2GNAA

Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with nadp and udp-gal
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
329
structure length
329
Chain Sequence
QNMLDNQTILITGGTGSFGKCFVRKVLDTTNAKKIIVYSRDELKQSEMAMEFNDPRMRFFIGDVRDLERLNYALEGVDICIHAAALKHVPIAEYNPLECIKTNIMGASNVINACLKNAISQVIALSTDKAANPINLYGATKLCSDKLFVSANNFKGSSQTQFSVVRYGNVVGSRGSVVPFFKKLVQNKASEIPITDIRMTRFWITLDEGVSFVLKSLKRMHGGEIFVPKIPSMKMTDLAKALAPNTPTKIIGIRPGEKLHEVMIPKDESHLALEFEDFFIIQPTISFQTPKDYTLTKLHEKGQKVAPDFEYSSHNNNQWLEPDDLLKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of FlaA1 from Helicobacter pylori Reveal the Mechanism for Inverting 4,6-Dehydratase Activity.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
molecule keywords UDP-GlcNAc C6 dehydratase
total genus 93
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature ec 4.2.1.115: UDP-N-acetylglucosamine 4,6-dehydratase (inverting).
pdb deposition date 2006-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2gnaA01
3.90.25.30 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase; domain 1 2gnaA02
4KUHA 3O8QA 1JAXA 4LVUA 3FNHA 3CKYA 3LYLA 4DBVO 4DRYA 3KTDA 1ZEJA 4WLNA 2VRCD 1MP0A 4TMFA 1Y9EA 2WE8A 2HKIA 3SC4A 1DAPA 3WIDA 4BNFA 5C5IA 2DUUA 2W2KA 3OICA 3Q11A 4CMEC 3AJRA 3EZYA 1LQUA 3WGHA 2FHSA 1K6JA 3NGLA 3ETGA 1HE3A 3KO8A 2FWMX 3VH2A 3I3OA 1I3LA 3DONA 4LMPA 1K3TA 2CF6A 1E7SA 1SCUA 5IDXA 3VPHA 2DAPA 1A9YA 1U4OA 2OP0A 2V6BA 1OC2A 3FNFA 3UN1A 1ZO8A 5A1TA 5L7WA 5A02A 3C7CB 4CQMA 1Y5MA 4CM7A 2CY0A 1MG0A 2CDBA 4FFPA 3WDSA 3JQAB 4DQXA 1ENYA 1AHHA 4LRSB 3I9OA 4B3JA 4PG6A 1PZGA 2DUWA 1HETA 4XQ9A 1YB1A 4TZKA 4IGFA 4RF3A 1LLUA 2CD9A 3C1OA 4GX1A 4QO8A 4BOYA 5DBFA 4N18A 3WR5A 4M87A 1YO6A 2Q45A 4TZTA 5JO0A 1V0JA 3E5MA 4XRRA 3LF2A 4FDAA 4Y8VA 2EKQA 3IS3A 4KDEA 3GFBA 3H3JA 2VOEA 1KYQA 4JK3A 1ZK2A 1WVGA 1Y8QB 1A4IA 2X58A 2PKQO 2QX7A 2LDBA 1U4SA 4PVCA 2C29D 3JQCA 3TZKA 2PFGA 1NQAO 1Q1NA 1P1RA 3NT2A 4CM9A 1F8FA 1ZJZA 3C24A 2R6JA 4R51A 3PTZA 1HL3A 5JPIA 1PJBA 5BNFA 1TXGA 1BW9A 2D2IA 4I1IA 2ZYDA 2Y1EA 3RUEA 4AJLA 4CM8A 2FZWA 3OQBA 5IF3A 4J16A 3TZHA 2O4CA 5BR7A 2ZJ1A 5ER9A 3KETA 5IG2A 1U3VA 4LCJA 4R01A 5FEUA 1UZMA 2B83A 1BHSA 4L76A 3INTA 4E5NA 3DTTA 2JKVA 4A26A 1CF2O 1E7MA 1KVQA 4IZHA 3MEQA 3UCFA 4PG7A 5JDIA 3WGZA 1WXDA 4DIOA 1VJTA 1S6YA 5FF9A 5GY7A 2GN6A 2CF5A 4E13A 2D0IA 1XA0A 5JMWA 4XA8A 1N9GB 1Y7TA 3QW2A 3N74A 2EEZA 1HRDA 1N7GA 5LDGA 1YJQA 5C3MA 3AY3A 2VOJA 4P22A 4HY3A 4U0KA 3ZV3A 3AM4A 4XQEA 2VTEA 3BMOA 3ONEA 5EINA 4AJNA 4LISA 4FOSA 5IDYA 4DGSA 4II2A 1IY8A 1F12A 2O2SA 3ZV6A 3KSZO 5J23A 1E7WA 4BKRA 2EV9A 1QKIA 2PH5A 3I9JA 1CERA 3WICA 5A9SA 4WPGA 5JS6A 1GUYA 1E1LA 2P91A 2JD1A 3SC6A 2HUNA 3R3JA 1I01A 4CR6A 1JW9B 1V8BA 2B0JA 2JFGA 2OGUA 2D5AA 3NJ8A 2VYVA 3K30A 2UUOA 4XB2A 3VHRA 1VC2A 2EW2A 3F5SA 2PD4A 3H6KA 4LRTB 4PCVA 1XDWA 4R1SA 2FSVA 1N92A 4JJIA 3RAJA 3QY9A 5A4DA 1X7DA 3I5MA 1HSZA 2O23A 1DLIA 2VWHA 4QFCA 2BFAA 3VPGA 3CINA 4IJWA 4UVDA 4UVGA 3U3XA 1LBEA 1XIVA 4FSHA 3DXFA 3DB2A 3VPXA 3ORFA 3ZW8A 2OFPA 4RVSA 4IQ0A 2X5KO 2Y1CA 3B1JA 3V1YA 3OJFA 3GNSA 1YDEA 3JCZA 4LMRA 1E5LA 1YDWA 2Y05A 1PJQA 2FSSA 3IDSA 5AOVA 1V3VA 4OM8A 4BIIA 1QLHA 4HNHA 2IYOA 3DZHA 3AY7A 3I9LA 4KP7A 4G5HA 1LEHA 2Y67A 5EERA 3DHEA 3U49A 3OECA 4HXYA 4Q3DA 5G4LA 3KOUA 4BL5A 4AG3A 1U2DA 2GZ1A 4NNJA 3DL2A 1HXHA 3V1UA 3LZ6A 4MVJF 2EHDA 4H15A 3SJUA 1ZXLA 2ZQYA 3WWYA 4GBJA 4J1TA 2JFHA 3H5RA 3DZKA 4MVJE 4ILKA 4F3YA 3VVBA 3BAZA 2VHZA 4YQZA 1CQJA 3EHEA 2Q4BA 4YRAA 5JNLA 3LLSA 4MIEA 3NJ4A 3AU9A 3RJ9A 3BTVA 3GK3A 3RUIA 2PNFA 1SOVA 4ZQEA 5IAAA 1EK5A 3OFSA 3VDRA 2P2SA 1EK6A 4M1QA 5CHEA 1T2DA 1QYDA 4OO3A 1UDAA 1Q7CA 2JHFA 3BTOA 4WNCA 4YT2A 3N7UA 3VKUA 4YAIA 1NPYA 4NK4A 2VYVD 4WASA 4YJGB 3GPDG 1SMKA 1XR3A 1GR0A 4RDHA 1X14A 2HMWA 4RDIA 4UAGA 1ZUD1 4JNKA 4XQGA 4CM6A 4YB8A 3QWAA 3BHJA 3K2EA 4BO1A 2I65A 2FPPA 1N1EA 4IUYA 1ISFA 2XXJA 3K6JA 1I2CA 2VYNA 3QHAA 4MKZA 1MG5A 2DTEA 4Q3EA 1JTVA 5EL0A 4EUEA 1MX3A 4WOKA 1TVEA 1L1FA 3DAGA 1ORRA 2EIHA 2Z1NA 1IZ9A 2ZB3A 2GZ2A 1ULUA 4OSPA 4DC0A 2DBVO 1PJ4A 3GQVA 1F17A 3ZZNA 5BNIA 5IJZA 4IMPA 3STHA 3JQ7B 4BO5A 3ETEA 4P8RA 1HE2A 1X7HA 4YT8A 3L4BA 2VWPA 1HE4A 1KVRA 1KC1A 3WQQA 4I5EA 2YDYA 3D64A 2Y1GA 4GVLA 4DPMA 1WDLA 1GQYA 2CFCA 1HE5A 5KOIA 3ZI0A 1XKQA 1DC4A 4R16A 3DDNA 3A28A 4YQYA 2NU7A 1Z82A 5F1PA 4NU5A 3NX4A 4YDRA 3FRJA 4J43A 1IHXA 3H2ZA 2WD7B 4W7IA 2V6GA 3ADOA 3FBTA 2O3UA 4BNNA 3FWNA 1A72A 5A05A 2X6TA 1XQ6A 2W4QA 3K73O 3LC7O 3GC6A 3JQ8A 1GAEO 2V65A 4I9NA 4NIMA 1NBOA 1T1SA 1E7RA 2VWGA 3A4VA 4A5OA 1H0KA 5HTOA 2C54A 1SO8A 1MFPA 4ZU3A 1D8AA 3H9JA 4HKTA 5CG1A 3TL3A 5TIIA 4M49A 2BGMA 1KOLA 4J90A 4MKXA 3K92A 1QYXA 3JYNA 3QLJA 4TRRA 5A5EA 5KKAA 4L4XA 1GDHA 2CUKA 5EIOA 1UZLA 2O7SA 3H2SA 4YJFA 3CUKA 3G79A 2C7GA 2YV3A 3BA1A 3GGGA 3Q1LA 4E32A 5BT9A 3BMQB 4KMSA 2EF1A 1O95A 4QECA 1D1SA 1QYWA 3AWDA 3NT5A 4F45A 4II3A 4KQXA 4MJLA 1C0IA 5GZ1A 4GGOA 5ILGA 3PWKA 1N5DA 5G0UA 5JDIC 3PDJA 3BHMA 1U1IA 4E6PA 4RJTA 2OUIA 3QA9A 2J8ZA 2P5YA 3DOJA 3HDYA 4O63O 3W8FA 4OIMA 3PYLA 3U9LA 4BB6A 3GMSA 1NXQA 3L77A 4EUHA 3MWEB 1LTHR 2ZCUA 4PRLA 4AJEA 4PLGA 4BGEA 1ZSVA 5I9MA 1UXJA 2EW8A 4JLWA 5EPOA 3TQHA 3JYPA 3ZU3A 