2GNBA

Edta-treated (2 weeks) p. angolensis lectin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
240
structure length
237
Chain Sequence
EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin
publication title Interplay Between Metal Binding and cis/trans Isomerization in Legume Lectins: Structural and Thermodynamic Study of P. angolensis Lectin.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 50
structure length 237
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2gnbA00
1WW6A 4PBOA 1AXZA 1FATA 2CWSA 2FMDA 4FPCA 2NZ9A 4LBMA 2D44A 1J1TA 4Q26A 4Y26A 1LOEA 3PVOA 3V0AA 3AYEA 1LOFA 3D6EA 1V6OA 3RQ0A 5DZGA 3NV2A 1Z0HA 1GZ9A 1SBDA 4M3CB 1ONAA 2WT0A 4P14A 1H9PA 3VKMA 1EPWA 4YW1A 1FYUA 1W6OA 1APNA 1LJ7A 1WD3A 1DZQA 2FHRA 3A0NA 3AYCA 4TZDA 3POSA 4RL7A 4K20A 5T5JA 1QNWA 3TAYA 1QOSA 4FPYA 1N3OA 1RIRA 2SLIA 4DPNA 4AVVA 4YZ2A 3MW3A 1SLTA 3INAA 3LSEA 1YRZA 4CRQA 1DQ6A 1FAYA 1BQPA 2AYHA 1FNYA 2C5DA 5DZEA 2D6MA 2B7YA 2DWRA 4AYUA 2ZAAA 1LULA 1DYPA 3V0BB 1TEIA 2DYCA 2ZGOA 2A3XA 5FREA 3WZ1A 4BM8A 2DVAA 1LGBA 2ES3A 1OFSA 3FFZA 1MS1A 1W6QA 3MEPA 5E88A 4R9BA 1PZ9A 1SBEA 3WDWA 5HCBA 4Q1RA 3ZYPA 4XIKA 4ISQA 4U36A 5KXBA 3ILRA 1Z78A 1GNHA 1MZ6A 4BPZA 1S0JA 2E6VA 3AZXA 2LTNA 2SBAA 5H9SA 3OPZA 4FPGA 4YM1A 4YLZA 5CBLA 2WLQA 1ZA4A 5T5PA 2VXRA 1UX6A 3I4IA 2GN7A 4JC1A 5LK5A 1G9BA 1X50A 1C4RA 5HCFA 2WQZC 1V6NA 1GYKA 2AUYA 4YGEA 4XXAA 2YV8A 3A0KA 4FOWA 2V5YA 3USUB 1SLBA 3LCPA 1N3QA 4K1YA 5KXEA 1VAVA 2W68A 1Q8VA 1LU2A 1AXYA 1CPMA 4XE9A 4UW3A 1GLHA 1S0BA 5IUQA 1G8WA 2JJ6A 3ILFA 1WLCA 4Y1VA 4ISRA 2JKBA 2UWAA 3ZXKA 2DVFA 1CESA 2ZGKA 2GNMA 3R4UA 4FPHA 2ENRA 1LCLA 4C1WA 1MACA 5JOYA 1YYNA 1D0HA 3ILNA 4LBNA 1SLCA 2DUQA 3AXDA 4YW2A 1UL9A 2WT2A 3WCSA 1AX2A 3VKLA 2GMEA 3SNMA 1O4ZA 1F31A 2D7FA 4AGRA 3BOPA 1MS0A 3TB0A 1F5FA 3IPVB 1GV9A 5GLWA 3AXEA 2A75A 4YGCA 2NP0A 1WUVA 4YGBA 1DIWA 2JE7A 2YY1A 3T1LA 3AZVA 4BMBA 1H30A 4U2AA 4GWNA 5IK7A 3W59A 2ZGTA 1C57A 3APBA 5T54A 1QKQA 2KM2A 1ENQA 1QOTA 3SH4A 1VIWB 3AP9A 3ASIA 3VUOA 1UAIA 5GM0A 3PVNA 2ZHNA 3VV1A 5GLVA 1MR5A 4FPEA 2I2SA 2EALA 2PHFA 3FLRA 1ULFA 1LOCA 1ENRA 4XBNA 1IS3A 2RHPA 5GLZA 1MZ5A 3ZXEA 1AX0A 4BOWA 1GZWA 1G7YA 4NO4A 1W6NB 2ZA9A 1S0EA 3AYDA 2PELA 1BKZA 4UW6A 1C1LA 2E51A 5GLUA 2PHRA 2JDZA 3AJYA 4FPOB 1WBLA 2WJSA 1QOOA 2ZGSA 4R9AA 5CB7A 1KDMA 3SH3A 1IKQA 4DS0A 1CN1A 4YM3A 1W6MB 4XTPA 2P3IA 3N7LA 3VKFC 1Q8QA 3WCRA 1JYIA 1V6MA 1AZDA 1R1ZA 4Y24A 4Q27A 2ZGNA 1QNYA 3NV4A 5JOXA 2UU8A 2YMZA 4XJUA 4AVTA 3WUDA 4BMEA 5F9TA 5JDBA 1PZ8A 2D3PA 2UWCA 3DUIA 3QCWA 2CY6A 1UN1A 2R49A 2XB6C 3OBTA 4P9YA 3WG1A 3ZXFA 2DTYA 2G4IA 1H9WA 4Y20B 1LU1A 3WHUA 2P2KA 5DUVA 1OQ1A 5IT6A 3H0OA 2GNDA 1LOBA 1IS4A 3N7JA 5GZEA 1N3PA 1DHKB 4WZFA 4XILA 2ZGRA 2DV9A 2R16A 2P3JA 1SLIA 2ZZJA 5FRAA 3RG0A 4JRAA 3WDXA 5BYNA 4LBQD 2EXKA 1AJOA 1GKBA 1V6LA 2NYYA 1IS5A 4YW4A 3C2UA 1HDKA 3N7MA 4ITCA 4BQ1A 3WVJA 1G9AA 2R0HA 1WW7A 5DG2A 2ZBJA 3PJQA 2PHUA 4GKXA 3B9CA 3WG3A 4LBQB 3O0VA 5CNAA 3WNXA 1FV2A 3M3EA 2UWBA 5CA6A 2ZMNA 2W39A 4XJWA 3ZSLA 2GALA 3WDYA 1AXKA 2JECA 4ZKTB 4W65A 1CPNA 3QLQA 2WSVA 1WCSA 4DQAA 2AH2A 4UW5A 3T1MA 3AFKA 2XG3A 