IJRA 4E2YA 1PJBA 1U28A 5DOVA 5EPOA 4LSWA 1RKXA 1VI2A 3KM0A 3GC6A 1JTVA 4RVHA 2HMSA 1PL6A 4ND1A 3WTCA 3ETEA 5IG2A 2I65A 6ADHA 3C1OA 2X0IA 5IN4A 2C5EA 4RDIA
chains in the Genus database with same CATH superfamily
2I4TA 4UXHA 1VLHA 1JIVA 1BXZA 1TW2A 1ODIA 4OBWA 4OXNA 4XYEA 5EERA 5IAEA 3L01A 3HBMA 3VUEA 4W9MC 1M6HA 1EAMA 1F3OA 2R4UA 3N8KA 3UV3A 2HU8A 3GAMA 3DULA 2A0XA 3D2BA 4JMPA 4XJVA 3MCZA 2I3GA 3VSDA 2VDWB 1TC1A 4IL5A 4TTSA 2NSJA 5CNMA 5EJ7A 1WQ3A 2OZLA 3I37X 3ZZ1A 5JHHB 1XJCA 3I1JA 1P2DA 1FRFS 2RBKA 1GV0A 3EGWA 3T54A 3SYKA 4D9CA 3GBVA 2QENA 4CLDA 1T2EA 2XMRA 4GOMD 4KMOA 3W9YA 4BKRA 3OE7A 4MYUA 3DZ8A 3OE1A 1ZD8A 1JR2A 2P6NA 3DEIA 5J4HA 1ESDA 4JQCA 4ZGWA 3G88A 1DIGA 2VRCD 2PUAA 4PN7A 2Y0CA 3IQWA 4NFSA 5FP0A 2I99A 4W5QA 3OZAA 1KETA 3HLYA 2W6PA 2BUBA 2IVFA 3S6JA 1V6CA 2BSXA 1K7YA 2WLSA 1IN5A 1PTKA 1XCMA 3AVOA 3BJEA 3CBGA 2YJTD 2FPIB 421PA 2YVAA 2AF3C 1DMSA 2VG8A 4ALIA 4LYFA 1BMDA 1R3DA 2FXIA 4RLFA 5HQJA 4B43A 4PZ9A 5FBRB 1DWOA 1KR5A 2BDTA 4B1FA 5JAMA 2JA1A 3EXEA 3PDHA 1M72A 1G21E 3A6ZA 4RJLA 5AOVA 5AQEA 4P32A 4YCAA 5AK5A 1S5PA 3OOYA 3SDBA 1SXJC 2WC1A 4HNQA 2OV6A 1N78A 4FBLA 4JI6B 4AY5A 1UK8A 4TROA 5T57A 1K4MA 1Q7BA 3AMVA 2QDKA 3FTCA 3ZY5A 4EMTA 3WJAA 4C7BA 1ZINA 3SGLA 2B78A 2XUPA 1N2GA 4C88A 4ZRNA 2XCSB 1K98A 2EHDA 1XCLA 2IYWA 4JDPA 2YINC 2RKWA 4RPKA 4AO8A 1Z22A 4F38A 2C4UA 3DT8A 2QJWA 2F3UA 3ONEA 4ZZ3A 3K4PA 4ML3A 3EXFA 4QAJA 4F4FA 2WHRA 3QUTA 2I5PO 4HL6A 4BNHA 4XM1A 1U0OC 2ZRPA 2OFWA 2SHKA 1TX4B 4H7EA 1VFNA 2HLPA 1CDOA 1P2BA 3ORRA 4PBRA 1I2CA 1R6VA 2BGJA 2RIPA 3I01M 2KBFA 4Q82A 1C4OA 1N2CA 2UYOA 3MTGA 3V1NA 1RCUA 3C8MA 3M2PA 1PZXA 1NQTA 2X0NA 5A7GA 5K0GA 2R7AA 3O91A 3OJ0A 4GX0A 2ZSFA 4ZZ2A 3HU2A 3GLHE 3U4CA 1IQUA 2IZ0A 1EUDB 1PT5A 5KYUB 2LDBA 4BX3A 3H9UA 2ZRBA 2W71A 4TVKA 4KE7A 4MUAA 1M74A 4UDNA 1NMQA 4OTZA 2I34A 3L0DA 5F9HA 3C4VA 4HNGA 1OWOA 2WV9A 2B2CA 5B1YA 4Z7NB 5KQSA 3PFFA 1TT5A 3PR2B 3EDQA 3UCFA 4BGUA 3JASA 4OI2A 5CNIA 3CBQA 3HU1A 4L6IA 4D8VA 1KAOA 1UEIA 2ZYDA 3SVZA 4TV9A 5CM2Z 2GK6A 5EI5A 2X0RA 5B3KA 3S68A 2OGWA 4N0EA 1UM9B 1BHQ1 4RJKA 1C2TA 4F4DA 4L4SA 3PYLA 2GRJA 1UMKA 1YQEA 2BGKA 2OP0A 1ODKA 5LUBA 5TPZD 1TJNA 4L22A 3JASB 1AA6A 1K5GA 5G1PA 2RGRA 2C3UA 2A58A 3U9SA 3LWBA 2OQIA 4QJIA 2VDPB 3DZJA 4G5YA 1D6JA 2RHRA 1J5XA 5KYUA 3M0EA 3ZWVA 4I19A 1OT5A 2Q45A 3SEFA 1WB5A 2WUWE 4YPOA 3EODA 5HZHA 3RIXA 2NZUG 1M8PA 3PD1A 4NY1A 3T7TA 2WJGA 1MO5A 4Q66C 4DLZA 4GLFA 