4BNVA 5JAMA 1FDVA 4BO4A 3GGOA 1KS9A 3WWZA 3E1KA 1T2FA 4L73A 1U3UA 3VTZA 3JYQA 1P1IA 1ZMOA 1HEUA 2DM6A 3MCVA 1F14A 4CMIA 1Q0HA 1T2AA 3CMCO 1LQTA 2P68A 1VSUA 2YY7A 4TRMA 1VL8A 1MXFA 4PGFA 5CPBA 2QYSA 4IY1A 2PKRA 1R16A 4R1TA 5KJEA 3V2GA 4BMSA 2GZ3A 4D45A 3ON5A 1JWBB 2A92A 4QSMA 3VZQA 5BNTA 1CIVA 1ZKMA 1LJ8A 2ZKLA 4QX6A 4R54A 3TZ6A 3W8DA 3ZGYA 9LDBA 1IUKA 1NHWA 5T67A 3OIFA 1AGNA 4IDAA 3ZHXA 1E92A 3KUXA 4IBOA 4OOFA 4FJ2A 3H9UA 2Y0DA 3AUTA 2VUTA 2XOXA 2X0IA 4UUMA 1E77A 1WDMA 4E33A 3I4FA 1UP7A 3DZIA 5FI3A 5L9AA 2EERA 3GEGA 3QWFA 1JVBA 3C1TA 1TA4A 3NDIA 4NBRA 3TOXA 5IXSA 1H6DA 5G4KA 2J3HA 2Q1SA 1WP4A 3OSUA 1YVEI 4GLLA 1B3RA 2AE1A 4DXHA 1RYDA 2D4AA 3UH1A 1K2WA 4OL9A 3WYCA 3NT4A 5JY1A 1LX6A 2BKAA 3KRTA 2C07A 8ADHA 1AUPA 4BGUA 2OXIA 3RU7A 5JLAA 3JQAA 2WYUA 2GD1O 3VZSA 3P2OA 4ALLA 3E6AA 2G17A 1JDJA 2HQ1A 1GPDG 1HT0A 4K6CA 1WLYA 2IRWA 1I3MA 3ICCA 4E30A 4Z9YA 4M54A 5KVQA 4QTZA 2CVOA 3B20A 3MJ4A 3X2EA 3F47A 4YRDA 2BELA 4GAEA 4JBGA 3KBOA 4J0FA 4PLYA 3QWBA 1BXKA 4WUVA 4J6FA 3HNPA 5B12A 4H16A 4YWJA 5HM8A 3U4CA 4L0QA 2DFVA 4A2CA 1WPQA 3GRKA 4UVEA 2PZJA 3GN2A 4S3MA 3T4XA 4RCVA 2W2LD 4PLTA 3ZNOA 5KJ6A 1EVIA 1VKOA 2HJRA 3JQBA 4L9RA 3D1LA 2BFMA 3DBLA 4YAJA 1HTBA 1DJQA 1XEAA 4W99A 1NVGA 3MJSA 4J2OA 3PWSA 5JBIA 2HRZA 4IJUA 4MVJG 1A27A 2YZ7A 1BW9B 3IUPA 2NM0A 1L7EA 3IL2A 1SZJG 4DWVA 4FGWA 4U0JA 1Y5RA 3QV1A 3FBGA 4CLOB 1A9ZA 1PGQA 1G1AA 1T4DA 3AOGA 2QRKA 3LQFA 1SPXA 3U62A 2W90A 2WD8A 3OJOA 3IKTA 1MA0A 4IGEA 1VKNA 2Z1MA 4HWKA 3T4EA 4CR8A 2FOIA 1T25A 4DBZA 3JD1A 1QRRA 5TGDA 3EYWA 5IZCC 1UAGA 2Q2QA 1BWSA 3RUDA 2DLDA 5I9NA 3RKRA 3K31A 1P31A 1R4MA 4DVJA 2Y1OA 5CDUA 4YCAA 2Q46A 5DF1A 3RC1A 1EQUA 3GT0A 4C7KA 4FD3A 3KEQA 1JKJA 2QYTA 7MDHA 3QJ5A 3ZHYA 3D0OA 1H5QA 1U2GA 1H94A 3QP9A 1ADCA 5DT9A 4EDFA 4PZDA 1C0KA 5TT1A 3GUCA 5ITVA 3R6DA 2H63A 2VT3A 3JYLA 3GVPA 2WM3A 3E82A 1RYEA 1XWFA 3JTMA 4F6LA 5HA5A 4GWKA 5C37A 1UJMA 1XQ1A 3OJEA 4W4TA 4WCDA 4FFLA 5KJ1A 5CPFA 1T2EA 2GYYA 1I2BA 3JD3A 2ZTVA 3U4DA 2UYYA 3KYDB 3VPSA 3VH3A 3ENNA 3GDGA 1TEHA 1KY4A 2DBQA 2OP1A 1TT5A 4E12A 5L4SA 1PQPA 1Y9AA 2J3JA 3QWHA 1DHRA 1O94A 9LDTA 5H82A 4BO3A 2E49A 4NBWA 4NHEA 1I3KA 1ZCJA 2VT2A 4XYMA 5DP1A 5FFFA 4ND5A 2C0CA 2Y99A 4HBGA 2Y0CA 3L6OO 4EBFA 2CDCA 1JQBA 1X0VA 4D3SA 4BB5A 4BKQA 1A7AA 1PGNA 1VM6A 1ZMTA 4R5HA 5BQFA 1QV6A 4XYGA 4BNUA 1T24A 5CG2A 4R4JA 4YJHA 1EEHA 1DFHA 2X4GA 5DBGA 3HB5X 3PJGA 1GUFA 3DMTA 4NG5A 2X9NA 1SB9A 1ISHA 1XYGA 1FF9A 3Q2IA 3UHAA 3CSDA 2NTJA 3C1AA 4Z9FA 4A73A 4MP6A 1IOLA 1LLDA 1OAAA 5CEEA 5JSFA 4B79A 2CDAA 2C5AA 1W8DA 1VPDA 3E9QA 4WEQA 1SC6A 3TJRA 3OIGA 4BHTA 4CQLB 3JQ6A 4YVFA 2D8AA 3WGTA 5JDCC 5HS6A 2DU8A 3ZHBA 3EUWA 2BH9A 1OMOA 2VHYA 2O3SA 3M1AA 3GVXA 3IP3A 4Y6PA 3FNGA 4D46A 3Q2KA 4E3ZA 4CUJA 1PSDA 4R3WA 4BNIA 1ZW1A 2TMDA 4AL4A 4KQWA 2G0TA 1I30A 4Y67A 1UXHA 3VH1A 5F1OA 2AEMA 2NUAA 2RH8A 3AI1A 3I52A 3CTMA 3PI7A 1PZFA 1F0YA 2G76A 3WSWA 2QW8A 2GN4A 1FDSA 4MKRA 4IJVA 5AXCA 5TT0A 1YONA 1C1XA 3HDJA 4J1SA 5F5NA 3VOSA 3SLGA 1I33A 3B1KA 4IIVA 4CMBA 1TB4A 5K6AC 2NVWA 5HS4A 5EESA 2QIOA 4CODB 3MJEA 3GOHA 1IYZA 2JCXA 3AFMA 1H6CA 2IZ0A 1NVMB 4BNTA 3EZLA 3OA2A 4YT4A 3ZU2A 3PP8A 3DWFA 4RL6A 4LCEA 3H7AA 2UAGA 5JCJA 2H1SA 1I10A 4Z0PA 3LT4A 3QVTA 2FPGA 1FDWA 1HDOA 5B1YA 1K6XA 3ZWXA 4O0LA 5JCJD 4QFDA 2V7PA 4A03A 1R4NA 2EKPA 4RPLA 1DAOA 1EFLA 1PWXA 2PZMA 5EQFA 3F46A 1C0LA 2HMSA 3A1NA 1E0DA 1ZK3A 1LU9A 2VZ0A 1PJSA 2QG4A 3DZFA 3K5PA 1DXYA 4FR5A 3DBHB 1YQDA 2J3KA 4L8VA 4DQVA 4BO9A 3K9QO 2RHCA 3VDQA 3ZHZA 1ZK0A 1AE1A 4MDHA 2X23A 3WTCA 2HU2A 1Q0LA 2HO5A 3Q9UA 1A71A 3IJRA 1E1NA 2YFHA 1MGOA 3ZU4A 4CMAA 3G1UA 1GCOA 4UEKA 2WD7A 4M8SA 1WWKA 2BF7A 1LDMA 1YE3A 3FN4A 1HLDA 3GZNB 4W82A 1B2LA 3O38A 2BGLA 3RJ5A 4YEDA 3G3EA 1ZEMA 2B69A 1QXSA 3CXRA 2EGHA 4NBUA 5T8KC 3WMWA 3EVNA 3INRA 5BSHA 2A94A 4NJMB 1ZSYA 4AFNA 1E6UA 1B16A 3W8EA 4CV2A 1NHGA 4ZRMA 3GPIA 3SLKA 4WNIA 3H5NA 4ND4A 5B37A 4YXFA 1OZAA 1DC6A 4CV0A 2GSDA 3HB4X 3Q6IA 3GEDA 4IMRA 4MVJD 1AXEA 3ONDA 4XJTA 2C82A 5TNXA 3DAPA 4EI2A 5L51A 3BIOA 3WNVA 2JD2A 3AUSA 3QRWA 3OETA 1GPJA 4MVJA 1NASA 1UP6A 1EQ2A 4CR7A 1HDGO 4GX2A 4BS9A 1I2ZA 2J5QA 4OHUA 2H9IA 1XSEA 3LSYA 1BXGB 1GCUA 2ZK7A 2NTNA 3AM3A 3PXXA 3D4OA 3VPFA 3QWIA 3QVXA 2RAFA 4H3VA 1LDGA 3NKLA 3NEPX 3ZWVA 2CMDA 1Y81A 2YQ4A 3UVEA 2P9GA 4XZ3A 4D42A 1EZ4A 3D5QA 3VZRA 3ETDA 4TVBA 3AUUA 3UKOA 3GN1A 3GZNA 3ULKA 4I9HA 1MLDA 1W73A 1XCBA 2OBYA 3P7MA 4PLFA 4GPD1 2ZYAA 4J1QA 3PZBA 2IXAA 1EFKA 1H6AA 2FR8A 2YYYA 4GI2A 4JCOA 4DQUA 3WLEA 3FNEA 3WGOA 4XWYA 5H81A 1HKUA 3Q3CA 4ALMA 3WJ7A 2W2KB 2OMEA 2Y1DA 3AM5A 1VRWA 4BO7A 1S7CA 1VI2A 1RWBA 4CLEA 1GY8A 1ZK1A 4G65A 3ZNQA 3DBRB 5ENVA 3NTOA 2PD6A 2RCYA 4TWRA 1E3JA 3RCBA 4AJHA 3L6EA 1DIRA 4PZCA 3ROQA 6LDHA 2ZTUA 5JCXA 4ZJUA 5DOVA 4BNWA 2O7QA 5T6BA 4BNJA 5IDQA 4WLFA 3RFVA 3H9EO 3WTBA 4FOOA 4WLOA 4FQ8A 1MC4A 4CQMB 1ZFNA 1P3DA 2PV7A 5U4QA 4DL9A 2DTXA 1OOEA 2VHXA 3ANLA 4BO2A 3WJAA 1Z75A 3WLFA 3K2BA 1LRKA 3EW7A 4CM3A 1LRJA 1FDUA 3NAQA 2E48A 3RVDA 3RFTA 4BO8A 3UCEA 3JSAA 5JC1A 2VYND 1SEPA 2P9EA 1QR6A 2DPGA 4XJSA 1R12A 5JYEA 4Q3BA 5A9TA 3LK7A 3MTGA 3OF2A 1LSSA 2X8LA 3FI9A 4RGBA 3C3XA 3CE6A 4OQYA 5JE8A 1B8UA 2DBRA 1SBYA 4OH1A 4B8WA 1GADO 4ESOA 