2R1BA 4YZ5A 3AP6A 3AP4A 4NOTA 4XBQA 4Y22B 2CWMA 2WT1A 3HR9A 2D3RA 2ZHMA 1W6PB 3UL2A 2VW1A 4KBBA 3VKNA 1LHWA 1G9FA 1WBFA 5IK4A 4GKYA 3UK9A 2ZHKA 1DQ1A 1LOGA 2D6LX 5JVVA 4BLJA 1G9CA 1LHNA 4YW5A 2A5ZA 2ZGPA 1HQLA 1LECA 1WLDA 4YZ1A 4FP2A 1IS6A 3SLIA 2DUPA 5GZGA 4FVVA 1CQ9A 4FPJA 1JYCA 3WDTA 1CR7A 1DQ4A 1V6IA 2P34A 1GANA 5DZFA 4R9DA 4Q8KA 4LBOA 4Y1XA 5DUWA 3SH5A 4DFSA 1UZYA 3MW4A 5JLVA 1DFQA 3IMNA 5JOWA 3FLTA 2YZ4A 4Q2FA 4GA9A 3V0BA 1BZWA 2E7TA 2R0FA 2VY0A 5SV8A 1XQNA 2GN3A 4ATEA 1ULEA 3FUOA 4F83A 3AP5A 3UJQA 3AZWA 3ZSKA 2ZGLA 1Q56A 2DUOA 2YXSA 3BODA 4WVWA 1U0AA 4YZ4A 3B00A 4I30A 2P37A 5GALA 3RMYA 1O4YA 1IKPA 1N1YA 1SBFA 3D4KA 2AREA 4P9WA 5EWSA 2Q5TA 2AENA 2PHWA 3L2YA 4XIOA 4ATFA 1WD4A 1YXWA 3A4UA 3HN1A 1Q8OA 4RA0A 1SCSA 2ZHLA 1A3KA 3D5OA 2DVBA 2ARBA 5F5QA 3RRDA 5KXCA 1CVNA 2HYKA 2EIGA 2WKKA 2NMOA 3OYWB 2DVDA 5E89A 4WVVA 5T52A 3USUA 3GALA 1DQ0A 4TYSA 2ZGUA 1V6JA 1CIWA 1QMJA 3R05A 4PF5A 4YGDA 1GBGA 1KQRA 4GXLA 1S0CA 3O12A 1I3HA 1UKGA 3M3QA 1KRIA 1DLLA 3GNEA 3WG4A 3V0AB 2CNAA 1ULGA 1DBNA 2NMNA 4L8QA 1VAMA 1QDCA 1HQWA 3IM0A 1LGNA 4XOGA 4FOYA 2C9AA 1UMZA 2TEPA 1LESA 4GWMA 1W6OB 1SFYA 3BIWE 3AZZA 3LSDA 2CL2A 2DTWA 3POWA 1B09A 3OY8A 3ZSMA 2OW4A 4C1XA 1KITA 3RSJA 2NM1A 4ASMB 3SITA 1A8DA 1YI7A 3R4SA 5L73A 5EYXA 4YW3A 3ZYRA 4XZPA 3IKWA 4FPKA 4XMIA 2A6WA 4YG0A 2A7AA 2D3SA 4YM0A 4YG3A 3AK0A 4YG6A 1JN2P 1HKDA 4XHXA 2ZKNA 2YROA 5GJ6A 3IPVA 1JOJA 1LHVA 4HL0A 5JOZA 4P9XA 5GZCA 1W6QB 2DURA 1KDKA 1N1SA 4Q8LA 1I1EA 2VUAA 1LHOA 1S0IA 3AZYA 1ZM1A 3PVEA 4CTEA 1JBCA 3ENRA 3M2MA 1UZZA 4Y1ZA 1G86A 3W58A 4FP3A 4M00A 5EXOA 2D6KA 2A6ZA 2JD4A 1FX5A 1RITA 5H9PA 4Q1PA 2VW0A 1W0OA 5HCAA 1BYHA 1W6NA 3VKOA 3T2TA 2A3YA 4MYEA 1N1TA 1D2SA 2WSUA 4ZXKA 2D6PA 4AGGA 1WW4A 2ZGQA 3MW2A 2AR6A 4XJAA 3B69A 3WHTA 1LODA 1S1AA 2VH9A 4XTMA 4WV8A 5T50A 2OUJA 1V6KA 2GMPA 1LOFC 1QGLA 2EXJA 5DUUA 3WV6A 1W6MA 3DGTA 3AP7A 4YM2A 3POYA 3N35A 2A6YA 2A70A 1YIFA 1LEMA 3M3CA 3N3HA 4LBLA 1ULCA 2LALA 2WNEA 1GSLA 1JUIA 3SISA 4M3CA 4XJ9A 3AJZA 2ZABA 4UW4A 1W0PA 1GZCA 2GMMA 3WG2A 5IK5A 1CONA 2ARXA 4IQPA 1KJLA 2DU1A 2EXHA 3ATGA 1URXA 3KQRA 4Y20A 1SLAA 2W08A 3N7KA 3B3QE 5H9QA 2A6XA 4LBJA 2W52A 1MS5A 3I8TA 4XDQA 3ZVXA 2CTVA 5H9RA 4FOVA 2R1DA 1AJKA 2Z42A 2ZMKA 1PZ7A 4AVSA 4XXPA 3RMXA 4CZSA 4JCKA 3N36A 1FNZA 4M3CF 3RS6A 5E8AA 1Q8PA 3NWKA 2E53A 3WDUA 3FUQA 1RINA 3U4XA 1MS9A 3NV1A 4Z8BA 3AX4A 3JU9A 3Q9OA 4AWDA 4PCRA 5CAZA 3ZSJA 1BXHA 1S0FA 3HMYA 4LBQA 3AYAA 1MVEA 4AGVA 2GNTA 2JE9A 2D6NA 1MS3A 1Q8SA 3UJOA 2NN8A 4M01A 3V64A 1DQ5A 3WOGA 5EYYA 3OJBA 2GNBA 5T5OA 1KJRA 1GICA 1MS8A 5KXDA 2EF6A 3O0WA 2OVUA 2ERFA 3IN9A 1LEDA 2D6OX 3M1HA 1AX1A 2PHTA 1N47A 1JW6A 4Y22A 2BQPA 4FQ4A 1GZWB 2VW2A 3ZPYA 1NLSA 2A3WA 2V73A 1W6PA 3MPPG 1V00A 4SLIA 1LGCA 4XBLA 4XJZA 3M3OA 1Y7BA 5AVAA 2E7QA 4H55A 1FV3A 3OY8B 3NV3A 3V65A 2DVGA 3B01A 2A71A 4GALA 3WDVA 4FPFA 3JUUA 3BTAA 4PBPA 5GLTA 2CYFA 2PHXA 3O5SA 1SCRA 4R9CA 4FPLA 3WLUA 2UURA 2VU9A 1BJQA 3CNAA 5T55A 1LTEA 1LOAA 4K1ZA 3FBYA 2OUHA 4YZ3A 1LENA 1ENSA 2GDFA 2H0BA 5DUXA 4BLIA 1IOAA 1N1VA 5DG1A 2ZACA 1DQ2A 1JXNA 4XYXA 5DXDA 4FOQA 3ZXJA 5T5LA 1JHNA 3KM5A 4YFWA 1MVQA 1A78A 3OGGA 1MS4A 4Y1YA 1OKQA 1ULDA 3OBRA 1YO8A 2ZMLA 1DYKA 5GZDA 1AF9A 1VLNA 2P3KA 1QDOA 1S0GA 4LBKA 5IK8A 1WW5A 2EAKA 4FQZA 1QU0A 1UPSA 4PQ9A 4DRVA 1VALA 3WUCA 1NXD1 4XHBA 1CJPA 1QF3A 1S0DA 4OZXA 4HANA 4YFZA 1LHUA 4M3CE 1F9KA 3ZXLA 5GZFA 1SLLA 4D69A 2DU0A 1AVBA 3FLPA 1DGLA 2D43A 3O0XA 1HLCA 1SACA 4XJ8A 1WLWA 5JMCA 1G9DA 2ZGMA 2EXIA 4DRRA 2A6VA 3OYWA 4K21A 3PMEA 1GNZA 4XMAA 2AGSA 4Y1UA 1C1FA