4MAFA 5BNFA 2P75A 1GPNA 3ML1A 4UE6A 3GLVA 2IFTA 2EQBA 1ZR2A 3V1YA 1CEYA 2QTVB 2P9JA 2VTDA 5JMWA 4Z1OA 1LZLA 3IUEA 621PA 2SNIE 2WD9A 3F6SA 1I14A 3QWBA 4B35A 3DLBA 4PYOA 4DMHA 2ODBA 3ZHTA 1TIKA 3DNFA 1E7RA 4ABYA 5CA1A 3UUGA 4BLWA 2PPLA 2P9QA 5DT2A 1NONA 3W8DA 1YVPA 4XDZA 3UHJA 9LDTA 1FSPA 1W2WB 1NHWA 5KX5A 3GEIA 3Q12A 1E60A 2AEMA 1NWHA 4B4UA 1J8QA 3EXFB 2E18A 4O4JF 2CVZA 2VNHA 4YJ2B 2ID7A 3MMNA 3N2LA 5F35A 3WB9A 4MA0A 4ON9A 1UT6A 2AOTA 1H22A 2F1JA 4H0CA 1R4NA 3CNEA 1TZMA 1UBNA 2CSUA 2Y6VA 3FYUB 3VYUB 4NNOA 1DL5A 4BMCA 3T5AA 1M0EA 1OPRA 1WS6A 4KQ6A 3VTFA 1CUBA 1BDIA 1R0LA 1Z2CA 1XR3A 3H8WA 1KVRA 4GRAA 3TBHA 5FEMA 4G8CA 1KQOA 3DKVA 4EG1A 5JWRA 1OB2A 5B36A 5F2NA 3QF7A 4EB6B 2C7VA 4UATA 4XOUA 4HWTA 5GONA 4KUEA 1HDGO 4BNDA 4ARZB 5CA0F 3URKA 1D2MA 5IABA 2HA6A 2W2TA 4XXHA 5E1DA 4LRWA 4FOSA 3TLEA 2AB0A 5KAMA 5JADA 3Q3EA 1Z16A 5JWHA 4OGGA 1OF1A 1TE2A 1SIOA 5I47A 2X9NA 2Y4OA 1P0IA 3D0QA 4UM5A 2PQMA 1Y3HA 4H59A 4NARA 5FXMA 3QWFA 3ILSA 2QN6A 3TOCA 3UB4A 5I51A 1U1FA 2II6A 4WW0A 2H54A 3CLUD 1FVXA 2C54A 4YRJA 1J07A 4HB3A 4KE9A 4PYNA 3BXPA 4WY8A 2MCFA 2Q0QA 4CI0B 4REOA 1K7SN 4XIFA 3FRIA 3D54D 3DJYA 4XGNA 4W5NA 3FA2A 4WLVA 2CNDA 1RXEA 4ZVTA 5LQDA 4YY3B 3JR3A 1DKMA 1X80B 1EK5A 2OFPA 2C58A 1FX0A 3K6SB 4PF1A 1V8OA 1PZGA 4TX1A 1EJBA 5B30A 1BTOA 5JNTA 1EVQA 1MD9A 1SK9A 2DBVO 4N12A 4PHCA 4C0AC 4YV0A 5EMNA 3C98A 3SYMA 4FFBB 3E8SA 4HEA1 2PT5A 4DBZA 3LQRA 2XI4A 2VNIA 3U3XA 3QVKA 2H5IA 4KJZA 5ALIA 3UOAB 2W8BA 4BTEA 1QO7A 3FKSA 3VAZA 3DUFA 4D9MA 1PWXA 4XPIB 4JKYA 1KI4A 1O7JA 2GO7A 3PJFA 3RTCA 1W88A 3VU0A 4WIAA 3RVMA 4WBSA 1KRXA 4IDUB 1U0FA 2CUNA 2AH5A 3IAEA 3KR0A 5AYVA 2W2VA 5JXJA 4HH0A 3IR7A 2HUNA 3GOHA 2NO4A 4UOEA 4TSRA 3OEWA 5IDQA 3ZIDA 4K6FA 3CN9A 4BECA 4XI9A 3Q5EA 1DLIA 2COEA 1JKFA 2WFLB 3K15A 3AEZA 4M6WB 4KYTA 1C8LA 2OYRA 2XKBA 4F96A 2J3DA 2EYUA 4WXYB 1XMVA 5CPBA 5JTUA 1UP6A 2WIGA 1EPUA 1SBIA 1YIDA 1Z88A 1YFZA 4BLOA 1WL8A 5KEIA 4LYGA 4R6WA 5JZOA 1XRMA 5HMMA 4KHPB 3PFNA 1K06A 2O5VA 3K0EA 1V1RA 2FEPA 4UBOA 2GCOB 1THTA 3KB2A 3O47A 1QNFA 3DLAA 2NTNA 4MR7B 2AMJA 5T4EA 4A9AA 3AUFA 1FXUA 1A2KC 5KU7A 1S9DA 4M36A 1RRKA 4V0OA 1LD3A 4BNKA 3NTVA 4UVDA 5CFQA 1B4DA 1VLZA 4QBGB 1MB4A 1T8YA 2WUEA 3AINA 4OQPA 2QEQA 5KJEA 4QXRA 1E5XA 4X95A 4GLBA 3DONA 3OI7A 1GXSA 3ZBQA 2QV0A 4CDNA 5I7UA 1E1RD 1E2IA 1FZTA 1Y3CE 4DYVA 3PC6A 1BMTA 1E6UA 2HZ7A 2B4QA 1GAEO 4UNNA 5M34A 1SHJA 4WJZA 1B0UA 1SELA 2JJ2A 2KM1A 2ZB3A 