4DYVA 4O59O 5G0TA 2QRLA 3TOZA 3PYXA 4XEHA 3TWOA 4BNLA 2VNSA 1GUZA 3BZUA 2PTGA 5TQVA 2YV1A 1ISGA 1PJ3A 1MB4A 3V1TC 3HFSA 3BMNB 1R37A 3AW9A 4DUPA 5ICSA 4J7UA 1ADFA 2DPHA 4G2NA 1TLTA 4QXMA 3GY0A 4QEDA 3E9NA 3ZDFA 2NNLD 1NM5A 4FPXA 4KTTE 2AEJA 4XCVA 1P45A 2ZATA 2I9PA 4PLCA 4KDFA 4DTIA 4NU6A 5LDHA 4CV3A 3ICPA 5CEFA 2BMAA 1Z7EA 1ZSNA 4OXNA 3KSUA 1T4BA 3L4SO 3S2GA 3DBVO 1YKFA 3DZJA 4IJKA 3D3WA 3H65A 3RWBA 4OXKA 5L4NA 4CMKA 2PK3A 3EC7A 3FCOA 1GV1A 3FSRA 3KXDA 1B0AA 3IIEA 3WGYA 3QSGA 3DBLB 3E8XA 1UZNA 5AYVA 1Z45A 4JBHA 3V2UA 4BO0A 1ONOA 2PGJA 4UULA 5IDWA 1QYCA 4N5LA 1KC3A 2JD0A 2OORA 4CMEA 5BSGA 5A9RA 1C1DB 4WKGA 1MXHA 3H9QA 2HK9A 4UUOA 1YOVA 4EJMA 3LT0A 3GZ4A 4DLLA 4JJFA 4PZEA 3M2TA 2B37A 3HN2A 4DIBA 5I7VA 4NFSA 3ZH2A 5EMHA 3IKVA 3QIVA 3ZWOA 2VTDA 1DFGA 3HSKA 4CLDA 2Y0EA 3HADA 4JX8A 5KVSA 3JD0A 4MPDA 3BTUA 3F9IA 1XGKA 2G5CA 2GGSA 3I83A 2C2YA 2AXQA 2GO1A 1OI7A 5TLSA 1VL6A 3K8ZA 3ZU5A 3ZWYA 5KIAA 2NQ8A 2VWQA 1ADBA 3E9MA 3IQDB 1Y1PA 4U7WA 2EKLA 4WOJA 1CETA 4W9NA 4M86A 1PU2A 1DC5A 2Z5LA 1DHTA 2C59A 2VZ9A 5JC8A 2AG8A 3O9ZA 4L75A 4JJGA 4PLPA 4K26A 4YAEA 4FCCA 1BDMA 2Q3EA 3F3SA 4ID9A 3AFNA 1H93A 4B7CA 4KWIA 4NQZA 2ILTA 3UICA 3F4BA 4HUJA 1JWAB 2E82A 3L9XA 4KOAA 1M2WA 4OAQA 5TSDA 5AXBA 3W6ZA 1HSOA 4IQGA 4RVUA 5K0ZA 2J6IA 4WJZA 4WLUA 4NFYA 1CYDA 1N8KA 4R69A 4LN1A 4R9SA 4ALNA 5IN4A 4PFJA 2Q1TA 4IQ8A 4ZN6A 1B7GO 3GFGA 1QV7A 3LC1O 3UCXA 4BNMA 1XG5A 2PH3A 1O89A 1HDCA 2EXXA 3NDJA 1DLJA 5COQA 3WYEA 1G0NA 4J7CA 4FFMA 1TT5B 3HFGA 3W4IA 4KZPA 2JAPA 4YPOA 3ZN2A 1UXIA 2EP5A 4W7HA 1U7TA 3GHHA 4HNGA 4FB5A 5L3ZA 4XB1A 2RBEA 5JDCA 3UW3A 1I36A 2HLPA 2RHRA 1KEVA 5KJFA 5L40A 2DC1A 3PJEA 1YL7A 2AA3A 4XGIA 2Q1UA 3K96A 5CP8A 1U9JA 4NFHA 4R41A 3ZWBA 2POQX 1HDYA 4TROA 5TX7A 1Y8RB 4ITUA 4S1VA 1DO8A 4GLOA 3ASVA 1DBVO 2O50A 3JQDA 1JAYA 2GERA 1KEUA 3CZMA 1K6IA 4NBTA 1UXKA 1EUZA 2VCYA 4FW8A 2BD0A 2HMUA 4INAA 4BNZA 3OM9A 5AQ1A 5B4VA 1UUFA 1LUAA 6ADHA 2EJWA 2AQHA 3EY4A 3TPCA 3FF4A 4P4GA 1U8XX 1PR3A 2FZEA 1V3TA 4D43A 1A5ZA 3OJLA 1JU9A 4FFRA 1Q7GA 3EMKA 2OO5A 3I9MA 4ND3A 4ALKA 1JVSA 3E5RA 1K89A 5C7IO 1W6UA 1YWGO 3OH8A 5A03A 5JFOA 3I6QA 4RF4A 4XIYA 3MTJA 5THKA 2B4QA 4GMGA 1SB8A 4MIYA 4A27A 3KYCB 1HZZA 4PLWA 1OC4A 3DEYX 3HHPA 3PHLA 4IIUA 1LC3A 1NFRA 5I8ZA 4IDDA 3UAGA 1DSSG 1J5PA 3COSA 1ONNA 1C1XB 2BGKA 1MV8A 1Q2XA 1E6WA 2PR2A 4NDNE 3JD2A 2B4RO 1GTMA 3PFFA 2F00A 5DCWA 3HN7A 3RKUA 2B4TO 4G81A 1HDZA 1QP8A 3D7LA 1ID1A 3GH3A 4DA9A 4XDYA 4YJDA 3WFJA 3PVZA 4W9NC 2EJVA 4UREA 1EBFA 4X54A 3WGGA 4BUCA 3FWZA 1PL7A 3WBBA 5I9LA 4ZICA 2VHWA 1WZIA 3ADPA 1I0ZA 2W98A 3DMYA 3NRCA 3PFWO 4RVDA 5FYDA 3VVCA 3GA0A 4DMLA 1JN0A 2QQ5A 5L95A 3UFXA 3ZWAA 1NQOA 2H5LA 3GVIA 4P4NA 1M75A 4GL4A 4E4YA 1GD1O 4ALIA 1NP3A 1RM5A 3PHIA 1P44A 4B4WA 1W0CA 1UP4A 3JQ9C 4ZHSA 5CEJA 1PS0A 1BTOA 3OIDA 4DC1A 2GF2A 5L45A 4B4UA 2QHXA 4K9DA 1WW8A 3DOCA 4UEJA 5CDGA 3TFOA 4QQRA 5T64A 4J4BA 1XHLA 1GEEA 1Q0QA 4E21A 4IDGA 4JBIA 1GYRA 4O6VA 2VRCA 4WCFA 3TSCA 2NVUA 3IAHA 1NPDA 2BRUA 4AJPA 4FC7A 3ZWMA 1NPTO 8LDHA 4K1LA 3PLNA 3WIEA 2YHIA 4GMFA 4D41A 4RQUA 1O0SA 1XELA 1P1FA 4RPHA 1EDOA 2X0RA 4ROSA 4ZQGA 5KWEA 2ZIZA 3CPSA 4FFOA 4CL3A 1MFZA 1DB3A 1NR7A 3S2EA 2GLXA 3I9NA 2HK7A 5MGBA 5A04A 4BQPA 2A4KA 2AHRA 1NAHA 2E6UX 3QVWA 3U0BA 3T7CA 2GR9A 5G0SA 3GUYA 2C2XA 2ZTLA 1V9LA 3O8QB 3C8MA 4IM7A 4MP3A 4CMJA 5CAEA 4BV9A 2PZLA 4B3IA 3QE3A 4R9RA 3W1VA 4AICA 3PHJA 3BXXA 1E7YA 1BG6A 3DFZA 5JYDA 4I5FA 1IZ0A 2IE0A 2GRAA 3TF5A 4CM1A 3I23A 4OQZA 3LT2A 3RUHA 4NZ9A 5A5FA 3JQAD 3OEWA 1EE9A 3JV7A 3EK2A 1ZXBA 1E3SA 1FXSA 3RQSA 3ZNNA 3ZWPA 1ULSA 4OXYA 4D3FA 3LLVA 1ARZA 3JQEA 3CH6A 3GAZA 3GMDA 4HFMA 1RPNA 3FD8A 4I5DA 4RVFA 4NPCA 5LCXA 2X9VA 1ZNQO 1EMDA 2ZJ0A 3CEAA 4ONEA 4QO7A 5A3JA 1NFQA 1BVUA 5F5LA 2Q2WA 5DNAA 1PS8A 2NADA 4WK6A 3DQPA 4ND1A 2X0NA 4OSOA 3WX0A 4AJ4A 3U09A 4B3HA 2X5JO 3GG9A 1K0UA 5IZ4A 2FMUA 3KEOA 4GVXA 1LI4A 3AI2A 5G2OA 3N58A 4J9VA 3DZGA 4RORA 3B1FA 1QMGA 4PLVA 4DLAA 2EWMA 1H9AA 5ENDA 2PKQP 5U9CA 5CDSA 1U5AA 4BMNA 1ML3A 2PD3A 1LLQA 3GAFA 3KZVA 2G1UA 1PZHA 1YL5A 2PY6A 4L4RA 5T5QA 3CIFA 4D44A 3DO5A 2O4UX 5F3RA 3FHLA 5EJ2A 1V3UA 4RV9A 2NSDA 2UUPA 3PHGA 2JCYA 1HDRA 1H6BA 5L7TA 3FR7A 3ZV5A 2O3QA 4HFNA 3S55A 4CM4A 3CZRA 4LSWA 2PWZA 4A7PA 5BSEA 3ABIA 5DDIP 4IS3A 2WWRA 3KM0A 3WS7A 4EEZA 4WGGA 2X0JA 3NV9A 3AK4A 1U28A 2JJYA 4BKUA 3ZWCA 4XD2A 2WJPA 3G49A 2X7HA 4Y6RA 1LA2A 1ONPA 4RVHA 4CL8A 4P38A 2JFFA 1TI7A 3BMNA 5AXAA 5L53A 2VHVA 3QQPA 2YW9A 4IDBA 1YH3A 5HRUA 4LW8A 3WOHA 3L4BC 3WFIA 1WMBA 2AW5A 3TN7A 3RUCA 3EGOA 4ZQHA 4CJXA 1OBFO 2NU6A 1A7KA 4L4SA 1N9GA 2J5KA 4FC6A 2DKNA 4J91A 3GVCA 5U1PA 1LRLA 2O3JA 4OMUA 1HDXA 4ZA2A 3BMOB 4YAGA 5KVVA 1YGYA 4JIGA 4YR9A 2ZQZA 5CDYA 4FIZA 4DPKA 4NR0A 5C7LO 1PL8A 3DFUA 2EG9A 2X22A 2JL1A 1GEGA 3NYWA 1DIAA 4AJKA 3C7DB 3PWZA 4D0RA 1ZIDA 5L7YA 1P1KA 4BNKA 2HK8A 4CMHA 3PK0A 1YBMA 1Q7BA 4MO2A 1M66A 1V6AA 3D3WB 4BO6A 3RUFA 2XF8A 1KEPA 4U6QA 3ZCXA 3ROKA 5A9SB 3GDOA 2X1HA 1SOWA 1ZZEA 4XGNA 1UR5A 5HWSA 1I32A 3JQGB 4CMGA 4J4HA 1QYVA 5B4UA 4A0SA 2AQIA 2O3RA 3LF1A 4RPKA 2R00C 2TMGA 5ICMA 3PPIA 4Z0TA 4NBVA 4CV1A 3NTQA 4B4VA 1GZ4A 2J5RA 3M6IA 2ZTMA 3KVOA 4AJ2A 4DREA 4MINA 2HMTA 5KVCA 2GASA 4E5YA 3OHSX 