chains in the Genus database with same CATH superfamily
1AR82 2BTVC 4PBOA 2C26A 4PLOA 2FMDA 5IATA 1OQEA 5FXXA 1IPJA 3FHAA 4Q26A 1PVC3 1TMF1 3VL8A 2XJQA 3AYEA 3M70A 3KS7A 3D6EA 1SG3A 1V6OA 1PVC2 5DZGA 2VZUA 1EYBA 3WF3A 4P14A 3I7DA 4B4RA 1EPWA 4YW1A 1FYUA 3ZR6A 4UFJA 5E6HA 1LJ7A 4XQ4A 5L9RA 1SPPB 3POFA 1SMVA 2UY9A 4JHTA 1DZQA 2QUOA 5FY4A 4DEQA 2PXJA 1D7PM 3GZTB 1GWMA 4NIDA 4K3UA 2XDVA 1POQA 3C7OA 3GBWA 3OF1A 1RIRA 4DPNA 4FTBA 2B8MA 1SLTA 3INAA 4Q4X2 2WNVB 4H3WA 4BHPA 1BQPA 4IV1C 1FNYA 4UBHA 1XBFA 2B7YA 3EB7A 1O91A 2ZAAA 1OVPA 3Q8CA 3ZIWA 4JX0A 1DYPA 2DYCA 1XNTA 3WZ1A 5FREA 4BM8A 4GB33 1H0BA 2ES3A 5F37A 4TN7A 4L2NA 1W6QA 5FY1A 1PZ9A 3B5LB 5E1RA 5JZGB 4AFMA 3CMGA 3O1RA 5DDJ1 4GB32 3GZEA 2GU9A 4XIKA 5K4LA 3VZLA 3PUHA 5KXBA 4RHV1 1PGL2 4B29A 1DG6A 2EIBA 4QPGA 2E6VA 5IVCA 1UXXX 4GQ7A 3ZKYA 4Y5Z0 1J3RA 5A3TA 5A7PA 1QJU1 2SBAA 2OZ6A 4J1XA 2BNOA 1AL23 4YM1A 4ZPIA 4YVWB 4AE2A 1VP6A 2WLQA 5CBLA 2RR11 2VXRA 1VMFA 5T5PA 4CE8A 2EIEA 1C4RA 1K5MA 1H8VA 4HVOA 3RZZA 1GYKA 2AUYA 1YQ6A 2PQSA 4YGEA 2YBPA 1EAH3 2V5YA 3AMHA 2IWGB 1N3QA 3FL7A 4OHXA 2QCSB 3I2FA 5KXEA 5A1LA 3BYWA 1UMHA 4YWAA 5AC93 1OOPC 5FAXA 4NROA 4AG4A 3IAPA 3WNMA 4LXLA 5AC92 1PNFA 1WGPA 1S0BA 3Q8BA 1G8WA 4IE0A 4COZA 3TEYA 1Z7S1 4KGQA 1NY71 3GBFA 4ZU4A 5F2SA 1UIJA 1PHMA 2WFPA 3UT0A 1V0AA 3VBSB 1KXGA 2BERA 4OCTA 2JKBA 1W8HA 2PA7A 4KU7A 1TQ5A 2PLV3 5IAXA 3MF9A 3KQ4B 5AVPA 1AR73 1VAKA 3MZHA 2PLV2 5FYIA 4MXVA 4A6SA 4CEWC 1RMU1 1AR72 2RS53 2Y34A 3AMMA 1GU3A 2BZDA 1SLCA 3AXDA 3H7YA 3JBG3 2JICA 4L97A 4XABA 3GHMA 1MQTA 1UY4A 2XOMA 4CDUB 2FBEA 2RS52 3LD8A 5IHRA 1OH4A 1K45A 1CIYA 3JBG2 4KGGA 4E8CA 3TB0A 4AEKA 4F3JA 5IFTA 3KHCA 1FPN1 4EYUA 3AXEA 1W8WA 4YGBA 4NIAA 1DIWA 1JZ8A 1PO13 2MEV1 2J1VA 2K9ZA 2YBKA 2YY1A 3AZVA 1H30A 3I2GA 4GMP3 5G04L 5FZLA 2ZGTA 1C57A 5T54A 1TZOA 3VDDC 3RZMA 5A3NA 4JGYC 4RGGA 1QOTA 1PO12 3MLLA 4ASKA 3ASIA 5FYVA 1UAIA 4AEJA 1XE7A 5C8CC 4IE7A 4AR2A 3MIBA 2P4EA 5GLVA 2I2SA 1QWRA 2PHFA 1JMUB 2RDNA 2HWF2 3J4UH 4IV3C 3JD72 2HYXA 4BOWA 4URAA 3T4HB 5A1FA 4NO4A 1W6NB 2PQQA 3VBRA 5I93A 3MYXA 4URTA 2VCBA 4AQ6A 4HN0A 4OULA 3J7MA 1WCQA 3FHIB 1QJFA 4BISA 4ZS3A 1HQNA 1OD3A 5F2WA 3WQ7A 3K75B 5CB7A 2QE3A 1F4AA 4IEZA 1PMIA 5LK7B 5ANQA 2KR2A 3WNOA 1GOGA 4TWTA 4XTPA 2O1QA 4PLNA 4ARYA 4QXBA 5L9VA 1VBE3 1X7NA 4BU2A 4LHNA 4CPBD 1JYIA 1R1ZA 2QKDA 4QGNA 4Q27A 5AFEA 2ZEZA 3NV4A 4CCCA 1RUNA 1UZ0A 1ZBA3 1RJ7A 1KD7A 1VBE2 4AVTA 1X82A 5A7SA 2QVSB 2QDNA 1LB2A 1VJ2A 3B02A 3CF6E 3OBTA 2W47A 5IWFA 2DTYA 1H9WA 2Z69A 4Y20B 2QNKA 2R30A 3THPA 3VL9A 3FHQA 1XU1A 1OQ1A 5DAQA 1LOBA 4XETA 4SBVA 2WA4A 5IVYA 5GZEA 5FO9B 4ES8A 5LRSA 4XILA 2ZGRA 1X8MA 1DGWA 3I59B 1JUHA 4B8EA 1I6XA 3JB8A 4JRAA 4ZS2A 3RG0A 1KFUL 1XNBA 