3ZHQA 5E3IA 1A8HA 4A26A 3DEFA 4MQ5A 2IP4A 1Q0TA 1LX7A 1E2LA 2XWJI 1DADA 2C29D 4AUKA 1CB0A 1N77A 4WKOA 4L72A 2GEUA 1DC6A 2PLFA 4Y0VA 1VKJA 4KREA 5FBKA 2J9FA 3TD2A 1ZCZA 1KH3A 1RQXA 4AVYA 1VP9A 1MX3A 2AN1A 2ZUEA 4UUQA 1RDFA 1TQ2A 3CE9A 2YBDA 3CLKA 3DP7A 2WWIA 4WLEA 3L0BA 4HNRA 4WT7A 4OFBA 4XX0B 1R88A 4YXWA 4FYWA 2ZJFA 4IXTA 3RTGA 2JG3A 2ZEJA 3LC7O 3QVMA 1ISFA 4OIFA 4PZUA 1RWXA 2R8EA 3NBAA 4ZAVA 1M66A 2R87A 4B7AA 3RYHA 3PKZA 4F9EA 1XMXA 4ZYYA 3LW7A 4QT0A 2D4AA 2DTEA 4Q15A 1I32A 2I2XB 2JI7A 2RHMA 3T7DA 1EK1A 1JQ3A 1TQ6A 4MV5A 2AOWA 4MWSA 1U8XX 5CITA 1GZSA 4Q7QA 5D8DA 2XOEA 1JKMA 1I0ZA 3DR5A 1BEEA 2V0NA 5C1IA 1Q50A 1T5OA 1JIQA 1WO8A 4H7DA 1RXYA 3BHNA 4KO1S 4JJFA 1OGJA 4R3UC 1PK7A 1CR1A 1YSCA 4FFVA 4R0NA 3PJDA 1G4UR 4Q1VA 2J46A 2YY7A 221PA 3AOEC 3LS2A 3OCWA 4HX9A 4PC7A 1S3GA 3O26A 2EVWX 4DA9A 3NQ41 4HUQB 3LMKA 4NOKA 2WAMA 3PHBE 1Q0QA 1PS9A 3JZAA 4NU8X 4WH0A 1JIIA 3JTEA 4LX8A 5ENDA 2NP6A 3IDFA 2H08A 3PNVA 2QQ0A 3SIWA 2FWNA 1E1KA 3LPNA 1RI5A 2PFGA 4N6NA 4W82A 5BV7A 1KVUA 1F12A 4FUTA 3HCOA 3PFIA 1ZA2A 2ZKIA 1D04A 1KDOA 1I4EB 4BYGA 3U7QA 3E84A 4YRMA 1G2PA 3QX9A 5EJ8A 1UXGA 3ELYA 3RS2A 2X6TA 1DV1A 1D09A 2VCEA 2AX3A 1PBTA 2J9YB 3LGXA 3T3IA 3WFZA 1DKPA 3OBIA 5CHYA 3PICA 2MJLA 2JB9A 4K3VA 2ZIAA 1CR6A 4XLZA 2ARKA 4REMA 4EY4A 3V6LA 4QTTB 1AZLA 5SZJA 4RKYA 3G9TA 2GZ3A 3NS7A 1NNUA 1M1YA 2RHHA 4FSXA 3EOBI 3JQEA 2H17A 2P6MA 5BWMA 3ZGZA 3GUVA 4PXAA 1CYEA 2WJHA 4QGAA 3W6OA 5EZQA 3OCUA 2PHZA 1RRMA 4PG5A 4A2CA 1XHFA 1HQDA 5AJUA 3AIKA 5CX1A 5KWSA 2HJVA 4JAVC 3BIJA 4D9KA 4GZLA 5I9BA 2CDBA 2JFWA 1B7GO 4QVIA 7MHTA 3ESAA 2V4UA 3ZXXA 1C81A 1F8GA 5DCUA 3ENVA 4QRHA 4Q18A 4X0EA 3EFOB 4N5IX 1RQLA 5JLJA 5EMLA 5FF9A 1NX9A 2IUYA 1T8PA 2QXUA 3Q2IA 3TMKA 2I7TA 4CKYA 1N9GB 2PMEA 4AKHA 1WHSA 6PFKA 1UWVA 3QF4B 4YCNA 1CY4A 4WZBB 1VCNA 3VJMA 4IM7A 4Q3KA 5J1TB 3WQQA 5FX2A 4RPHA 2QL6A 2J7KA 7GPBA 4AWBA 121PA 3EMKA 5FUVA 3K8QA 2PRJA 2OXRA 2ST1A 2F3TA 1E3WB 4JZYA 2PNJA 1GZ5A 1U2ZA 1I36A 2KE5A 3P9ZA 5BSHA 1JHRA 1UMCA 3R4CA 3QLUC 3TVYA 1KBQA 4E5KA 2B6NA 2EBUA 2WBLC 5HOQA 1SD1A 4CM5A 1R64A 4FONA 5DGIA 1VLLA 2WU4A 3TRJA 4QXMA 3TUZC 1R4ZA 4I36A 1BE1A 3T95A 2EWWA 3GJ5A 1UWLA 1GU0A 5HX7A 1N9GA 1BDJA 1O97C 2CV2A 2GCOA 2IHBA 2AA3A 2NYRA 3SF0A 3ZDAA 3U5ZB 4KLCA 5AOCA 3Q87B 2BFPA 1JG6A 2PRKA 3UJAA 1EA5A 3O2NA 1P45A 4B34A 4WA7A 1NC3A 1PEDA 1UBLS 1UKVY 2J5QA 4NH0A 4DC1A 5CDSA 5FOUA 5KKCA 4QUKA 1W19A 3OF2A 5DLDA 5EAIA 