3KYBA 5ILOA 2WTBA 2ZB7A 2FR0A 4J49A 5IFLA 2CZCA 4LVCA 1KVTA 3BMCA 5JAQA 5IXYA 4RF5A 1NWHA 4HFJA 1B26A 1F8GA 2DT5A 2IDZA 2YQ5A 3KYDA 3LC2O 2FP4A 5DN9A 4PN3A 1BRMA 1KETA 1KVUA 1F06A 2DFDA 3VAZA 3L9WA 1A4UA 4CLHA 3B6ZA 3OQ6A 1LSOA 2D1YA 2J3IA 2NVBA 2O3TA 1DJNA 1GU7A 3WSVA 1CWUA 3R1IA 3P2YA 4E31A 5B4TA 4CLXA 1B3BA 3IMFA 4PIVA 3GEMA 1YBAA 2CVQA 5ITWA 3DHNA 1N2SA 4OJNA 1LXCA 4W6ZA 1RJWA 2YHUA 3KB6A 2GDZA 3GNQA 4Y9DA 3TNLA 4CPDA 1NFFA 4RVGA 3F6YA 3GVHA 1XLTA 4MP8A 3GLQA 2H6EA 2D5CA 1LNQA 3PLRA 3RI3A 2WYVA 3NGXA 4EGFA 2VZ8A 3RFXA 1JKIA 2HSDA 4M55A 4GH5A 4ALJA 1PS9A 3UXYA 5I8WA 3ZWNA 3SXPA 4CQLA 4GWGA 5GZ3A 4WLEA 4YJGA 4I9UA 1SEVA 3VKVA 1FMCA 4Q3NA 5CFZA 1TT7A 1P77A 3GR6A 1DDOA 4KUEA 2PGLA 1E1KA 1GYQA 2EP7A 2RIRA 1BSVA 2XPCA 2YDXA 3HZZA 1IPEA 2I3GA 3DZBA 5I7EA 2VUSA 5TJ9A 1VJ0A 3ZV4A 2AG5A 1G0OA 3PRJA 1XU9A 4C7JA 2PA3A 5F1KA 3H3FA 3SVTA 1QLJA 4TSKA 3ROMA 1QG6A 4YAKA 4XRGA 1FK8A 4XX0A 1R0SA 1I3NA 1Z74A 1P33A 1RKXA 2YV2A 3V8BA 4B7XA 4J3FA 2VN8A 1MC5A 1NR1A 3QVOA 1NYTA 4I08A 1W4ZA 3JQ7A 3WGIA 1IE3A 2AE2A 3C7AA 2WMDA 3R3SA 3F1LA 4CM9D 4UVHA 3ZW9A 1P0CA 1LSJA 2C7VA 1B8PA 1B8VA 2GN9A 2R00A 2X5OA 2CVZA 1X1TA 4R5MA 3VC7A 1DIHA 4WEOA 1ZK4A 1CQIA 3NUGA 4L74A 4XGKA 4XR9A 1LDBA 3SX2A 4HP8A 5COBA 3PQFA 2OHXA 4OYRA 4C4OA 1ISIA 1DEHA 3OEYA 4KUGA 4TRNA 4GQAA 3LVFO 4DMMA 4RO0A 3G0OA 4Y6SA 4XDZA 3MOGA 4WLVA 5TJHA 1RM4A 2EGGA 3DBHA 2YFQA 1PEDA 3KYCA 1PJ2A 3PQEA 2JAHA 4E2YA 1P0FA 2I3AA 3INGA 3PIDA 4E2ZA 2E37A 5A3VA 1FJHA 4I5GA 3DHYA 4IDEA 1J0XO 5K9ZA 1BVRA 4R1NA 4OOEA 5T57A 1BGVA 3AU8A 4B4OA 4KTVE 5DBIA 4NK5A 1J4AA 2GPTA 2Y68A 2I99A 3I6IA 1DIBA 4MVJM 4P4LA 1D4FA 4EJ0A 4DYDA 3GRPA 1DFIA 3M2PA 1ISMA 1VL0A 4GSKA 4CLRB 1UH5A 1EVJA 4YJFB 1P9LA 2NTVA 2OBNA 2Z95A 4NJMA 1PJCA 3WMXA 5LC1A 3BMQA 1FDTA 1MUUA 2ZB8A 4MVJI 3MOIA 4D0SA 3VZPA 4PRKA 1L7DA 3ZWWA 4EYEA 1E3WB 1GQQA 3G17A 3DAFA 4BNGA 2Y93A 5ER6A 1ZJYA 4EZBA 4ZGWA 5G0WA 4GKBA 1GZ3A 1HZJA 4OGWA 1BXZA 2FR1A 3JQBC 2A9FA 2HCTA 3KLMX 4N5NA 3S1LA 1IL0A 1IHYA 2B5VA 1U5CA 4IDCA 2IODA 1P1HA 3S2IA 3L07A 3UGKA 1BXGA 4TKLA 1GL3A 1EE2A 2B35A 2IEBA 3PEFA 1Y6JA 2G82A 3DOOA 3RC2A 4WCFB 3H4VA 1UDBA 1P74A 1PJLA 2NVUB 4B7UA 2BHLA 4DIFA 1QSGA 4LK3A 3RU9A 3O26A 3HDHA 3WQSB 3HQ4O 4RZIA 4E5MA 1E1MA 3BYZA 4N54A 4RZHA 3DR3A 4TKMA 2B5WA 3JQFC 4NJOA 3MJTA 1EVZA 3WGQA 3AUAA 3HG7A 4PG5A 3RROA 3PGXA 1AHIA 2Q49A 1PX0A 2CSUA 3OMLA 1WZEA 4CUZA 2X9GA 3DBRA 1B14A 1YB5A 3A9WA 5ES3A 1H2BA 1YQGA 4PG8A 1LSUA 4CMCA 2Q99A 3DTYA 4U5QA 3JD4A 3JQFA 4Q9NA 3SEFA 3OBBA 5AVOA 2NU8A 1HYHA 1X15A 2Y1FA 4J7XA 5C7OO 5JW6A 3DC2A 4JROA 1GQ2A 4E5KA 2O2YA 1DRWA 1DRUA 3JYOA 1EDZA 1N7HA 4J1NA 5KNLA 2GCGA 2WEKA 5IZCA 1Y8QA 1HYEA 3T7EA 1AXGA 3FR8A 4YTEA 4XYLA 1UAYA 3I4CA 4UEOA 5G4KB 1E5QA 5JO9A 4JN6B 4J9UE 3MJVA 2QZZA 3H5AA 2C20A 4JQCA 4Z9XA 1SNYA 2GNAA 1R0LA 1XU7A 2AQ8A 2RH4A 1VJ1A 1KIFA 2I67A 1RM0A 2I66A 3LU1A 2HJSA 3L6DA 3W4JA 1PTJA 5JAZA 3D4NA 3W6UA 4TQGA 4EJ6A 1NNUA 1N1GA 4HADA 4AJOA 4EITA 1CEQA 2F1KA 1YJ8A 2VNAA 1V35A 3RUAA 4CM8B 1JA9A 4YRBA 1AN9A 2AMFA 2D3TA 5H83A 3EDMA 1PQWA 3AI3A 5BSFA 2VQ3A 3OQ1A 4J4TA 4E2WA 1IB6A 1PL6A 4E0BA 2PGDA 3PGJA 4N7RA 3JQ9A 1HYGA 2P4HX 3A06A 4XYBA 4PLZA 1WMAA 3RC7A 2IZZA 2VUUA 5KKCA 1GZ6A 3C85A 3KSDO 2AEFA 4Y98A 2AQKA 1PWZA 4CM5A 4EUFA 1GFSA 3GDFA 4XQCA 4OKIA 1YRLA 3GF4A 4MVJP 4WCFC 1KVSA 3W4KA 4M89A 3WBFA 4D7AA 3UOGA 1NX6A 3WNQA 2DTDA 2NQTA 2FPIA 3Q0EA 1GV0A 4YBZA 4ND2A 1KERA 2LDXA 1I5RA 3RBVA 3ZNPA 4N5MA 1DC3A 1I8TA 3IP1A 1YQXA 4RPJA 1E3IA 1T26A 4ZVVA 4YYZA 2CNBA 3V5NA 3Q9NA 3ROPA 1KBZA 4GSLA 3OA0A 2JCVA 4O5OA 4H7PA 2NACA 4CM4B 1IULA 1DIGA 2BFOA 3BHIA 1PJTA 2Q2VA 2UV8A 4CLOA 1I24A 3RBZA 4RQTA 2VRBA 1PQUA 1X0XA 1D1TA 5EN4A 3RIHA 2I76A 1LDEA 1PGPA 2HDHA 5FI5A 5GZ6A 3AY6A 1ZH8A 3E18A 4RLSA 3FPLA 2W2LA 7ADHA 1NWCA 5DULA 5KJCA 4UUNA 3MZ0A 1NAIA 4UVIA 3RASA 2E4AA 1M76A 2OZPA 1C1DA 3VTFA 4Q39A 1WNTA 3PJFA 1PR9A 4XR4A 1VLLA 1YOVB 3VH4A 1YBVA 1H9BA 4GX0A 1R4MB 3ANNA 4IPTA 1LLCA 2P5UA 3ONFA 5JAIA 1CJCA 4B8ZA 5MDHA 4MIOA 4Z3DA 4Q3AA 5A06A 1K5HA 1ADGA 4MOWA 3TFQA 5AXDA 1WAMA 4TRJA 1X7GA 3RSHA 4BGVA 5JXWA 3U5TA 1YXMA 3F4LA 5FWNA 4NMHA 3D3EA 4BKPA 2IYPA 3I9KA 4PLHA 4WE3A 3G1TA 4IZIA 2BLLA 5DP2A 1CRWG 3L0DA 4FN4A 5THQA 2WE7A 5CDTA 1KY5A 3JQGA 3NDRA 4E5PA 2PLAA 3M1LA 1PGOA 3AOEA 4A10A 1J49A 2QRJA 1NQ5A 4XYEA 3TZCA 3TDKA 5GMOA 1Z73A 2WYWA 3RBXA 3GG2A 2ZB4A 2DVMA 1UXGA 1LDYA 3MWDB 5DCUA 5DOZA 2WSBA 4J2HA 4AJ1A 1JKFA 2ZCVA 1ISJA 2R2GA 5L4LA 3WXBA 1HWYA 1P1JA 4MVJH 1PIWA 3ASUA 2FY8A 2ZYGA 4IINA 3D4PA 4ZQBA 4E2XA 3U4HA 3D5TA 3EAGA 5JY6A 1R66A 1O6ZA 4HX5A 4KWHA 1E3EA 3BMCB 3BTSA 1U8FO 3ITKA 3WG9A 4U8GA 5ADHA 2Y66A 5KCZA 1E3LA 3HDQA 2YJZA 4FS3A 3TL2A 4J0EA 2BI7A 2OL4A 4YJHB 5T8KA 3KV3O 1ENOA 2D59A 4FGSA 1BDBA 4URFA 1B15A 4UUPA 4BNYA 1HF3A 3U4IA 4PVDA 1U7HA 3ITDA 1SAYA 4HV4A 1X1EA 2QZ9A 2NLOA 3PHHA 2YUTA 2V6FA 4RPGA 4JXKA 4Q3CA 4BQRA 3IUSA 2GN8A 3P5SA 3I1JA 4FJ0A 4IDFA 4QT0A 2HAEA 3ANMA 1Y8RA 2X86A 4LSMA 3F5QA 1BMDA 3DMTC 1E7QA 3OJ0A 1NVTA 5COAA 1YS4A 2Q1WA 2JHGA 2WDZA 4F46A 5F21A 1DPGA 5TC4A 4YA6A 2DBZA 3V2HA 4HFRA 4QUKA 1D3AA 4JGBA 3PZRA 1UDCA 1C14A 3GHYA 4Z6KA 4AVYA 3IJPA 4I8XA 3S2FA 1E6EA 3LDHA 1IPFA 2BFPA 3NTRA 