1VMHA 1AJOA 1XYOA 1V6LA 1ZRDA 1IGOA 3C2UA 3JCIA 5FUIA 4ITCA 4LUKA 2R0HA 1WW7A 3ALQA 1SFNA 4AEDC 3U78A 2PHUA 1RUC3 3B9CA 1U5ZA 5FJHA 3TEXA 3WG3A 4XC9A 1F5JA 2J1TA 5CNAA 5CA6A 5A7OA 3N9PA 3MLKA 2R7EB 4WM8C 1RUC2 4XJWA 3ZSLA 2O8OA 1OC1A 2OPWA 3WDYA 4W4ZA 2JECA 4ZKTB 5JR2A 4LHKA 5BNNC 3I3MA 3OCPA 3QLQA 1W28A 1QQP1 2BEOA 2AH2A 2JDNA 3T1MA 4Q4Y3 3J7NA 3AP6A 5FZFA 3AP4A 1PGSA 4NOTA 4UFMA 2K2SA 4YZ5A 3MUZ1 3ZIXA 1W6PB 3NAPA 2ORZA 4Q4Y2 1VBD3 1VRH1 4COYA 3LPGA 1HXS1 3ZN6A 5JCTA 2WN3A 5BNPB 2D6LX 1U5YA 1VBD2 2A5ZA 3RYPA 1JODA 3ZSEA 5FR3A 5A3PA 2K46A 2WDBA 3IDBB 4KWLA 5LBFA 2DUPA 3MUY1 4CU9A 2JX9A 3KV4A 3K4AA 5FPVA 1DQ4A 5FK7A 5IVFA 1GANA 1NOVA 4R9DA 4XPVA 4KL1A 5JLVA 4IESA 3EMRA 3BVCA 3E97A 3FLTA 4GA9A 4CU6A 2R0FA 4P5HA 4ARXA 3PL0A 2VUDA 1W9YA 2IXIA 2GN3A 3FUOA 4F83A 3AP5A 4AQ2A 4QHZA 4X6QB 1X33A 3WSOA 4NAMA 1STMA 3SKJE 3UKVA 1ZRFA 1AR91 1U0AA 3IWZA 3VBOA 5GALA 4AI3A 4OLLA 2ZXQA 3K2OA 3SCHA 1IKPA 5LA1A 4EJRA 5C5TA 4NPMA 1OSGA 4OMCA 5FTTC 1RUD1 3KT7A 2QQMA 4GAZA 5C33A 5A7WB 1O59A 4QQOA 1REDA 3AL5A 3C7EA 3RRDA 4RGAA 3VBRB 1S55A 3D5OA 2YDEA 2ARBA 5JXHA 1GOFA 1JZ3A 2D40A 4BWOA 5KXCA 2XHNA 2HYKA 5E89A 1GWKA 2DVDA 1TVGA 4QKDA 3L9JT 5T52A 3USUA 4DY3A 5EZWA 4TYSA 4NAOA 2ZCWA 1QMJA 4YGDA 4PF5A 1RUJ1 3KCXA 1GBGA 4XFHA 1NA1A 1S0CA 3PIGA 3M3QA 1XRUA 3GNEA 1R081 3NW4A 3ZFEA 2HWC3 1DBNA 1F35A 4L8QA 1VAMA 1QDCA 5C5UA 5I91A 3PU3A 2Y6FA 3IM0A 2QQJA 3BOWA 4I0WB 2HWC2 1R1A3 3LZZA 2EICA 2LUWA 3B93A 1ZYBA 1W6OB 4C8DA 3VHOA 4HVRA 1B09A 1NT0A 5BNOA 1KITA 4Q29A 2WWSA 1JU4A 5FMBA 1WCKA 3SITA 5C7GA 2ET7A 4AQTA 1A8DA 5L73A 3WEZA 1I9RA 1NE4A 3IKWA 4IEOA 1RUE3 4WM7C 4XMIA 4OHYA 1HN0A 4DNYA 1OURA 2OS2A 2A7AA 2GZWA 2QBXA 4YM0A 3O1MA 3AK0A 2R041 4IW3A 1RUH3 5FP8A 3TN93 3VBFC 1RUE2 1ZREA 1RUI1 2YROA 4LUMA 5C8WA 2F6BA 4NJ4A 1O3QA 4IV1A 5AFBA 1LHVA 5JXJA 3TN92 3EHKA 5JOZA 3BI3A 2WWJA 4P9XA 4NIHA 4LIUA 4R52A 3PVBB 4Q8LA 2CGNA 1I1EA 4RFRB 1LHOA 3DN7A 4JKLA 5FPXA 1IZ3A 4K9SA 1OPMA 4AI8A 4CDQC 4XAAA 4CTEA 1JBCA 1W90A 1PX3A 5FYMA 5CFCC 4JQRA 2OQ7A 3W58A 2WBKA 1WZXA 5EV7A 1O3RA 2D6KA 5BNQA 4ORFA 4LHSA 5B4NA 1Q43A 3ZYJB 3ZXGA 2H0VA 1UQXA 2N7GA 4LO7A 1W0OA 5HCAA 2WNUB 4JV4A 5GKAC 3VBHB 5FY0A 3VKOA 3KHBA 1A8MA 5F6KA 3ST7A 4LA2A 2RS31 4ZXKA 3GJAA 3H1WA 3B69A 1S1AA 1GOHA 4XTMA 4WV8A 2OUJA 2CU5A 3ZLIA 3O1OA 1CZSA 3SCFA 2LROA 2RS11 3PIJA 2A6YA 3W5MA 4W50A 3J8F1 3NJVA 4B4PA 1JUIA 3POBA 4O65A 3HOBA 2WFF1 4UW4A 5C3SA 1W0PA 4G4FA 1UO9A 4NMIA 4XUOA 4IQPA 1KJLA 2DDUA 1COV3 1SLAA 1VBB3 2CDOA 1ND2B 2W08A 2LW8A 4KBZA 4CCMA 2QQPA 3MO4A 5K0UA 4K7JA 5FZOA 4LBJA 3ZVXA 3BPSA 3I8TA 3PJYA 4XDQA 1DLCA 4EN0A 2ZMKA 1PZ7A 4XXPA 4CUGA 3GF6A 3O7OA 1FNZA 4LTAA 4M3CF 3DKWA 1NAEA 3NWKA 5E8AA 2E53A 3LB9A 3TYJA 2JEMA 1OQDA 3POGA 1RUOA 3JZVA 4Z8BA 4AI9A 4AHYA 4AWDA 1ZA7A 3EXUA 3HT1A 5KWRA 4HKWA 1CAVA 5KC5A 2BVBA 2NPIA 2P6HA 1MVEA 1ZZ7A 2JE9A 3DL3A 1Q8SA 1TNRA 4O61A 2NN8A 1EPZA 5EYYA 4E4ZA 2FCUA 4MG2A 3CEWA 3HIFA 4YM2A 5LRRA 1FXZA 3HQRA 2WA3A 1GICA 2VBDA 5KXDA 1W2TA 2AC1A 2EF6A 2WO7A 3O0WA 4JGYA 2R063 4NN0A 4CUBA 3EJKA 2VOKA 5FO8B 1K5MC 1N47A 1YCIA 2J1EA 4BIOA 2Q30A 4Y4YA 4AHXA 3ZPYA 1HB4A 4UOJA 