1R0XA 1LBHA 1VG8A 2DFPA 3O8OA 1U0RA 1JSZA 3DLTA 5EJFA 5GJCA 4DDTA 3ENNA 5EWMA 4DIDA 1PTJA 2HQ1A 4OB7A 1QG2A 1OFHA 2VNAA 4JLJA 2BT4A 4RY9A 4QPCA 1TLFA 1K5HA 3AHCA 4YLEA 1TUIA 3UAWA 3LCCA 4PVDA 3HH8A 2JAUA 1W76A 2VT6A 1CX9B 3UPUA 2CL5A 4ZIRA 4EF5A 2NP7A 2RAVA 4Q93A 1OFIA 1O03A 3ANTA 4JJ7A 4QYSA 3RLIA 1GU1A 2D5BA 2GYUA 2Q28A 3MOIA 3OPXA 5EIBC 1SKMA 2E4AA 3S29A 2PSSA 2QUJA 2BBSA 2W5UA 4L5IA 1U1GA 3G7UA 1N0HA 3H84A 4FJ0A 3WVNA 1WMSA 2VF5X 3KJQA 4EGAA 1C7RA 4IS2A 1EM8A 4RFLA 4B6QA 1HEIA 2Q6VA 4J94A 4XVHA 3IO3A 1D0SA 2YY5A 1II0A 1OWPA 1WZIA 2BKUA 5FUBA 2H52A 3B1WA 4NAVA 3STWA 3WOHA 2VPWA 1Y8CA 4PO1A 1ZVMA 2YV3A 1WETA 1NVKA 4D8WA 2NWQA 4TTJA 4Y2QA 3TOSA 2HEIA 2IIPA 4GLJA 3O1LA 5AI9A 4FYVA 3C3YA 1O77A 5BYJA 3IV6A 3QPCA 3IDSA 4MLPA 4OBXA 4DDMA 4IWYA 4TTIA 2GZMA 3JVEA 1FBNA 2QNIA 4CXMA 4LY0A 4PG7A 1W5EA 2Q8QA 2GPJA 1N2CE 2HD4A 3G0HA 3P5BA 1O95C 5IJ9A 2FK7A 1QNLA 2OM2A 3SX0A 2YWCA 3KYJB 1AQLA 4EFLA 4JFRA 5TQ0B 3WK6A 1ES9A 3AT1A 3CHYA 3ASUA 1B6TA 1IZ8A 3ABRB 3VR6D 1I0IA 3QE3A 3FNIA 3ZEAA 4I81A 5K0NA 4C78A 4G4IA 5CVCA 5BW4A 1F20A 4QECA 2EJCA 4Z7OB 5BN1A 1IWPB 1A3CA 4WE3A 4PNEA 4A03A 1OX4B 3GNLA 2FWMX 4ZWNA 4M3NA 1FFBA 2GF2A 2K6GA 3CNNA 2B61A 3VISA 2QPLA 4GZ3A 2Z8XA 3NONA 4EG7A 5KX5B 1XMPA 3SBXA 3DV0B 4RVDA 3VVCA 1O0BA 2W93A 4GI3A 1LW7A 3I09A 3IAHA 4IO0A 3GOQA 5AKHA 2C61A 3L7CA 3I9V1 3L8YA 4D0RA 4I1VA 3N07A 4GD3Q 1T1IA 3FOFC 1MHTA 3NT4A 5BSUA 3S7ZA 4B5LA 4FGKA 1PFUA 3QJGA 1Q15A 2XUFA 1CEQA 1XMSA 4MV0A 4PCAA 3ACDA 1WV0A 2HCBA 4I9FA 2D7DA 4MI6A 1ZX1A 1M6NA 1Z2OX 3I45A 4RPJA 3LYHA 4N7JA 3NHJA 3EG9A 4O2BF 3MJFA 5AKXA 1WXIA 1XZ8A 2IX3A 1RMQA 1XA0A 1YU9A 4IZ6A 4JL8A 1JAXA 2BGRA 1Z07A 2Z2IA 2OAP1 2LIPA 4PO3X 1PKXA 4M1WA 3JPYA 3PDIB 4MLCA 3QZUA 1SBYA 2QT9A 1VE1A 3Q5DA 2REQA 1T6YA 3HYCA 4HXYA 3KSRA 4BYMA 4D82A 4OHYA 1I6WA 2O1EA 1W75A 3DOUA 2HBRA 2WU8A 1LSJA 1QF9A 2FOIA 2WV7A 3DZKA 4P4NA 1LDEA 5IM5A 5HKOA 5JCJA 1PW5A 2Z8ZA 2VRWA 4GLLA 4JA2A 3AILA 3THXA 2QW0X 4QELA 4O4IA 3JQBA 3WNVA 1IRIA 4HFMA 1E0KA 1Q12A 4JK3A 4X1IA 2WSIA 3ESZA 4JHXA 4XYMA 3VNVA 3QA3E 5B57C 5EJ6A 3NBFA 3ER8A 3IDQA 4M22A 1EJ6A 1REQB 4KKXB 1UXIA 4UPEA 4G1BA 2I1QA 4BMNA 2XADA 4CPDA 4MZDA 1U2PA 1TJYA 3TL6A 4ZOLA 5I48A 4QD3A 2C4TA 1ZIPA 1YC2A 4AMVA 3U44A 4XD2A 1CSEE 1P7CA 4YJDA 1P29A 4JASB 5L7WA 3WLEA 2NTEA 1I1OA 1K27A 1RHRA 1HH4A 1Y8AA 1YK0A 2A0KA 4PQFA 3ZD8A 1U0GA 1LI7A 2UZ0A 4MWDA 3RUIA 2GBFA 5I9NA 2RC6A 5KKAA 1FVOA 3OZBA 