4BNXA 3WYBA 1GYPA 3MJCA 2IXBA 2Q50A 4BGIA 2FN7A 3HWRA 1M6WA 3HUDA 4YACA 1ZVMA 3ST7A 4ZD6A 4BMVA 3E48A 5TS3A 3WB9A 4IS2A 4R3NA 5K6AA 3A14A 5JMPA 4O1MA 1KEWA 3EVTA 1R6DA 1O9BA 1WDKA 1EUDA 1DRVA 3GGPA 1LC0A 3JQ8B 1U3WA 4JP3A 4Z0HO 1C3VA 2NU9A 4RF2A 3E03A 5I7FA 3SJ7A 2Q4EA 1G6KA 4U6SA 5HBRA 1CDOA 3PYMA 4RLHA 1O8CA 2NWQA 4NH4A 1R4NB 2DQ4A 4ZRNA 4K28A 1Z6ZA 4DPLA 1H2HA 4YT5A 4AJJA 4D79A 3SBOA 4ZQFA 2P4QA 3PIIA 3H8VA 1J6UA 3AOEC 3O4RA 3OP4A 3TZQA 5DCYA 1NQTA 2SCUA 1R15A 4XKJA 1O5IA 4R1UA 2FRDA 4BNHA 3FTNA 2NV6A 4NI5A 1LDNA 1RM3A 4XIJA 3F1KA 3HJAA 2HRBA 4JP2A 2XAAA 4IXTA 3IC5A 1EUCA 4IXWA 4GKVA 5TF4A 3FTPA 2I6TA 4CUKA 1EVYA 1X13A 4R68A 2BI8A 3UUWA 3UF0A 4BKOA 3CMMA 5I7SA 1M6HA 3FPCA 3P19A 4GGPA 1DOHA 4CQMD 3ENKA 3RD5A 4LGVA 5DZSA 3X2FA 1JLLA 4EEXA 2XXBA 3HE3A 2UVDA 4K6FA 4WECA 4BVAA 3O03A 3IOYA 2C5EA 3S8MA 4FJ1A 4AJIA 3PQDA 5KTKA 3TRIA 2UDPA 3QVSA 3PDUA 2GUGA 1VE9A 2W8ZA 4GX5A 4BV8A 4PG4A 4Z3KA 1YL6A 1T2CA 3GNTA 5TRTA 1QORA 4FFNA 1NTOA 1Z7BA 2OOSA 1YB4A 3H9GA 2V6MA 2I5PO 1EBUA 1ENPA 1M67A 4EW6A 2YHIB 4CLRA 3LT1A 3R0IA 3KLPX 1U3TA 1PGJA 2HMVA 4CMIB 1HLPA 4FBGA 5EQDA 5G0VA 4F6CA 4TVOA 1PZEA 4OKNA 2ET6A 4D3DA 1OFGA 1D7OA 1VSVA 2PZKA 2IEDA 1ZBQA 2O48X 4DLBA 3PJDA 1E3WA 2B36A 2IZ1A 5IN5A 3RC9A 1R0KA 3KHUA 3B70A 1T1RA 3WQRA 2A35A 2P9CA 1ENZA 1C0PA
chains in the Genus database with same CATH superfamily
5CAEB 3PC6A 2QW1A 4LVUA 4DRYA 4DBVO 1WXFA 3LYLA 3QFHA 5LA6F 3I2IA 4WLNA 2WM9B 4QGBA 3GLGB 1Y9EA 4O5AA 4A3SA 1XQYA 2HKIA 1GR1A 2ZJ2A 1PFYA 1DWUA 2LCFA 4POOA 3WDLA 3C8HA 2B4KA 3D0KA 3MRSA 1KY2A 4HH3C 5IC4A 3NOOA 4EL5A 4DYHA 4WZBE 1UC5B 3O0TA 4CTJA 3KELA 4YCJA 2JLXA 1YB6A 4P58A 1X19A 2FHSA 1HEYA 1XAHA 2P0AA 1EP1B 2QJOA 4C01A 4MR7B 5AKGA 1LFDB 2CWDA 3BXZA 5P21A 1K3TA 1KZ9A 4IGKA 2GKOA 2PT6A 1M7HA 2H48A 4BV3A 4KZKA 2Z5FA 2DAPA 2JLRA 3QMVA 1U4OA 2OP0A 3QX7A 1OC2A 3RUPA 1L4GA 5HIMA 2ORWA 2X5XA 5A02A 1DJMA 2WIKA 3MBKA 3AKYA 4E07A 1I6WA 3ODPA 1EGAA 2CDBA 1T6ZA 3DZ8A 3WDSA 4RDCA 3WWPA 4DQXA 3OOHA 5D2CA 1XLVA 4NEHB 4IIYA 4B3JA 3MWYW 1D4AA 2WPDA 5D1NA 1LB1B 2P2NA 4C20A 1X3LA 2LUOA 2WLTA 4WKOA 2Z8ZA 4RF3A 4HLUA 1DZ3A 1Z25A 2Y2VA 4L50A 1YQ9A 4QO8A 4F4CA 4URVR 4RSRA 4D8WA 3GLSA 2QSJA 4N18A 4UBJA 5ERXA 1B74A 2V8BA 5JI3E 3NMUF 2P4UA 1FFXA 3KEMA 5JO0A 1RC8A 2PGXA 1V0JA 1N4AA 1WD7A 3B9PA 4OXRA 4XRRA 4YX9A 1ZJ4A 4JEUA 4Y8VA 4OV6B 2I6FA 1HNXB 1DCFA 4HDMB 2HJGA 1KDYA 5D86A 4DVGA 3GFBA 3GRCA 4JK3A 4UEQA 4P7BA 1ZK2A 1EGHA 4PFKA 1Y8QB 4UM5A 4B87A 1MR3F 4BLOA 3MWFA 3TLGB 2P5TB 2WYHA 3E22A 4PVCA 2FZGA 3O4HA 3JQCA 2H4WA 1NQAO 4RYLA 9ABPA 4CIYA 2P9ZA 1JDSA 4CM9A 5IULC 1ZJZA 3H1GA 3RAEC 5BUZA 3PTZA 4GBGA 2OFFA 1NU8A 3SDBA 3SQWA 3ADDA 1PJBA 5BNFA 1TXGA 2JF0A 1GCAA 1JR3E 3IEMA 1EFRD 3TCKA 2A1IA 4I1IA 3AP1A 2ZYDA 2VFAA 4AJLA 1JU3A 3IV7A 4JVSB 3R3UA 5I5GA 4LCJA 4WINA 5E6UB 3W34A 3ZXYA 2B83A 1BHSA 4YRCA 1K4YA 4ME6A 3INTA 4LI3X 4F4DA 1LK5A 1T6YA 3F7TA 3PT5A 3HK2A 4FMDB 1RWKA 1VJCA 2Y8EA 2J9ZB 2JKVA 2Z2ZA 3ZOKA 1SZCA 1E7MA 3OPVA 2A84A 4I55A 1J8QA 1AA9A 5AP9A 5ECYA 2IF0A 5JDIA 1NRWA 1TNDA 3NBZC 3KJIA 1JAHA 2YOFA 5DW0A 1WXDA 3AR8A 1GTRA 4PAWA 3BB3A 2QSYA 5FF9A 5GY7A 2G7ZA 1GKYA 1ATZA 2AJBA 2AH5A 3BIFA 4FYVA 5JS2A 5JMWA 2RI0A 1GRQA 4Q0MA 1JL3A 3CUSA 3FMPB 3E3MA 1Y1QA 4NU0A 5F76A 5H3CA 1OX4A 3SZGA 4FKMA 2W8BB 4G97A 3VPCA 5F2NA 4U0KA 4GOJA 3AM4A 2BM0A 4FZRA 3BMOA 4Q34A 3K09C 4RGVA 5HKBA 2FSHA 4FMPA 1CUYA 4KVZA 4X8MA 2ACVA 1X1SA 2O8BA 1F6WA 3O9MA 5IDYA 2QV7A 3R4CA 2QP3A 1PR2A 1U0RA 3HKBB 2ZVDA 3ZCPA 4II2A 4UUBA 5A0VA 3PCRB 2PRIA 1QIMA 1RAEA 4BE7B 5BY2A 2EV9A 3E7WA 3U61B 3I9JA 1V4BA 3IOCA 3C5HA 4IWNA 3R7DA 4WPGA 1DUSA 3NTUA 1RQPA 2HI0A 2ZRDA 3D4BA 2OXTA 1VCMA 2GXQA 2I6QA 2QL7A 2TRSB 3R3JA 2ZBVA 2HA3A 3EXHA 1M1ZA 4C4AA 1JW9B 4HYQA 4B34A 2B0JA 2XW6A 4HATA 5DEOA 1E2FA 4QASA 5DTMA 4X7BA 2QJTA 3UMSA 2C4HA 1JR3D 1GPBA 2E1PA 2PSEA 2TMYA 4HH0A 4HVCA 4H31A 1FYDA 3ADCA 1VTKA 5H3LA 2WYIA 3V80A 3GV0A 4E70A 4RA6B 3F5SA 4LRTB 5CT6A 2HA6A 3CQ9A 1XDWA 1NXPA 2FSVA 1KK2A 2Q6KA 2FLKA 1BXRA 1QIDA 3F5DA 2QAGA 4Q18A 2EKZA 2PUFA 1QFMA 2VWHA 2FB9A 3OJWA 2PU5A 3VPGA 2WSYB 5JZMA 4GQBA 4UVGA 4I1OA 4BGDA 1JR4A 4B6RA 4JKIA 2F4NA 4ZIRA 4FSHA 3VPXA 3LVQE 1VBKA 1NVBA 2VP0A 4RVSA 4IDPA 2C77A 2X5KO 2A0XA 4WXYB 3QFTA 3OJFA 1U2TA 1UMBA 5J2UF 1YDEA 1XWIA 4KLCA 1WG8A 1I14A 2CHVA 4LMRA 2V9ZA 4IDUB 1D0VA 2FSSA 1XF9A 1QZZA 5IW8A 3T5GA 1DX4A 4G85A 2CT8A 4ZEXA 1E4OA 1QGZA 3A8TA 4JXZA 4J0KA 4BIIA 1A2OA 1QLHA 4K9KA 5GV8A 4KPFC 4Y9TA 1KPIA 2V5VA 2VUHB 3DWGA 1XNQB 1LEHA 4PS0A 3L04A 5JRDS 1J00A 3HRIA 3N05A 1IJBA 2LNDA 3HMQA 4Q3DA 4UFNA 4BL5A 3H11A 4GXQA 2BHSA 4HMPA 4B6OA 3GAAA 3OZEA 5YASA 4IL5A 3V1UA 1RPZA 5HTKA 3DXZA 2D0DA 3W8NA 2EHDA 2JAQA 1RABA 3LXXA 4H15A 2CJPA 4Y7CA 1N0HA 5JXJA 5LNK6 3K0CC 2OO5C 3IQXA 5I4BA 2JFHA 4K6HA 4MVJE 2OCAA 3M5DA 4F3YA 5FKJA 4BCCA 1SVIA 1IIBA 1M2OA 5KTTA 5KI6A 2OAP1 5IBPA 1NYRA 3MHPA 2OQVA 1J99A 1FFHA 4LRXA 2BKUA 4TTJA 1KZGB 2IYWA 3C6YA 1QX3A 2BM1A 3CBQA 3Q6MA 4DA8A 1MPTA 2PNFA 1SOVA 5K4GA 3WZLA 3NHPA 2FVXA 1CJMA 3OFSA 3CW2A 1CTQA 1YVDA 2P2SA 3QVVA 5AVRA 1M8JA 4BXOB 2X6RA 2NUAB 1T2DA 1QYDA 3D3KA 4RNDB 2AXEA 2CVFA 3BTOA 4WNCA 2ZWIA 1EH5A 2WT9A 3MVEA 3Q6NA 3R3ZA 