3NMBA 2QJVA 2Y60A 1V00A 4SLIA 4X8PA 2BWAA 1H2LA 2E7QA 3I2KA 4X8NA 3OUHA 2XR4A 5CFDC 4W6WA 1RHI3 4QM8A 4CUAA 4E4DX 3V65A 1VE0A 2DVGA 2A71A 3WDVA 1ZBE1 5GLTA 2IXJA 3I2IA 1ZRRA 4R9CA 3WLUA 3CNAA 4RR3B 4DIQA 5TSWA 3FBYA 3KMHA 4NIGA 1LENA 1ENSA 2GDFA 2R073 5DUXA 4N43C 4BLIA 1JTZX 1IOAA 1L7RA 4A42A 3MV01 4I01A 3THCA 4XYXA 3CL1A 3N9OA 5JMOA 4B7EA 2R072 1NLRA 4IV1B 3NL1A 3ZXJA 3AVSA 3ZMOA 1AYN3 4E9KA 1UD1A 4GMP0 4I02A 1QH6A 1UKRA 3OGGA 3WP5A 4Y1YA 5C4WC 5LB6A 1RJ8A 1DYKA 4N7IA 1AYN2 4IXLA 2VNGA 5GZDA 4A7YA 5FZ4A 2OT7A 2FZ1A 1J84A 2P3KA 1GP4A 1UF2C 5IK8A 4FQZA 1ACCA 4BQ2A 1OF3A 1VALA 5FFOC 1R093 3J9SA 1CJPA 4XHBA 1Y4WA 3DYPA 3I2JA 2HWB3 1LHUA 4CCNA 3ZMNA 5C3QA 5F7UA 4F7ZA 5CIRA 2BNNA 2KD7A 3WW4A 2DU0A 3DCQA 2VAUA 1I5PA 4IE6A 1PIV3 1R092 4M4PA 4PJYA 1VPHA 2HWB2 2ZGMA 2EXIA 3AKQA 4DINB 3OYWA 2RDSA 3M7AA 3LDBA 3B9IA 3PMEA 4K21A 4QKFA 4BQYA 5BYNA 3S0MA 2HEVF 1WW6A 4QQ2A 3O1PA 1AXZA 5SV5A 4KWKA 5LBCA 1J1TA 5DAWA 4WVZA 4WM8A 1UY1A 4CU8A 4Q0PA 3V0AA 2IXCA 3HPNA 3RJ2X 2FDJA 1OOPB 5FMDA 2AEYA 3RQ0A 5D8AB 3NV2A 5FOJB 2XWBB 1D4VB 1SBDA 3KVAA 2YUEA 2AZ5A 1ONAA 2UY8A 2WT0A 2ZX1A 5A33A 4HPKB 3VKMA 5IFPA 4HFSA 1DF0A 3ZN5A 1APNA 1W0NA 2B4KA 3HQUA 2CAUA 4AQSA 2VL4A 2FHRA 3AYCA 3JQXA 1E5IA 3NNMA 4CP9B 4O7XA 5F3CA 4TZDA 3POSA 5D21A 1D4M2 5CVRA 2ZX3A 1O6UA 4K20A 3WNPA 3ACGA 3TAYA 3FN9A 4FPYA 5CG9A 2HLEA 3MW3A 4CEWB 2PTMA 4YSFA 5DQ0A 1ZZ9A 2AYHA 3LDKA 4OQ9A 1LKNA 2DWRA 4AYUA 2VVDA 2G1MA 3V0BB 3H9AA 3SKVA 3F95A 1LGBA 3OD4A 3EO6A 5FPLA 1OFSA 4RS5B 3HN3A 5E88A 1AR61 1SBEA 4LK7A 4EN9B 3HNMA 3ITQA 4BCUA 4ISQA 1X9TA 3WD5A 1DZRA 4MGZE 3VDDB 1BLZA 2OA2A 5A3MA 1Y9QA 2XQRA 2Y0IA 4BH9A 1QH7A 2VO5A 2Y38A 5H9SA 4A41A 3OPZA 5C8CB 1VBC3 2H6BA 4FSJA 1F8VA 2L9LA 1UX6A 1QIQA 5L7OA 5LK5A 1ALYA 3AMQA 4IV3B 5EFUA 1BMV2 2WQZC 3ACHA 3A0KA 4PIZA 3WW2A 1ODNA 1WMFA 1PGW1 3AKSA 2VMGA 2W68A 3GM8A 2ZEWA 2OQ6A 1OBNA 1W04A 1OLME 4OUSA 1US3A 5FZDA 3PU8A 2J1AA 5IUQA 4Q0UA 1NCRA 2JDMA 2BNMA 4NIIA 3HAGA 5DMYA 5M0TA 4Y1VA 4NHXA 4C0BA 3QD6A 2WZR2 4INDA 3USUB 2ZGKA 1O4TA 2ENRA 5DAPA 5EJZB 4DEVA 3KGLA 4XF3A 4C1WA 5CEHA 1O5LA 3CIHA 5CKQA 3RVHA 2WN2A 3UKTA 2DBIA 2BGCA 5LWBA 1ZRCA 4E2QA 4XVHA 4KG0A 4MGQA 4XZUG 1YFYA 4YW2A 3T0BA 3VGIA 1AX2A 3SNMA 1F31A 3UGFA 1MEC1 4OMDA 5FYZA 5J36A 4HK8A 4XFCA 4WVMA 5BPXA 4G9SB 1F5FA 5JI9A 3J7LA 3IPVB 4FXGB 3SXWA 2HBUA 3GZAA 1C8M1 5I0DA 2A75A 4QHBA 5FLIA 1H1IA 2NP0A 5FP3A 2BRTA 3VBFA 1F15A 1QJZA 3QACA 2A1XA 4BK4A 3T1LA 4AEDB 4EWDA 1OA2A 3VBOC 4CDWB 4XF4A 1QKQA 3SH4A 1W8OA 2FZ2A 1XPWA 1W8NA 3C7HA 5GM0A 3PVNA 4IEPA 4JQTA 2EALA 5BNNB 1ULFA 3SEPA 1WMXA 1CAUB 5CFCA 2D93A 2W9XA 1GZWA 1TME3 5DDJ3 4A45A 4ZU5A 1U5IA 1S0EA 2PELA 2VMFA 5JI7A 2JG8A 4PDWA 1C1LA 2E51A 2PHRA 1TME2 4MUVA 1NA1C 4FPOB 3E6DA 1QOOA 1C8NA 1YNAA 2ZGSA 5EHDA 3SH3A 3ZFEC 1W2AX 4LULA 3LKJA 1FMD1 1W6MB 2P3IA 1EUTA 3LIHA 4JGZA 4CP1A 1AZDA 1SDDB 4HBNA 4Y24A 3LPFA 2B39A 4BIFA 1GQGA 2YFUA 4C0HA 2GAUA 3ETQA 4XJUA 5FBJA 4YPJA 5JDBA 1JYVA 4L0PA 3QCWA 3DUIA 2UWCA 1A6CA 4Z92B 2CY6A 3HWJA 4E4SA 5BNOC 4H14A 3TEZA 5DUVA 4LITA 2FDHA 5ABJB 3IMMA 2J1UA 1CAXB 2VQ0A 3N7JA 4MGKE 3N9MA 1DHKB 2HWD1 4WZFA 1RUF3 