5AM2A 3VPBA 3FMVA 1WY5A 1R9NA 1V1JA 3VO9A 2A4MA 4CKCB 4EHAA 4FCWA 1A8QA 1Z47A 2QLMA 3RWOA 3TUIC 4PZCA 1JQLB 1ISGA 1O94A 4WVLA 1IOVA 4X90A 4W5JA 5T7BA 3QYJA 3BFJA 3DTVB 3FZNA 3VR5D 4G0UA 1P33A 3TIFA 3PPWA 4NCAA 1W9HA 3FUXA 3MCWA 2OHIA 3KJZA 4H3VA 3HXMA 3GYBA 1ZO8A 3MGBA 2AMVA 3K7EA 4HTAA 1KPGA 1YONA 4BKUA 1OXXK 3QWIA 4K2HA 3GFRA 5G41A 1GGJA 4F72A 4D98A 4YAEA 3ANSA 4ARSA 2Y92A 3IYLW 4V0KA 4OA5A 4QUBA 1P1KA 4EARA 1UP7A 1FFCA 3SKXA 4YLYA 2B0CA 3E3LA 4YX9A 4TLBA 1HO3A 2P2CA 1D4ZA 4HLNA 1DEAA 4PBSA 4CUJA 3L2OB 5KVAA 2QJTA 2NAFA 3JYHA 2R8ZA 4EQZA 2YZ7A 2HRQA 1B43A 3AHJA 3MCAA 1KEEB 3PE3A 2RGWA 4FHFA 4JIGA 1CZLA 1QOZA 3ZE8A 1BZYA 3QNWA 4Q12A 2C9BA 5EZYF 1I7SB 2VPTA 4TM7A 3RIGA 2XB8A 1H2AS 2W42A 2W11A 1WPRA 3TFQA 2DYKA 2VCYA 4I99A 4RD4A 3VR3A 3C87A 4PFJA 1JKJB 1YCDA 2AMYA 4UUPA 4D43A 1U7PA 3KFLA 2NO9A 1NF3A 1VYVA 1ORTA 1AXEA 3L4BC 4EGJA 1GPUA 1Z3IX 5J2UF 2GJ8A 4EB0A 5I7FA 2AOTB 5DYIA 2NUTA 1E98A 1N9KA 1YASA 3GP5A 3TSZA 2XYQA 4ZVLA 3N87A 4H3HB 2KPOA 5IHPA 1I13A 1QRRA 2WJ6A 3DTTA 4QNRA 1FFAA 4TL9A 5JD4A 5CA1F 1P1HA 3GGCA 3ACCA 4G37A 3LJKA 5K6RA 2LVBA 3KOYA 4U7PB 1HL3A 3A1CA 5HRUA 2A1UA 1AF7A 3NHUA 5HW0A 5KYNA 4C2UA 2G9VA 1LPNA 2YN4A 4GKBA 2WMDA 1L4LA 1KVQA 4IDOA 4O4JA 4CM8A 3WIUA 2NACA 3A6PC 2IU3A 4KI7A 3WA6A 3QK7A 1XGKA 4EFKA 2H06A 5JD5A 3AVVA 3VC1A 2F3RA 4W1SA 3DYVA 3TZCA 1R4MB 3ST7A 1JDJA 2HCTA 1KNXA 2LXNA 5A4JA 1BHJA 5J2UA 4C7JA 5JCJD 4DLXA 4AXXA 1CDEA 3L04A 3DXZA 5C31A 1P7WA 3QYPA 5I6DA 4GPIB 4DANA 4G0XA 4RMGA 1G17A 2XYPA 1UPCA 2J0SA 2QLBA 2ZJ0A 2ZQ5A 1D9XA 2UYHA 2KSQA 2HPVA 4IPTA 1VSUA 5DWDA 3D1LA 5BSEA 4NK4A 3L7IA 2ZI7A 5FFMA 1R2QA 4I1IA 1NAIA 3PXAA 5F7ZA 5TE9A 2Z1DA 2C9ZA 3ONNA 4QFMA 1TCBA 2WT9A 4KWIA 1WOYA 4UW9A 3WHPA 2JBAA 1X15A 1PL0A 1ZD4A 4M0LA 3ZCRA 3HK2A 3ND7A 2MMCA 1P0MA 4PNZA 2HF7A 2R1TA 4MA4A 5DEIA 4G0WA 2Q99A 2P5TB 2C88A 3C3CA 3DE2X 4GX5A 5EQDA 1QUEA 1E3MA 1XTJA 4WADA 1EZ4A 5CAEB 2V7EA 4BZZA 3TNFA 5JH7B 1KZGB 2IYNA 1JFRA 1YRYE 4O08A 4RNCA 4HXEB 3HG7A 4XEHA 3TRKA 1U8FO 4WL0A 1GPMA 2IKSA 1GPBA 5LOVF 4R54A 3UMMA 1ZM9A 3KB6A 4XFJA 1VJ1A 4IAOA 4KQCA 1JMKC 3IEKA 2QZPA 3ZDXB 5ADVA 1DUSA 2VDVE 1OGYA 4DLRA 4L16A 5FNVF 3OPMA 4HADA 5FR2A 4BQPA 3DLHA 3SOPA 2IOFA 2NVOA 3SBOA 1F38A 1IYZA 2WPDD 4IUYA 1TGYA 3LC1O 1H2FA 3FYDA 4E12A 5K3BA 5KQLA 4AN0A 4RFSB 2ZYAA 3HYSA 3BH7A 1QHYA 3D8HA 2JBWA 2YOFA 3EBLA 2Q2NA 3KQOA 5FA8A 3SLKA 2ZE6A 1CY1A 2IODA 1W96A 2PH5A 5K4GA 3QQ5A 