4KN6A 4YAIA 2BEKA 4O4HB 2VYVD 4EO4A 1ODFA 2VHJA 3KZKA 1ZXXA 5A7HA 3KKNA 5E3IA 3CNOA 1BU8A 2QQEA 3CXUA 1XR3A 4UASA 1USGA 4WOPA 1PDOA 1M8FA 2QLLA 2HMWA 4RDIA 1ZUD1 3W9SA 4AC9A 3N8DA 3ED1A 4DLPA 4ENPA 1MVNA 2LZ0A 3GFPA 5TB5A 1JQKA 2CUNA 3MINB 2CMHA 3K2EA 2PMFA 4ZEMA 5JASA 2WMNB 3QG5A 3TD2A 4IUYA 4MKZA 5CVCA 1CY8A 1OJ7A 2VXOA 1AXRA 3MG9A 1OASA 1A9PA 4WOKA 1EB8A 2RIPA 1VJGA 4A6DA 4M21A 3ZI4A 4ZKDA 4WBSA 1VL5A 3SHOA 2F8TA 1ORRA 4BTVA 4B4KA 3N7TA 3SX4A 4P4UA 1I7LA 3O95A 1S2OA 5DYGA 2Q9AA 3REOA 2CDRA 1V8PA 4FYPA 5BN1A 2DBVO 2AMYA 3RSLA 3ZZNA 1KP2A 3KT3A 5TQJA 4BVFA 2P4SA 3L1IA 1Z3IX 3JR3A 5A4IS 1HE2A 1US8B 1NW9B 3IVMA 4EPYA 2YVAA 4N6NA 4EFLA 3CLHA 1HE4A 1KC1A 1ORDA 2YDYA 1HE5A 3ZTWA 1ONBA 1GSOA 1DC4A 3Q2OA 3DDNA 4R16A 4N6OA 1Z2PX 1Z15A 8ABPA 3HVJA 1GZ7A 1T6NA 2K87A 3B5EA 3OT5A 4J43A 4ZZ1A 3GBPA 3H2ZA 4ZAVA 2HU8A 2RK4A 3MMNA 3HYSA 3B2EA 4UQOA 4XJVA 1U0TA 4NYIR 2V6GA 3FBTA 3R3VA 2AVNA 2H08A 1U2PA 4TL9A 1FP4B 1XQ6A 1O2DA 1NBMA 5HOEA 3EGIA 2W4QA 1PEKE 1K8YB 1N5LA 2JFQA 3LC7O 3MJHA 4MW6A 3EXAA 5AHOA 3PDHA 2V65A 2PUCA 2BTQA 4G41A 4I9NA 4INPA 5KWJA 4ZVLA 1NBOA 1T1SA 5CIYA 1AKEA 3LC0A 5DGHA 5BVHB 2IYFA 4U2EA 2O6HA 2DJ5A 2JJ2D 1WPGA 8MHTA 3VR2D 3NEAA 3KAJA 4QE3A 3JR7A 1NVFA 3B53X 5IABA 1JFLA 2C54A 1O6CA 4KIWA 4ZU3A 4DA4A 1D8AA 1EE1A 1Q7EA 3MAGA 5AVTA 3UFXB 3TLBA 1DCTA 5LZ7A 1GPUA 4ZPXA 5B36A 1HTTA 4LZLA 2Y27A 3OTIA 4XWKA 1KOLA 4JYBA 3KQQA 1JJVA 5AKJA 3GRYA 1BU5A 1QYXA 2PWAA 3H2JA 3DAOA 4Q6WA 5AT1A 1E1QD 5FJIA 4NCHA 2FPWA 3WYDA 3QENA 2E3JA 3U44B 3H2SA 2O7SA 5HZGA 3CUKA 4C0WA 3JWPA 2AT1A 2YV3A 2Q21A 3N8GA 4TS4A 3HDVA 1Q3TA 2R6ZA 3IAM1 3RO7A 4E32A 3KQLA 3ESAA 1CG6A 1G4HA 1IXRC 1JHRA 1HPLA 3E0XA 4KRFA 2VDMB 1KY3A 4GOOD 4YNBA 2AJDA 3L6CA 2UZ4A 4F45A 4F2HA 3TQTA 2XWJI 1C0IA 1LZKA 4W5HA 4U1RA 3UGJA 2OA0A 5AESA 2OGWA 1YZVA 2BEWB 2WWHA 5G0UA 3SSAA 1KNXA 1PKXA 2OTCA 2DKOA 3O4FA 5JDIC 3BHMA 3SSNA 2VZLA 1U1IA 5HZHA 4HGOA 2ZPTX 3OPYI 2XDQA 3QA9A 2Q5HA 4DCCA 1RYFA 5CB4B 3N3BC 4KJXA 2F3TA 1AB6A 2G07A 2P5SA 3A1EA 1Y6GA 1BA3A 1F5NA 4O63O 3OMXA 3U9LA 1OYWA 3LUKA 1GA6A 3QJGA 3W8FA 4EZIA 4DRZA 2ZCUA 2QL9A 4PLGA 3R7WA 1S3IA 2ZU0C 4YMLA 4YCNA 1ZSVA 1MJNA 5ALGA 2JGLA 2VQ6A 5EPOA 1YFLA 1RI5A 1EX7A 4PRZA 4TZ0A 4AKSA 3U60B 3FCSB 1IQUA 1L5NA 3WWZA 3FLEA 5TDHA 3VTZA 1ESMA 4WUTA 3BWDD 1QF9A 3MCVA 2Z58A 4KKVA 3NKVA 1Q0HA 1XQWA 1MABB 2QAGC 2BGNA 3BL5A 4JSTA 3LQRA 3FVTA 1W96A 3KFLA 1FNNA 4I6EA 1TMGE 2QYSA 1GJRA 2ZJFA 4GZMA 1R16A 1XPRA 4F6RA 121PA 2GZ3A 2JI6A 2SKEA 2A92A 4H0CA 1B00A 4OBXA 4LXXA 1DWPA 4QNRA 5BNTA 2JCBA 1D5CA 1CIVA 3BQNB 4DEVA 3TZ6A 1T1IA 1U8CB 1IUKA 1F2DA 1QIGA 4OQEA 2J46A 3MQ4A 5BW6B 4HZIA 1PFQA 4F5ZA 5T67A 3OIFA 4IDAA 5EJ5A 2O2JA 3PUYA 5AW5A 1JPVA 1EAMA 1MRZA 4HQKA 4IBOA 4JQSA 4PSDA 1SOMA 3FTDA 3H1PA 1QWOA 2NO9A 5DWVA 4M7RA 4H08A 4NENA 4V24A 4BZXA 2V1UA 2RSLA 1WDMA 5C4GB 4E33A 2P75A 1Y3HA 3DZIA 4OVKA 3GEGA 5AW0A 3IPRA 1Q1ZA 1JVBA 4EG5A 3TMAA 2J1LA 2I2XB 4NCKA 5F12A 3UQZA 4A4DA 3OCYA 2QTNA 5IXSA 2J3HA 1D4ZA 4G09A 4EMTA 4GLLA 1FYVA 1PO7A 4KAFA 2AE1A 4DXHA 4F97A 3IBCA 1WLSA 2D4AA 5ALLA 1PYOA 3LQ4A 4OL9A 3WAKA 1TCBA 4AQ7A 2Q4DA 1LX6A 4D81A 2HW8A 2QD4A 1AUPA 2IYSA 1P5JA 2P2YA 2OXIA 1RVV1 4AG6A 1M6NA 1IHOA 2ZT6A 3VR4A 5B6IA 2CFIA 1E6LA 3P2OA 3T1YB 3E6AA 4IUCS 3DVQX 5B6JA 1IUPA 1EWVA 3B5IA 3BMXA 1UPCA 4BX9A 4H7JA 4EENA 4BVJA 3KE8A 2AYYA 4OY3A 1WW2A 1UT5A 2ZWAA 3SM3A 1H23A 4LJ6A 4UJ5A 5JNWA 1SKBA 1XTKA 2FA9A 221PA 3X2EA 1J24A 3DW1X 4EMSA 3VU3A 2XT0A 4HN9A 3HM9A 3T5BA 2E0IA 3KT0A 1W5BA 4H16A 4PZZA 5CYPA 3GU3A 1ULAA 1U1CA 2IDJA 1CJTC 1EFVA 1O96A 2QUAA 1COWA 1JZSA 4I7EA 3CE9A 3TRKA 4A2CA 2PZJA 1P6UA 4FZ3A 4S3MA 4RULA 4X65B 1GTL1 5JSZB 3OUUA 2JZNA 2NTEA 2G1KA 4PLTA 5B3JA 1VKOA 3KQWA 5KC9A 2FPSA 1QB8A 3RSGA 4L9RA 3D1LA 1C3JA 3LPCA 4HDCA 2DLNA 4L0DA 4MRVA 1G8GA 1FFGA 1I3OA 1USVA 5T4HA 2QX8A 3BM5A 1XEAA 1KMMA 4W99A 3AKDA 2D2EA 2JIOA 4AZWA 4J2OA 2JFPA 1NU6A 5C46F 2V7GA 4OK5A 5D8DA 2Z2KA 3P9XA 3TEFA 1AZWA 3MTEA 3PFCA 4GUDA 3IL2A 2R1TB 5AOAA 4PN7A 1U1FA 3V34A 1KAQA 4CBVA 2I29A 4MWEA 3WC4A 4CLOB 1HTWA 3ETLA 1D2GA 4UHEA 4HDQB 3R7FA 5FTKA 3IDZA 3OZCA 1XTQA 5DO9A 2QRKA 2QTWB 3E7DA 1H1DA 3F9RA 4ZVNA 2W90A 3TZLA 3WKCA 2WD8A 3DP7A 1AOXA 3EGDB 2ZWMA 1BH6A 1JAIA 3NIWA 3T4EA 4FB4A 2VNHA 3HCNA 2ENWA 2GCOA 1C1HA 3L7LA 4YMSA 4L8GA 5KDOA 1O87A 2YYSA 1UAGA 3UHPA 4E1VA 1YUNA 5D3MA 3T9AA 1XD8A 2H31A 4FHFA 4LYFA 4OQXA 4AMYA 1PBTA 2YH2A 4YUWA 1BWSA 4UUQA 2I33A 4FDUA 3ZS9A 4RK4A 1W19A 5E7MA 1T0BA 4Q4HA 1OX4B 1AQJA 3THXB 1A4XA 2IS2A 3OQPA 4KN9S 1AZTA 5D84A 4QBGB 5EUBA 2NP7A 1UBOS 2ZT8A 4DLWA 5K20A 3UC5A 4Q1CA 3T7DA 3ZE9A 1YS6A 2B2NA 3FVRA 2O8BB 3KEQA 2COEA 5DW3A 2ZI4A 1P9OA 2R84A 1W88A 5EHZA 2GTIA 1BOFA 3L8MA 1PZXA 1U2GA 1H94A 1PX2A 2FI1A 3KC2A 4XWGA 1ADCA 2BI4A 4HL6A 621PA 1C0KA 4YAUA 5TT1A 5EJ6A 2Y0PA 1AHNA 1CJSA 1PHPA 2DRIA 5AK4A 1TM5E 5C3UA 1QIJA 4Z1MA 1CFZA 1N3YA 1RYEA 4K9OA 4W5TA 3GGSA 4W9RA 5CYOA 1JG2A 1XKTA 1MHTA 3IT0A 1A8UA 5J5VA 4ZGGA 2I9KA 4W4TA 5KJ1A 1ZI6A 3H19A 3Q1KA 5CPFA 4B35A 4CF3A 2GYYA 5LYJF 3QY0A 4BHHB 1QHHB 4WI1A 1QHNA 3QUBA 5FBWB 2I6GA 1GGMA 2X6QA 2KB0A 4HNAB 2GHQA 2L19A 1WVMA 2XOEA 3B9RA 3VPSA 3MHTA 1ZD9A 2FWAA 1D0SA 4M1EA 3VH3A 1V8OA 