5EQUA 5D2AA 1UWWA 1CGPA 3LF7A 4J1WA 4O9GA 5FZMA 3WDXA 4LBQD 3RYKA 1UOGA 4XFGA 1RUF2 2NYYA 3PUIA 4YW4A 5I0UA 4P9JA 5IAVA 4Y3OA 4BQ1A 1G9AA 1ND3B 4GH4A 2YPJA 1JU3A 2JG9A 3MIEA 2NQYA 5DG2A 2QQVA 1RMU3 4PIYA 3BGAA 2ZEYA 1QJY3 1FV2A 2IXLA 5FPUA 3N9LA 4LE3A 2XJVA 3WINE 1QJY2 1AYM3 4Y5TA 4MGTA 1FPN3 4QWNA 3UGHA 4Q4W1 5FY5A 3ZFFC 3DECA 1WCSA 3U0ZA 1OFNA 2RMU1 1AYM2 4UW5A 2MEV3 2XG3A 2R1BA 3AFKA 3DEMA 2DCKA 4Y22B 4Y4RA 5FKBA 5ACA1 5K8SA 1SZBA 2E9QA 2VNVA 3UL2A 3ZDVA 2VW1A 4UF0B 1G9FA 5FY9A 5FQ0A 1AL22 1QY4A 5IK4A 1Y43B 1KS5A 1C5HA 1V9U3 2ZHKA 1DQ1A 4GWIA 2YC4A 1G9CA 4YW5A 2V4VA 2ZGPA 3E6CC 1RUG1 4ZZ8A 2WLPA 1LECA 1EAH2 2JB4A 2W1QA 3KVBA 4D7TA 4YZ1A 1IS6A 4OI0A 1RVF1 3KF3A 2VCCA 1AR81 3SLIA 3T08A 5CFDA 4FVVA 2X09A 4FPJA 1JYCA 3WDTA 1CR7A 1V6IA 1W3VA 5DZFA 3WQ1A 4Q8KA 4LBOA 4Y1XA 5DUWA 3SH5A 5C3OA 4QX7A 1D2QA 2YU2A 4Q0SA 4B4QA 4WM7B 3ECQA 4YVSC 3IMNA 1IQDC 2JB8A 1PVC1 1XNAA 2YZ4A 3AKPA 4UXAA 4A4AA 2WO1A 4N43A 1ZZCA 2E7TA 5K0UC 2WZ8A 4AW7A 1NXMA 1XQNA 2JIJA 1W39A 2QZ3A 4LMFA 1HB1A 1HRV3 1Q56A 1H6XA 2YXSA 5C3PA 4UBGA 1PK6A 3B00A 3WF1A 3RMYA 1HRV2 2OX0A 2R6QA 3IDEA 5C4WA 4MGIE 1N1YA 1SBFA 4CDQB 2AREA 4P9WA 2X53S 2C6SA 1W2NA 2Q5TA 2Y6KA 3L2YA 4ATFA 4ZHNA 3A4UA 5FP4A 3S7EA 4BA6A 1OA4A 4NPLA 5FY7A 1Q8OA 4Q4X1 2ZHLA 1YC61 2DVBA 5F5QA 1KGYA 4HG6B 1HV1A 2TNFA 1R64A 2EIGA 5J3UA 2NMOA 4KG8A 4QGMA 1CX4A 1GMMA 5A1AA 1JZ6A 1XNKA 3WP6A 5CU1A 1SFPA 2WIIB 2D5FA 4XFAA 3L2HA 1JS9A 3TOJA 2GC3A 2QQLA 1UKGA 3W9AA 1DLLA 2RDRA 2QTWB 1GNYA 2W3JA 3N9QA 4GB31 3A22A 1ULGA 1PGL1 3S6PA 1HQWA 3CO2A 4LJHA 4XOGA 1Q3EA 4FOYA 4G3YC 4AK3A 2TEPA 3BTYA 4CSWA 4CXYA 4X6RB 2XUMA 2Z79A 3BIWE 2CL2A 2DTWA 2VMCA 3POWA 2JDHA 2JWPA 4QKNA 3RSJA 4ASMB 1HRI3 2IVJA 2I07B 3T2OA 3R4SA 1L7QA 3T09A 1CZTA 2BOJA 1HRI2 5D1IA 2BU9A 3S57A 1OLMA 4YG0A 5F32A 3LQCA 1DZTA 2BVVA 3KB5A 1OA3A 2B45X 2F17A 3R4DB 4YG6A 2DFBA 4XHXA 2JDAA 2ZKNA 5AC91 2IZWA 2A73B 3VLBB 1ZBA2 2DF7A 4YNIA 4XEZA 4EN8B 4D6SA 1W6QB 1KDKA 1UYXA 3P1IA 1UZWA 4QXCA 3WQ0A 2JXAA 5DN2A 3S7IA 1S4CA 1PM7A 2OXBA 1C28A 2PLV1 3ENRA 4QPGB 4Y1ZA 2FDIA 1H1AA 4M00A 1AR71 1K5JA 2JD4A 2YPDA 1FX5A 1RTVA 1UU6A 4Q1PA 2XBO3 2RS51 1S2EA 2BP6A 1K5MB 3JBG1 2XKPA 1PO23 2Y6LA 4K40A 4MYEA 1UXZA 5JXIA 1JYXA 1JHJA 2XBO2 2D6PA 4RQPC 3PMSA 3WX5A 4S2DA 1PO22 4FI9A 1JI6A 5T50A 4GD4A 4D6QA 1V6KA 1NX9A 1RXGA 2EXJA 4MHRA 5DUUA 5C9AC 3X29B 4UT5A 1PO11 1Y3TA 2VCAA 4GMP1 3N35A 5FZ6A 2A70A 1G9DA 4MXWA 1YIFA 3K48A 1Y9MA 2X5IA 4LK6A 2P6CA 3N3HA 3U11A 3JB4C 4OQ8A 1UOBA 4JZRA 2LALA 1GSLA 4M3CA 4I3PA 3I2OA 3AJZA 2ZABA 5IK5A 1GZCA 2HWF1 3F2ZA 3JD71 1URXA 2PMWB 2W94A 1BCXA 3ES4A 3N7KA 3B3QE 5H9QA 5FZ0A 3IZOA 3ZYFA 4AI2A 4IE4A 2IC1A 1UYPA 2X29A 1CX1A 1S2KA 2G9FA 2R1DA 1AJKA 3VDAA 4AVSA 2VC9A 4BYYA 1B35A 4JCKA 4QPWA 3N36A 5KHKA 1J58A 1MQTB 4FFHA 3RS6A 4AFAA 5LCWL 3OUIA 1H2KA 3DV8A 1Q8PA 2VZOA 2W91A 4EZ4A 2IVIB 4DUVA 3FUQA 3THTA 4AVCA 5C70A 1WKYA 3B7MA 1FT9A 3AX4A 3K3NA 3JU9A 3NNFA 4MOAA 2FCVA 5CAZA 3MIDA 1BXHA 3SQOA 1VBE1 3HMYA 3LIGA 4LBQA 2WQ4A 2GP3A 4MX3A 2C1FA 1MS3A 5KHIA 4M01A 3POIA 1DQ5A 2R043 1YEWA 1BEV3 4QGLA 2RJLA 4MV2A 1KJRA 1K3IA 3P3PA 3OEBA 2OPKA 