4EI7A 3HR7A 1QLJA 4MPDA 1TM7E 2RGXA 1K8ZB 3LKDA 3D2LA 3HA5A 1QIIA 5KOHA 3O8QA 5IS2A 3LQ4A 3MTAA 2BFBB 1LVGA 2PLRA 1RIFA 1RWBA 2ZIXA 3A0UA 3DMHA 3H3JA 4TV8A 3THWB 4CETA 4YCSA 3K05A 4O02B 5DXFA 3ZGNA 3LHKA 3PKJA 3TPCA 1I2MA 3LTNC 3L07A 2W6IA 5B53A 2B83A 4Q9KA 3R7SA 4LRUA 1ZCFA 4NESA 1NGSA 4QVKA 3UFXA 1E59A 1FLDA 1V48A 2JK1A 4OLAA 3LX4A 3OEED 2V7GA 4A5SA 4M1YA 2BEVB 1JHAA 5IASA 3U7HB 4QFCA 5E4JA 1BFDA 3D4OA 4OO3A 2O20A 4QOFA 1YT5A 2J30A 3Q10A 1JR3E 4QNNA 3LKVA 4YP7A 5CB4B 3MMPA 4N5NA 5A5FA 2X22A 1J39A 3MWJA 1RZUA 3VR5H 2RG7A 1B1CA 3AUUA 4GMKA 2VAXA 4MXDA 4RORA 3AV0B 4CMJA 2ACWA 3WYCA 4FGSA 3I4FA 3FPKA 2DOKA 5JATA 5LP6B 2DRIA 3EVGA 1XVIA 3MT7A 5EQFA 2HCRA 3LLCA 2B94A 1NXQA 2A35A 1Z6PA 4P98A 4PSVA 3O1JC 1TEHA 4P84A 4W7SA 2JAQA 5ALDA 3W3AA 1Y5RA 3JQBC 3PITA 5JYCA 4I4IA 2OGZA 4ESVA 4CG1A 2NZXA 1TQ4A 2NV2B 2PUGA 3JVUA 4UTXA 5D7BA 3DTYA 1W59A 5F1OA 5GMOA 3AEXA 2PEZA 9ATCA 4YV7A 1NKTA 2P62A 3I6MA 3SHQA 1DCFA 2VP4A 2ECFA 4NBLA 1QZ3A 2I3BA 4YMHA 3CVOA 3EWIA 2DT8A 2ADFA 2PPVA 2C2MA 2QR2A 1DAHA 1QFYA 1WUIS 2HIGA 1JVNA 2X3UA 3K9GA 5IC5A 1EH5A 4L1KA 4XSHA 4LFAB 3LDFA 3CX6A 3WGQA 2C4MA 3Q6IA 2NNLD 4WXEA 5DTJA 2G4VA 3VR6H 2XAUA 4OY3A 3D7MA 2V5VA 1GSHA 2YZ2A 4H7IA 5E6SA 4BC0A 4CG3A 5JNUA 3HBLA 4ZEWA 5TPWB 1OYOA 3VZRA 3P4XA 3ZGVA 4AN1A 1N0VC 3IGFA 3SEQA 3ZY4A 1C0KA 3ND9A 4LOLA 3GGPA 5IFLA 4CEJB 4UPVA 3N8IA 3CUKA 3D3JA 1Z0DA 1PQ4A 4JKOA 4JLAA 4MUYA 3OTHA 1TD1A 4HDRA 5KYWB 3BD8A 2PMWB 4B7UA 2QWXA 3GLUA 4TKLA 1X8LA 5DYGA 5G4KA 5AK3A 2JFNA 4HFRA 1ZHHA 2IK8A 2ZSEA 1CKEA 3CKMA 4JENA 2WJWA 2O8VA 4KJXA 4LDZA 3V42A 1GWNA 3R0JA 2D5AA 2EJVA 2OCGA 2PZ8A 4WZAB 4RQBA 4JROA 3ZEIA 2BM9A 3Q40A 3PFHA 4WDRA 5K2MA 1XCJA 1RYZA 2FGJA 2I8LA 2IEDA 2YWJA 3DQZA 1VJGA 2DM6A 4U9UA 5EJAA 4E4RA 3OY2A 4V1CB 1Z13A 3PD7A 3TJRA 1YR3A 4JLMA 2G67A 3BMNB 1RU3A 3PUXA 3C74A 1ZW1A 4HWPA 1Z37A 3E5HA 5IBPA 1MVOA 3SZGA 1QMGA 5B64A 5UKDA 3BHMA 5EXDA 5FTNA 4CLXA 3CVYA 1R0CA 1U7UA 3EA4A 3QVLA 2GXSA 2QZ9A 2ZS7A 4KMMA 1MC8A 2NG1A 2G6TA 3PVCA 1Z6QA 4Q4AA 2XA2A 3RC8A 5CFPA 1NJ5A 2VHZA 2BBOA 2W90A 3L8FA 3MJTA 5C5IA 5CG1A 5HOEA 2ZAOA 4YFYA 4OLBA 2B82A 1N6IA 2YHUA 4ID9A 1WABA 1XZBA 2BJHA 3Q6NA 4UCWA 1P2UA 1N36B 5SY4A 3LUFA 2E0IA 4QBHA 4FR2A 1CNEA 3PT5A 2EYQA 1U6KA 4CMBA 4PC3A 2ZBRA 1P2GA 4FUQA 1HNZB 4ZVOA 2X9VA 3H11B 4LJLA 4PAQA 4RABA 3A1SA 4KXLA 3MVEA 2BM0A 4IR7A 1X7GA 1LK5A 2J8ZA 2IHNA 2ZTSA 1GQQA 1ZMTA 2ZIZA 4C20A 4TUYA 1FW6A 2Q6IA 