1AKVA 3GDGA 1KY4A 5TVKA 4P82A 5L4SA 1ZX1A 1KS2A 4YMVA 1Y6ZA 3JSXA 4E6EA 1Y9AA 2HCFA 3QWHA 2J4CA 4JL6A 5K09A 2F1OA 2ZAOA 3UAZA 2QMZA 4YUVA 2YL2A 4B4VA 4BO3A 1Q7TA 4YXWD 2J33A 2PA0A 3SS8A 1FFDA 3VYVA 4NBWA 3Q3VA 4ZOBA 1TUEA 4CHTA 1NP7A 2C0CA 1NUTA 4HTFA 3BBLA 2Y99A 3BGOS 2Y0CA 3L6OO 4I46A 4WY5A 5HG0A 3RF6A 4KO4S 1X0VA 2RGXA 1UMBB 1C4KA 4GR4A 1I1QB 1ZONA 4D3SA 4C88A 5JS7A 1UDXA 4YLEA 1KSHA 2O19A 1QV6A 1RWXA 2C2WA 4MZXA 4XYGA 3QI2A 5EXPA 1ACJA 4BNUA 2J3MA 4ZP1A 4GS5A 4ZHSA 2X3UA 1SQFA 2X4GA 4P4SB 1U2RA 3GGDA 2JFVA 3M5PA 4MHOA 1GPWB 1N6KA 1WULS 3UHAA 4YQFA 3CSDA 3DYBA 5DHPA 4E08A 4K6OA 2YWRA 5CEEA 4LUCA 2CDAA 4J0GA 3JVEA 2NO4A 1ZN8A 3KXKA 3T5MA 1T6XA 2OCXA 3TJRA 1SC6A 4B3GA 3PXEA 3TE6A 3I37X 1DEOA 4MKHA 5C32A 1PWHA 3P4UA 1L3CA 4G0QA 4TYNA 1YDFA 4EA9A 3G0BA 2HTFA 3IXQA 2DU8A 3IYLW 3ZHBA 1E98A 1H4QA 5BSRA 2ZYWX 2BH9A 3EY9A 2G70A 3TLJA 1G5IA 1A5AB 4PYRA 2VQSA 1UJ5A 3IP3A 1M2VA 3PD0A 1V9SA 2GPBA 1PZMA 2PWPA 5DJ5A 3RVBA 1Z8HA 1ZW1A 2TMDA 4AL4A 2G0TA 1PEYA 3L79A 3FMIA 5JATA 3HS3A 1I30A 1OX5A 3A1VA 1UXHA 3PQ6A 3CLRD 1HFJA 2AEMA 4M1OA 1XAIA 2DSTA 2HLNA 2JK0A 1UFOA 2W22A 4A2WA 5KSZA 4EDHA 3RYFA 4IZ6A 4NWIA 4U02A 5AJXA 1F0YA 3MC1A 2QW8A 2GN4A 3TW6A 5E2AA 3PGVA 4H6WA 2FOLA 3OEED 5CJPA 2NZVG 3CRQA 3H0KA 1NY6A 5JWHA 4DN6A 2VAWA 3T3EA 4LDRA 4JDPA 3VOSA 4MW1A 5F51A 3AUYA 4QFBA 1I33A 3K8OE 2ONCA 1UBTS 2XY4A 3L0BA 3CNQS 4IIVA 4NAVA 1EHIA 1SU8A 5AUPB 2WTAA 3ZKWA 2BISA 1VYHA 4CKWA 1VG8A 5K6AC 2FZKA 2IUFA 4N40A 3MJEA 3JWHA 2P6OA 3G8DA 1FVXA 1PFKA 3NFRA 4X44A 3RIMA 4YT4A 5LIPA 4KR3A 3KR9A 4RL6A 2A59A 4FGJA 3DGFC 3MXOA 1QYRA 4BWVA 2Z56A 1TMKA 1UBUS 2FPGA 4JYAB 4H7HA 2GESA 1HDOA 2UYHA 4URWR 2QXYA 5JCJD 4QFDA 2V7PA 4CTMA 1DAOA 2PX6A 3E8SA 5EQFA 5EMJA 2HMSA 3DZFA 3RJMA 1EP9A 3S44A 3KDAA 5GOZA 2CJFA 3CTPA 2CFRA 1I4TD 4FR5A 3KSMA 4MQ6A 4PGAA 3R7AA 3IRUA 1Q12A 1JNXX 3ZHZA 4A92A 2FCRA 1WBJB 2QGFA 4H4DA 1RZRA 2HO5A 5EJFA 2G9NA 1A71A 2XZLA 3NC1C 4YJ3A 3ZU4A 1S02A 2BFEB 1MAAA 2QNBA 4XIIA 5B3JC 3W04A 4NDAA 1U9IC 5KYNA 1FE8A 1FFEA 1LDMA 1U94A 1HLDA 1XJ0A 2RJOA 3FN4A 3NAZA 3ND9A 4HDNA 3K9CA 2BGLA 1SC9A 4WKBA 2OAGA 1J21A 3RJ5A 3K70C 4BAZA 2OM2A 1NP6A 5GADl 3QBEA 3CXRA 3O94A 1CUCA 4EI7A 4OHZA 4G84A 4PTZA 5IKXA 1K75A 1CUGA 4Y6LA 1Y3FE 4RK0A 5T8KC 3RVOA 4BMCA 2Q5CA 3LS2A 3LY5A 3EVNA 4EL0A 4R9VA 2A94A 2V54A 1ZSYA 3WYAA 1B16A 3PR2B 2W43A 1C4OA 4CV2A 1NVKA 2DUJA 4ZRMA 1XAGA 4S24A 1QH9A 5KAMA 3SS7X 1X38A 5KVVA 2O0KA 4YXFA 3ILHA 3HYTA 4IMRA 2BBWA 3GEDA 3TPFA 1V6CA 1CPYA 1JIVA 4XWOA 1JHVA 1KI7A 5AUQA 5TNXA 5ED4A 1IOWA 1GG5A 4GYYA 4YJ2F 2Y1KA 3BIOA 3CRVA 3AILA 2WSLA 4EECA 5DE3A 2WWTA 3TLEA 1MF7A 2ODEA 2QV0A 3PDIB 3C16C 4LWZA 1EQ2A 3WLIA 1P73A 1D6NA 3SI7A 4WV3A 4DHEA 2H9IA 5INTA 2JAXA 2ZK7A 2NTNA 3G1WA 4X0EA 3QWIA 2VA9A 2ZJZA 4XH9B 3UJ7A 3IX7A 2CMDA 5KMGB 3RE1A 1Y81A 2P9GA 1W93A 1VI6A 4ZHQF 1H5UA 4C6TA 2PTHA 2VSOA 4GBED 3UXMA 3ETDA 2ZYTX 2X4IA 3AUUA 2H1CA 2OWDA 3QTBA 1U8TA 3MSXA 3K5HA 4Q12A 1WB9A 3AVUA 2WJHA 2O2GA 1S4QA 4H77A 3ULKA 1HY3A 1MLDA 3AF5A 4FHDA 5EJMA 3D8SA 2DFTA 4Z54A 2PRKA 3KU4A 4GPD1 2FR8A 3CLTD 4K2HA 5CFQA 1Q16A 5JAOA 2R6DA 1PUJA 1WR8A 1ID8A 2NV2B 4ALMA 1DKRA 4LFCB 4EB3A 3SQOA 2ECQA 2VDKB 1S7CA 1SA0B 4MS4B 4CLEA 1FDIA 1L1RA 2BHTA 3B3GA 4G65A 3THSA 2WTUA 2EEPA 1QG2A 3Q0IA 3RCBA 2C92A 4IH4A 1DX6A 4GICA 4D4KA 3IO3A 2XMGA 3L8CA 5C8VA 1II0A 1OJLA 6LDHA 1OBOA 2ZTUA 3PFIA 2BGJA 1Q3KA 4I1UA 4ZVKA 5A6SB 1FJXA 1IU9A 4BNWA 4PYQA 1YB2A 1T8YA 5IDQA 3E7XA 4B3DA 2FSPA 2ADMA 1VIMA 3LXRA 3RLIA 5FLXA 1ZFNA 2PV7A 2XYQA 5K99A 4DL9A 2DTXA 3A6FA 1OOEA 4NC9A 4BO2A 3D6UA 2H7YA 4KXMA 4LX8A 3WJAA 2ZCJA 4GPTA 3K2BA 3ZZMA 2V6JA 4JS0A 2W6JA 1XMQB 1RRMA 1LRJA 3GIWA 4U3JA 1GRVA 2E48A 1H3FA 2JVIA 3N76A 3K53A 3RFTA 3HZOA 2PO5A 1PJRA 2R7MA 3JSAA 3UCEA 3WV4A 5JC1A 4N7BA 4Q03A 3B78A 1RADA 3AKCA 2LCQA 1R12A 1Z9BA 1LSSA 1DAEA 2EOAA 1E66A 2X8LA 2YUIA 3C3XA 3EFEA 4GO1A 5FPQA 4JUBA 4EHDA 4OQYA 4RMJA 3UBTA 1B42A 1B8UA 2GMWA 2WIBA 1SBYA 4OH1A 1NJSA 1K98A 4MUKA 1UOQA 2Q4TA 3ANXA 1O54A 2FWPA 2VSYA 1OPRA 3G2QA 5K0LA 1Y4DE 5LMCA 1JE1A 1IBKB 2W2XA 1IIRA 4EGQA 1HC7A 5B7NA 1KBOA 1M33A 4F8YA 1CEYA 2FYTA 1XYYA 4TMKA 4FMDF 2L18A 3T95A 3WO0A 1TUGA 2ZSFA 1F6DA 2P2LA 2ZR7A 2IDMA 3B1VA 4JB8A 1ECLA 4MQMA 1R37A 4IH1A 3AW9A 4KR2A 1RJDA 1YHZA 3QLUA 4MCAA 1I2DA 4FSXA 2IF2A 4J7UA 5IMBA 4CKYA 4ERXA 1BMQA 3Q7RA 1ZL2A 3QLTA 4OP2A 4QXMA 4KMOA 4TN1A 5KYUB 1XHFA 3ZDFA 2L42A 3G88A 4KTTE 3SZRA 1Q0TA 1L4HA 4G4SP 2CMKA 3U0VA 4UU1A 3VYSB 3R9XB 1NJFA 3IOBA 4PLCA 3MQFA 4LHZA 4KDFA 3UGQA 1SR8A 3RV3A 5HMLA 1T8WA 4E46A 3BK1A 1RMTA 5F33A 1NUSA 1DAGA 5CEFA 2H4ZA 1KR5A 1ZSNA 1IJFA 4PSUA 2RCNA 4KU4A 3HJCA 2OENG 1OZHA 5DGTA 5LP6C 3ILSA 1G8SA 3A9SA 4LQCA 4YMIA 4Y6GB 2IH4A 3OD5A 5FEMA 3TECE 3SZUA 1N3LA 2Y71A 4DEXA 1R6VA 4OXKA 3RBAA 1USKA 2C00A 4KX5A 3RWBA 2H2GA 4HVAA 4CMKA 2B1JA 4DMRA 3KXDA 4Q7JB 3FCOA 1GV1A 3FSRA 3VRHA 2ASEA 2AD1A 1FYFA 3CEPB 4AZSA 1DQYA 3DBLB 4OM7A 5AYVA 4N3CA 1U11A 3ADKA 3BX1A 2F7SA 2C94A 2RJNA 3G0HA 4C4TA 1VXRA 3DKVA 4UULA 1QYCA 4ZYLA 1KC3A 1OI2A 3HKBA 3A58B 4B43A 3HJFA 4QL3A 1UJ2A 1E2EA 2X14A 4U5XA 4XFKA 5HKKD 4GP7A 1OFHA 4S04A 4URZR 3B3QA 3CKMA 3RS8A 4B6FA 1XX6A 2HK9A 3AYZB 4HDKB 4YUXA 