2OVUA 2ERFA 3VHNA 4DXZA 2IUWA 5L7OC 3M1HA 5FYUA 1AX1A 1QJEA 4IEVA 5LATA 3ZYGA 1JW6A 4L9BA 4CCEA 2O0OA 3R6SA 3KT4A 2A3WA 3NKGA 3BALA 3I3BA 4XURA 3MPPG 3WF4A 1LGCA 1UY3A 1Y7BA 3ZXDA 4H55A 3VZOA 1IPSA 2X05A 4AVBA 1JZ4A 4GALA 3T2PA 1NYWA 4FPFA 4BB3A 1RUC1 3O5SA 2WNVC 2D5HA 2EIDA 2QQKA 2VU9A 5HPOA 3S5AA 2FD8A 1NCRC 3DKQA 4Q0QA 4N9IA 3PTYA 2BBVA 4HK9A 2WUHA 4YZ3A 1OHFA 3CJIA 4Q4V3 2ETEA 3OG2A 1N1VA 5J1XA 3JQWA 2BV4A 1JXNA 2VMIA 3DXUA 3ZO0B 4Q4V2 5DXDA 4FOQA 1W9SA 1JHNA 1W8UA 1R1A2 2O8QA 3MFAA 2J42A 4JHZA 4Q4Y1 4YFWA 1MVQA 3WR0A 2PYTA 3A7QA 1H6YA 4P9GA 1YO8A 4QB6A 1W2UA 2ZMLA 5BXXA 1O3TA 1ZRIA 1ASJ3 1VBD1 1VLNA 1QDOA 4LBKA 1QU0A 2VUCA 1ASJ2 3WUCA 4MGYE 1NXD1 4N9HA 3WNLA 4OZXA 2E7AA 4KI5M 2WAOA 2YG0A 3ZXLA 1SLLA 1YJKA 2MNGA 4IUGA 1OMIA 2C24A 1U12A 3O0XA 4QQPA 5FZGA 5JWPA 4MGSA 4DUXA 1RUH2 2DCZA 4IGPA 1AL0G 1QXRA 1O8SA 2V4AA 4XMAA 4KWUA 3CZUA 1FATA 2CWSA 4RFT0 4FPCA 3ZOIA 4DXRA 5J96B 1OT5A 5HBAA 5F3GA 1LOEA 3PVOA 4QQHA 1BK0A 5DABA 4JKKA 4KH9A 1Z0HA 3ZFFA 1GZ9A 1EUUA 2JG8C 4M3CB 4PDWC 2ZPXA 4JRLA 3NAPB 3SCGA 5FKCA 3ZN6B 1BBT3 5I0RA 3RFRA 4IL7A 3MV11 4JGZC 3MI8A 4RL7A 3I2HA 1BBT2 3POJA 1QXJA 5T5JA 1QNWA 3OOXA 4CDUC 2JD9A 1N3OA 2RV9A 2SLIA 1SEFA 3H3ZA 4AVVA 4YZ2A 3MDPA 2HKXA 3LSEA 1YRZA 3CDZB 1FAYA 2QZ2A 1M4WA 3ZYBA 5DZEA 2D6MA 2BFUS 3CU7A 3LE0A 4ZXEA 4META 1LULA 2C4XA 1ZBE3 1CJDA 1TEIA 4F8AA 2HWC1 2O14A 4YVSA 1ZZ8A 2Q4SA 4LOSA 4OI2A 4V2WA 3BUCA 1XSQA 4N53A 2WS93 3URFA 2FDFA 1COV2 4Q1RA 2VJXA 2Y33A 1VBB2 3PUQA 3ILRA 1Z78A 3VBOB 4FTEA 3WY6A 3N4MA 2WS92 4WBBA 1NCQA 4BPZA 1W99A 4KWJA 3AZXA 4GH4C 2JG9C 4KNCA 4FPGA 5DPNA 1ZA4A 2VULA 3ZDSA 2ZZQA 3H3UA 5JAXA 1X50A 2Z4FA 1V6NA 4IEWA 1RUE1 2YV8A 3UYJA 1WA4A 1OVSA 1SLBA 2Y0OA 2ZKLA 3LCPA 4LLOA 3U07A 1QHDA 2RM23 3OBAA 1J59A 4K1YA 3TN91 1YQCA 4DOUA 1VAVA 3WP3A 5JSPA 4QPIA 4K8FA 1NA1B 1Q8VA 1CAWA 2RM22 4PIXA 1MPXA 3QOPA 3JXSA 4S2FA 4CDXA 3ZFEB 4XUTA 4BQ5A 1CPMA 4XE9A 2EVXA 2WZPP 1GLHA 5A3UA 4XUQA 1ULPA 2JJ6A 4OYUA 3ILFA 1WLCA 4EROA 2R062 4CXWA 3AFGA 3ELNA 4NE9A 4ZU7A 4OUEA 4LLFA 3ZXKA 3W5NA 1REFA 3NNLA 2VOWA 2GNMA 3R4UA 3LFIA 1DYOA 3AB0A 3MLJA 4FPHA 4NRQA 1O5UA 3FMGA 5BNOB 3H8RA 1MACA 1XXNA 3IIAA 5FDBA 2XMLA 2G9GA 2LM3A 3UV9A 3ME2A 4LBNA 1RHI2 3G6JB 1UL9A 5LZ6A 3VKLA 4BJ0A 1JZ5A 1O4ZA 4IEQA 4NR1A 3VZMA 1RC6A 2XGXA 4AGRA 2J7MA 2VM9A 3BOPA 1MS0A 4IETA 4CEYA 3M8LA 1GR3A 5I0TA 4N8MA 4OHWA 4J6GA 3ZFGA 4XF1A 3BN6A 4YGCA 4LPLA 1XB9A 2Z2SB 3IBMA 3CBNA 3OUJA 1PK6C 2AEZA 4U2AA 4GWNA 3T2QA 4BMBA 4S2HA 3W59A 5A6ZA 5FZEA 3APBA 3HJRA 1O3SA 4JDMA 1YIPA 2KM2A 3K51A 1VIWB 2W46A 1SDWA 3VV1A 3BIEA 3N9NA 1QXPA 1VBB1 3T4VA 1MR5A 4FPEA 4XUPA 3FLRA 4BDVB 4AL9A 2V72A 4JKMA 1IS3A 1QJX3 4XBNA 5EP9A 2I74A 1AX0A 3ZXEA 2RG4A 2VMEA 2YYOA 3K4ZA 3ROUA 5FXVA 2ZA9A 3OBZA 1BKZA 4UW6A 5GLUA 2JDZA 2WO2A 3AJYA 3VBUC 3KF5A 4HKOA 1PIV2 2WJSA 4BQXA 4HMZA 4FTSA 4R9AA 1KDMA 2BDRA 1IKQA 1UW8A 4RQPA 4QX5A 3BTXA 1POV3 2WL1A 1CN1A 1OUXA 2H6CA 2VNOA 3GCXA 1E57A 3GZUC 4GIQA 4PI2A 1EV13 4XQWA 3VKFC 3H1MA 3VB9A 2W0XA 3WCRA 4YRDA 3ZPOA 5FYCA 1D0GA 2ZGNA 1QNYA 3UETA 4A44A 5JOXA 5C9AA 4GJZA 3WT3A 4M0NA 3E5XA 4HVQA 2D3PA 2WR9A 1H8TA 2XB6C 