1Q77A 4A8TA 2ECPA 3AR5A 2C4HA 4H7JA 4BNIA 3BBPA 2WKWA 3VX3A 4BQNA 1WW2A 4KVGA 1QQTA 2O2EA 1E77A 1V95A 1NVMB 4H6PA 3FCEA 4HVAA 5D85A 3RIEA 4JI3B 3RARA 3V1LA 2YCLA 1O96B 1TPYA 1VL1A 1NVUQ 3DMDA 1IBRA 3O2SB 3TOVA 3V4LA 4E22A 3FSGD 1U2GA 4HRYA 2RB5A 3QXHA 4MA5A 5JZMA 3OM0A 2R11A 3WLJA 3E1KA 1NC1A 3NT5A 1Y81A 2CNBA 5JS8A 1PNQA 2VZ8A 5EVCA 5A03A 2XVMA 3ET5A 4ZYTA 1KP3A 4MGZR 2IPLA 1E7SA 3ZL9A 2IP2A 2YMMA 3B3JA 3M7IA 1B42A 1Z12A 1FYVA 4AWAA 2OZVA 5LP6F 4HAXA 4M55A 1J99A 3PCRB 4OHXA 4Z0HO 4EZEA 5J47A 4M9RA 2RI1A 4NBRA 3QEKA 1QHSA 2AJTA 1QE0A 7MDHA 4JGBA 3QEMA 4TXJA 3TBKA 3K6RA 1SRRA 1U9YA 2A2ZA 1TCCA 5AH0A 1Z56C 2DBQA 4L5YA 4OYLA 4EQ6A 2NOAA 2QX6A 4N3GA 3BA1A 3GL9A 1GKIA 2JHPA 3LT2A 4U9IS 2DUMA 2OXTA 2Y1FA 3BGVA 1GNPA 3V55A 1RD4A 3ZDZB 5B4VA 2JFOA 2G25A 2WJ3A 2E1PA 2WKQA 2K4MA 3MXTA 1QIHA 4XTCS 2GCIA 2VC2B 4HH3C 4J75A 4OJYA 3ROKA 1Y8ZA 4XD7A 3L05A 3R0IA 4X71A 1X1AA 1Y6ZA 2RH8A 1A72A 2EJUA 3WMWA 1RVV1 2C5LA 1NJGA 3E9QA 1T0UA 4DMFA 2DETA 2AUNA 3HY3A 1R74A 1HDIA 2X1HA 4MKXA 3H65A 3QE9Y 4MV4A 4IQFA 3C7CB 5FPHA 3SR4A 1DBWA 1G5QA 3A7DA 4NFLA 5EJ9A 5HFJA 4RHXA 5I8PA 4ZHQB 3RNOA 1XIVA 4D8YA 3V8MA 3QXSA 1YS9A 4FINA 4DIFA 1OAOC 2EP5A 3KSAC 2J9RA 3HCCA 3B9RA 3HJBA 4GE0A 3S2UA 4N4AA 4X1KA 1YA6A 1ZONA 1GNLA 3QE0A 2OA0A 3NANA 1DB3A 3R5FA 4S1TA 4HEHA 4C5CA 2C9DA 1N6NA 2IZ6A 2P6UA 3AR8A 4MV3A 4Q1AA 4UEKA 3HRKA 4ENRA 5KPDA 1TO2E 4B3JA 3Q7EA 1ANKA 3TZLA 4G1CA 1JR4A 5IBRA 4ENUA 4CQNA 2JGRA 4FN4A 4KBFA 2J3HA 2E55A 4ZQCB 3ZNPA 4AP9A 5H8WA 5IDXA 4C07A 4N40A 4G1VA 3ZQ4A 2IZ5A 4I08A 3GEBA 1XA3A 5DOZA 5I4CA 2PLAA 1V5GA 2YV1A 4EG0A 3HACA 4MCHA 2ZSDA 3DEKA 3MJDA 2XBLA 4R81A 2V6GA 3P9NA 1L7BA 5A4AA 5IDWA 2XKAA 3HUTA 3NTXA 3R77A 2IYVA 5F7OA 4O29A 2IL1A 3RE1A 4MRNA 3OZGA 1SM4A 1CXZA 3D5TA 4DF3A 1I7NA 1YV9A 2WA2A 4V02A 1YR7A 3ZC3A 3PNBA 2M1ZA 1U3UA 5F52A 1G55A 2EEPA 3BQNB 3HKBA 1I51A 5FWAA 4LECA 4YJHA 4LNUB 5T4HA 1CR0A 3F6RA 2WICA 2Z43A 4MS4B 1F06A 1Z4KA 1QO0D 3T0FA 4YV1A 1GAJA 4TRMA 1S4MA 1UJ5A 4PX9A 3K92A 3P9YA 1RE1A 2E9SA 3ICOA 4OF4A 3U56A 1XN1A 3GCGA 4QDZA 3BUSA 3NDRA 3ORHA 4WERA 1C7FA 2Y1KA 1U04A 3R6TA 4NABA 2HFKA 3ZLAA 4BWVA 4IHAA 4BP8A 2XOXA 4IJSA 3C1AA 1HR0B 4WACA 2ON6A 3BDIA 3K16A 2X8LA 3S5UA 3JQGA 1GUYA 4DDWA 1C41A 3HVJA 2FE1A 5AUPB 3PE4A 1U7ZA 3EUWA 4D79A 4M8LA 1Z5GA 1MQSA 1ID8A 4ZC1A 5AVZA 2G7ZA 4GH5A 4LBYA 3MTEA 1U9IA 4RUKA 3OIUA 1YRLA 2Q3EA 4G0OA 4C3ZA 2WYVA 4POOA 1VM6A 3T7AA 1CD5A 