1E3QA 1UOPA 3LQYA 4UUOA 1YOVA 2IVZA 5B6PA 4FFSA 2EX1A 3UMFA 1SKYB 3ROXA 1G63A 1JEQB 3ZQKA 5BW8A 2P77A 2V97A 4QUAA 1O4WA 3GZ4A 3O91A 2ZRQA 5HIKA 5A1JA 2B37A 3FJYA 2XCOA 3HN2A 3RIGA 3VI4B 5A5GA 1KQGA 3C3CA 4ZALA 3IKVA 3QIVA 2YIMA 4KXYA 2VTDA 3ZWOA 4J0IA 2CMFA 5TXGA 1YZKA 4MQLA 4CLDA 3HADA 4N82A 2GX6A 3JD0A 4DSUA 2HJVA 4GKJB 3KL4A 3AESA 1SCAA 2G5CA 1DT3A 1RI3A 2OKCA 1XQXA 1B1CA 5KIAA 3KOXA 1CY1A 1ADBA 4U7WA 3R40A 2EKLA 4RBNA 3PNQA 1RQXA 3C6QA 4M4SA 1CETA 4XD7D 2WILA 1V11A 5FOUA 1ZA1A 1AO3A 4PC3A 3DL0A 4GPAA 4W9NA 1PU2A 4TT3A 4DDWA 2Z5LA 3DYVA 2OLJA 3SQNA 2WZQA 3FPEA 5JC8A 1HFKA 3TR0A 1T0JB 2GOYA 1KMIY 3IJ5A 2FUCA 4JUDX 5EKSA 4ADSG 2J0SA 2ADOA 2V58A 3J81A 3I01M 3P5BA 5EKDA 4FCCA 4LHWA 1FRNA 1R0YA 2Q3EA 4ID9A 4YP7A 3AFNA 4B7CA 4DNFA 5DX8A 4BJ5A 2D8MA 2ILTA 4Y1RB 3PG5A 1IVNA 3Q3IA 5HJ5A 3OEHD 4KOAA 2AJTA 1M2WA 1MJGA 3LSTA 4OAQA 1RI2A 1MD9A 5AXBA 4ZZ2A 5TSDA 4V1CB 2XE6A 3H8WA 5IT9A 4IQGA 1DJPA 5K0ZA 4WJZA 5BYAA 3LBYA 5FORA 5A2QA 4J07A 4OUDA 4R9SA 5ICGA 2ZE8A 1CP2A 5IN4A 2QQGA 4ZN6A 5T3YA 3HA3A 5EUMA 1E2DA 1GG9A 1K2VN 1QV7A 1OHHA 3IPYA 4BX0A 1XVIA 1CC1S 2QN2A 3WY9A 2DLCX 1E2NA 1G0NA 2YVKA 1CUSA 3FDJA 4KPUA 4URHA 4YMGA 3KDPA 2ACWA 4G1MB 4A6XA 2JAPA 2V98A 1B1AA 2GAAA 1A7UA 1XL1A 1M2OB 2EP5A 1ODLA 2N9UA 2WJ3A 3GHHA 1E2PA 2Z04A 4PYOA 4Y9UA 3TIIA 5C80A 2CXXA 2FJUA 2RHRA 1KEVA 1QX4A 2WB2A 3EX7C 1XBTA 3PJEA 4BFSA 3EEOA 4BJ3A 2ZW9A 3TUJC 3LX4A 1AT1A 3EZ6A 4HTFB 2DETA 3DEKA 3SE7A 4U6NA 5D5QA 1TF2A 2ZVPX 4NFHA 5ICCA 1YS9A 4OLHA 2IOQA 4PBRA 4EABA 4TROA 3D59A 2NGRA 3NI2A 1Y8RB 2CXTA 3M4XA 3SC3A 3KLBA 3V1NA 3E53A 1CD5A 1Q74A 5T6MA 1BWRA 1NA5A 1L6IA 1Y98A 3ASVA 3COPA 3NTLA 4IEEA 4JU9A 1GTVA 2I71A 4AO8A 1JAYA 2GM5A 1KEUA 3LDFA 4LJ7A 3REQA 2QY9A 4BFCA 4NBTA 1L7VC 4JWTA 2YNMD 3NNNA 4FW8A 1E2BA 4M1SA 3OM9A 4BRSA 1TIPA 1QJ4A 1O9GA 2W00A 2AW3A 3TPCA 3FF4A 3IHKA 1FPQA 5CA0A 3FWYA 3DH0A 3RTAA 1PR3A 5CDFA 5AVVA 4D43A 2I87A 1SIBE 2YHBA 3SZOA 1A5ZA 3GX1A 3OJLA 4P6VF 1MNAA 1J0CA 2CHQA 2QLMA 3EXG2 4XUGB 1M34E 1TRHA 4G9EA 3MOSA 2AZDA 2UUAB 1FTGA 4RE6A 1WDWB 4PO8A 3DVAB 3ZHTA 2OPBA 5L6LB 3CVXA 1G8AA 1T2NA 3CJTA 4ES6A 5K8CA 4G0VA 4EYGA 5JFOA 1BMTA 1VOTA 3A6DA 5TV2A 5JALA 2BGWA 4RF4A 4QT4A 1A1VA 4WK2B 2RONA 1SB8A 2FMFA 1FS5A 2IGBA 1L0BA 1VHWA 3AH8A 1OC4A 3DEYX 4PLWA 1LTKA 2IEYA 1TD1A 4UTRA 1NFRA 1EBBA 2DMRA 1O94C 2C9MA 5I8ZA 1QDUA 3UAGA 4X1YA 2FPMA 4KYVA 4MA4A 4FFVA 3AB8A 1KE1A 4AKTA 1IDOA 1JHYA 1MOPA 2BGKA 1Q2XA 2PR2A 4NDNE 4YUAA 2VP5A 2B4RO 1DG1G 3JD2A 4NBLA 4UU8A 2CV0A 4LZWA 1T3LA 4B2YA 2CUTA 2OAEA 3LFTA 1CHNA 3OPQA 1EG2A 5C34B 4RWZA 3GH3A 3PPWA 4DA9A 4KGXA 4YJDA 5JYBA 3WLOA 1G42A 4L8YA 5DX0A 3PVZA 2G28A 3PXCX 4J3JA 1FFAA 5JEEA 4UREA 1EBFA 1C4WA 2AFHA 2IYXA 2XNJA 2XTNA 3G5UA 3WGGA 3L05A 5I9LA 4AF8A 1WZIA 2QPLA 1WZCA 3CKKA 3DMYA 4RVDA 5FYDA 1ZR4A 4QUGA 1DEKA 3VVCA 1QUEA 1XAJA 3DVSX 1O8BA 1NKTA 2EX0A 2QQ5A 1FRFS 3DLHA 3IOEA 1VHQA 4J16C 1NF2A 4JVNA 2XRZA 4I1SA 1X1QA 3VHXB 1U2DC 3ZWAA 3DJFA 1NONA 2XEXA 3JW8A 1Q0SA 1M75A 2XSZA 3SYTA 3G6WA 3CUYA 5FL3A 1DUIA 1K92A 3T5AA 1PV1A 1UQUA 3RVKA 3BSSA 3QUQA 4P53A 5EMKA 2BYTA 3TTSA 2DFKB 4FW9A 1ZH0A 2GKGA 2PYDA 3H9CA 3LL4A 3SYMA 3DA8A 3NVAA 5F3DA 5BORA 2O1EA 4BKRA 1FJGB 4NY1A 4UHJA 5DLYA 1WW8A 3UT5A 3TFOA 1Z6PA 4QQRA 4EIWA 4RK7A 9GPBA 4YV1A 4QRHA 1GEEA 4HDNB 4IDGA 4AMGA 2W2MA 3TSCA 2O1SA 1LPNA 2ARKA 3O8LA 3SYNA 1J0BA 3O8RA 3LTNC 2YIJA 2ZR9A 4AJPA 4FC7A 5I4IA 4QYIA 2ZYSA 5ANRB 1JDTA 3H5TA 4GMFA 3VR3A 5KQLA 2AFRA 5D87A 4HEA1 1P1FA 2R4UA 5HKAA 1EDOA 2X0RA 4R1LA 1R9GA 4FFOA 3W7AA 5B2EA 5AVXA 3KPWA 2WJZB 1QUFA 3MWEA 3VU0A 1RCTE 1KZ1A 1NOIA 3KXIA 3R7WB 1NR7A 1XMPA 3U5ZB 2HK7A 3Q5DA 1NG1A 5MGBA 5A04A 4YXWA 4YYEA 4BQPA 2WOJA 5HE8A 2WWVD 3PXUA 1YRHA 3T7CA 2GR9A 4GPBA 2C2XA 2ZTHA 1V9LA 2EP8A 4MP3A 4CMJA 4TYYA 2WF5A 4ZMRA 4B3IA 3B1ZA 1IVYA 2GBGA 5E95A 3QE3A 3TX2A 2WPDD 4R9RA 5EJ8A 1GDTA 2FZ4A 3DTVA 1XPOA 1XZQA 3S70A 1E7YA 1U0LA 1RYMA 3MRVA 5H7XA 3H16A 1IZ0A 3ESCA 5FULA 2IE0A 1QQAA 2GRAA 3SZ3A 3F3YA 1S89A 1RE0A 4F6RB 1SUPA 3I23A 3CJRA 4MLCA 2WU0A 4B85A 1CR0A 4LHSA 4C6TB 1TEZA 2HIHA 3LT2A 4BU0A 4CCYB 3HLTA 3LHKA 4FYMA 2C8LA 2WJ4A 5E8RA 1E9RA 5LIRA 2FPXA 4L2IB 3ZNNA 3RQSA 1Y37A 1ULSA 4H3KB 2Z3ZA 3EH2A 4OXYA 4PZ9A 2KBEA 4PINA 3ZWPA 2W6NA 5IAGA 1KKLA 1UMKA 3LY8A 1QOPB 5IF9A 4TMTA 4HFMA 1RPNA 4I5DA 5BVGB 3UUFA 3GUHA 2QL6A 4MULA 4JMPA 3MD9A 5F4BA 3CEAA 4QO7A 5A3JA 2X15A 2OESA 2ZUVA 4MS4A 1R5OA 3CRMA 1RYZA 3MBIA 4NU8X 4WK6A 2Q07A 3VKWA 1RU3A 5JPCA 3MLEA 4GRIA 2BTOA 4C0LA 3MT9A 3U09A 1P2SA 4AJ4A 2QF7A 1DCKA 3S5UA 5IZ4A 3WHKA 1FRQA 3KEOA 3PTLA 5G2OA 4X3CA 3LOPA 1VB3A 4J9VA 2VTBB 4RORA 1KEKA 3C3JA 3QFSA 3X1DA 4ANFA 1WKVA 1T36B 3KR1A 2DT8A 4F1WA 2EWMA 1NXVA 3D8UA 3V4LA 3UHOA 3KKLA 4PSKA 3W9UA 1HL7A 2ZI5A 1P2GA 2HT6A 3KZXA 5EGNA 4DRXB 2YZKA 5CDSA 1OWLA 4AW9A 4BMNA 4IXMA 4OK3A 3I2FA 4COKA 1LLQA 2BE9A 1PZHA 2FPIB 4GF5A 2VJYA 4JASB 5T5QA 3DBOB 2GPYA 3ICQB 1I4WA 3MRTA 3DO5A 4LNHA 4EI9A 2XZPA 5ALNA 1KFCB 1W1WA 3LCRA 3FHLA 4MWOA 3SYKA 2FR8C 4EHAA 2OEPA 2XNSA 3W77A 3GJ7A 2NSDA 2UUPA 1ULZA 2JCYA 1HDRA 1ODTC 3OCCA 2NN3C 2Y2UA 3ZV5A 2F9LA 2O3QA 1J07A 4HFNA 1MW9X 4Q02A 2GD2A 3M4YA 3CZ5A 4OX9B 2ZRMA 3VJLA 3ABIA 1DXHA 1C7EA