3C5VA 3TCXB 3G8YA 4XDYA 4HP8A 1EGHA 1BH2A 4CIBA 1T6XA 2FPKA 1SCIA 2GUWA 4I6GA 4J90A 1RJ9A 2YXBA 3NCTA 4WNYA 3EK2A 3NHZA 4ZI7F 1W0KD 5JR3A 3OC6A 3U17A 2R47A 3VKHA 2D2FA 1CETA 1KARA 1U1DA 3K72B 1Z4PX 5IAKA 4EUSA 1Z5PA 1GAWA 5H3HA 4ZICA 3WAGA 3VSEA 1I2BA 2WD7B 1H3EA 3AL2A 2I6XA 2I6UA 4C4SA 1JAYA 2M6KA 3UAYA 4QKQA 4KWHA 2R751 2Z58A 3IHTA 1VE3A 4K9KA 5CVEA 1SBQA 2ZZMA 4OK5A 1G291 1J22A 4RGVA 5C51B 3HTXA 1NE2A 2FN3A 2FPOA 1ORDA 1I3MA 3E53A 3FTDA 2GNOA 4X92A 2HNAA 2Q9BA 3KP1A 1POWA 4RVGA 4PSKA 2P9TA 1D03A 1Y4ZA 2CY0A 4ZOCA 3TDMA 1A7AA 3L46A 4FDLA 1F14A 4INAA 1EE2A 3PWKA 1IJBA 2WJ4A 2JLVA 2CNWA 1UPTA 3RLFA 3NUZA 1XYYA 3IP7A 2X5JO 3GLIE 4I5EA 5H1YA 3R3YA 2Z5VA 3ASYA 4V2UA 3PWTA 4ARUA 4L7QA 5F12A 1H9BA 4CT5A 4X1IB 2VHUA 4JT4A 1XROA 4HV4A 3Q9LA 3QJYA 2ZI9A 5A7FA 1T9ZA 3NDIA 2HT6A 1JHZA 1TOAA 3KTOA 4MDFA 3RUCA 5J43A 2HQSA 1Z6AA 1NJ1A 3SZLA 2YTZA 3U60B 2QY6A 4YBZA 4IKOA 1HG0A 1PUIA 2Q6TA 2EFYA 1Z29A 3DFZA 4N82A 4OXQA 1JEYA 1RJWA 4CMGA 1JB9A 4H4DA 3WKAA 1EG7A 1MOZA 1RVDA 2JEZA 3U3OA 4CL2A 2H48A 2IA5A 3A3OA 4J43A 3ESQA 1DTSA 2PRYA 3TSCA 2O5RA 2CLLB 4KW7A 4AULA 5AT1A 1AD2A 2O3SA 1NYTA 3GLHA 4MQUA 2QTWB 1U31A 1YS2X 5HFNA 4F11A 1VI5A 4EO9A 4QOIA 3C3MA 1ZNQO 1Q1EA 3UGKA 2ZBEA 1I7DA 1E3EA 4QICA 5LNK1 1QK4A 1ZIOA 4X7PA 1CF2O 3EC1A 3ISVA 1XKXA 1TK9A 3AH8A 1BX0A 2I4IA 4FKMA 4MMXB 4QUGA 2FUNB 1XRPA 1NUTA 2G40A 4FHCA 1KPIA 2P40A 2IYYA 2X76A 1RC1A 3BK1A 3TTTA 3ZZTA 3BL8A 4YRNA 3CRNA 4LY3A 2FSVA 4UULA 4JI0B 1E1YA 2AR0A 3HSKA 2KQUA 3ROZA 2TECE 3OEYA 4JB2A 2VXBA 4MULA 1HXHA 4QLAA 4L5CA 4RAQA 3T5CA 4EWLA 4HD8A 2ZVJA 4NOMA 4S12A 1V3QE 2H7CA 3IEIA 3AIOA 4HS9A 5LXTB 3RAEC 2VDNB 3VDQA 2WPNA 3W5JA 5KNDA 3CQ9A 4NEHB 2CJYA 1ZRMA 1CWUA 4WLFA 3FYUC 4DPMA 1KZ9A 3JZFA 4TSFA 3DL0A 1EGAA 4NU6A 1MCZA 3MD9A 5K03A 1QFSA 1V3UA 4PHHA 2OORA 2GN0A 4Y2UA 5LWHA 1Z63A 2WSSD 2GSWA 2DERA 1C0EA 3JSXA 3SKYA 1DXHA 4ENPA 1AF4A 1E6CA 3EQ8A 2RC5A 3H99A 3V1TC 4Q1CA 2QL5A 4KFUA 1YZHA 3GJQA 3LFHA 1E2MA 3P32A 3W3ZB 4QZVA 2QJRA 1KR2A 1VTKA 3LWNA 5C4GB 4QL3A 1YFLA 2NSHA 3BE5A 4PFSA 1GRQA 4XIJA 4N9QA 4NMHA 2DR2A 1ILEA 4L5BA 3LCVB 1GPWB 3B78A 3QG5A 1N0WA 1YI8A 1WXGA 2FQXA 1G19A 2WWGA 1HY3A 4BLTA 1RYFA 3BGOS 1VA5A 1T2DA 3QXXA 3JQ9A 3SZOA 5JQGF 3U6KA 2HSEA 3E6AA 4X44A 5ER6A 1BE8A 2HKIA 2IPOA 2JL1A 1JA9A 4DYHA 1H1LA 1ZK4A 4KNWA 1AV6A 3KOWA 1BKYA 1Q0HA 1N57A 3PD0A 1JEJA 1Z75A 1NBAA 4TWBA 4RF4A 3RQIA 4C6TA 5BNWA 5FWNA 4BV8A 3H4TA 3JRWA