1E5RA 3Q8AA 2PAEA 5HXVA 1IHMA 2ADDA 2G4IA 5LEKA 1JOBA 1LU1A 2OZJA 4CYDA 1MZFA 3FE5A 3KGZA 5FWEA 5JR7B 2OIIA 5K0UB 5FZOB 2GNDA 3LGRA 1IS4A 3I3EA 3M3IA 1N3PA 4NHMA 2FDKA 2XJPA 4QX0A 2ILMA 1US2A 2ZZJA 4HT1T 2VOXA 4D7SA 4QMAA 2EXKA 1GKBA 3CJXA 5FZBA 1HDKA 2GSYA 3N7MA 3IDAA 1JH5A 2WQ8A 2ATFA 4AI0A 2ZX2A 1YFXA 2PFWA 1CAVB 2LS6A 1XE0A 3ES1A 1XOYA 5F5AA 3MIFA 1WA6X 4R4XA 3RZLA 1OD5A 4AAXA 4EWEA 2R071 2VZSA 2UWBA 3ON7A 2ZMNA 2W39A 2XH6A 1MEC3 1OH3A 4R8HA 4QU2A 3OGJA 4NVPA 4HKLA 1W06A 5F1RA 1VBA3 3GDBA 2QQNA 4W65A 1C8M3 1CPNA 4ZY9A 2B46X 1AYN1 1FOD3 2HWE3 3LEGA 3NQHA 3CHXA 4JGYB 4DQAA 1GP5A 1VBA2 4IGQA 3POEA 1TG7A 1XYNA 4LKDA 2VZ3A 2YC0A 4LHLA 2CWMA 2HWE2 1FOD2 2D3RA 1J1LA 2VG9A 4Z2WA 1WCDJ 3RGBA 1PM4A 1LHWA 4I09A 3VD4A 1XYPA 1VBC2 2VZ1A 4W6YA 1UU4A 2GC1A 1SPPA 3UK9A 5IVBA 1R091 3M4FA 1LOGA 4COWA 1LHNA 2HWB1 3DYMA 5JIUA 1ULOA 1WLDA 2P17A 4A3ZA 5FYSA 1WMEA 1KFXL 1PIV1 3NSTA 1UNBA 2UYBA 2X5IC 4DY5A 1CQ9A 3PTRB 3LA3A 2KXLA 2WNVA 1W8FA 2D98A 1NZCA 1S2BA 3ZM8A 3MW4A 4DFSA 1HX6A 1DFQA 2BFUL 4QXHA 3HT2A 4A7KA 1TMF3 3C3VA 4Q0VA 4QX1A 2VY0A 5LW9A 1ULEA 2XLFA 4D0QA 5FP9A 1TMF2 3Q8FA 3UJQA 3AZWA 5JZGA 1B35C 2DUOA 4H7MA 3BODA 3C7FA 4WVWA 5F3EA 5FOBB 3FBMA 2VTXJ 4CCKA 2OYZA 3NKTA 4DZGA 1O4YA 3SMHA 1D4M1 1OLQA 2VR4A 2ZEXA 4HETA 4I0AA 4JTOA 4PT6A 2WNUC 3VBHC 4UYBA 5EWSA 2PHWA 3ABZA 4XIOA 1YXWA 3HN1A 5A6XA 3H1YA 4YVWA 2FMYA 4TSVA 4RA0A 1W2OA 2VGDA 2W87A 1CVNA 3OYWB 4K8RB 2VE1A 4WVVA 1DQ0A 1LNSA 2ZGUA 5IVVA 4IDZA 1KQRA 4GXLA 3S30A 3KD4A 4QPYA 1I3HA 4NWWA 4WM8B 5J48A 1KRIA 5JSOA 3NJXA 4XUNA 3WF2A 5HV0A 3V0AB 4QB1A 2CNAA 2NMNA 4AZZA 5DAVA 3AKTA 3OGSA 5FZ1A 5FMOL 5A33B 2W2IA 2Y6JA 2C9AA 5FPAA 4N90A 2RJKA 1JOPA 1ND2C 1ZX5A 2Q8EA 3KSCA 4GWMA 4RHV3 3VBSA 5FZAA 4AFCA 3RJRA 5DDJ2 4B3NA 3RI9A 2RMU3 1BMV1 4RHV2 1UU5A 1QJU3 4C1XA 3GCWA 4KMQA 5I8YA 2WYSA 5ACA3 1WWYA 2RR13 4BXFA 2W1UA 4UFLA 5EYXA 3CJIC 3MHZA 1J83A 1QJU2 4XZPA 2RR12 4CDUA 4ZZ5A 4RGKA 5FYHA 4YG3A 2YGMA 4OFGA 1JN2P 1HKDA 4QX2A 4BQ3A 1JOJA 2ADEA 3RPQA 1AR83 1L7LA 4L92A 5GZCA 3HEIA 5BUVA 4WZCA 1LR5A 2WZR1 2EAAA 2XJUA 2VUAA 1Z7S3 3HNYM 2QQIA 3W20A 3AZYA 1ZM1A 3PVEA 5A7NA 3U4SA 3QBQA 3VD3A 4AEMA 2Q8CA 1UZZA 1Z7S2 1G86A 1NY72 2VZVA 3HQXA 3RYRA 2VVFA 5EXOA 2A6ZA 4LA3A 2W1SA 4P9IA 1RITA 1X8EA 4XFFA 3VD5A 2JKXA 2QQUA 5FLJA 5L7OB 3NJYA 1BYHA 1W6NA 5KBFA 1XU2A 2VQAA 4PQQA 3BKZA 3LWCA 1H4HA 1DGWX 4P02B 1N1TA 1D2SA 4AGGA 1U5XA 1WW4A 3WHTA 2AR6A 3K3OA 1LODA 1RMU2 3O1UA 5APAA 4E4HA 1XC6A 2J1SA 1OUSA 4R4ZA 3KV6A 3KZ4C 4RR3C 4OHZA 4P5YA 3FJSA 4RYDA 4DO0A 4Q4X3 3VD7A 4TLFA 2W95A 3DGTA 2GC2A 2CAVA 4L99A 4O9EA 2MHFA 2BOIA 3IDCB 4HXCA 1UY2A 3T3YA 3WNKA 4D8MA 4YARA 4AVAA 3PDQA 2PAKA 1ODMA 1FPN2 1NCRB 4LBLA 2IXHA 3SISA 4AFBA 4AOCA 3WG2A 2MEV2 1UIKA 2E31A 2VVEA 3V64A 2DU1A 3KQRA 4Y20A 3D82A 5ERLA 5F8PA 1K42A 3ETPA 2B9VA 1BK1A 5CYYA 3LOBA 1GQPA 2A6XA 3MGUA 2W52A 4QDSA 2W1WA 1TME1 4UI9L 4CCLA 2CTVA 1V9U2 1AUYA 4FOVA 2PN5A 2Z42A 1YFUA 4BQ4A 4P9LA 3I59A 3Q8EA 3RMXA 2IFRA 4ES9A 1HJFA 2WC2A 1DGRA 4QU1A 3A21A 4OZOA 5F5IA 4NUBA 3WDUA 3PNAA 3U4XA 2IFWA 4WVMB 2G19A 3NV1A 5F5CA 5L9BA 3OPWA 4PCRA 1X9PA 3KV5A 2XUEA 2XVLA 4N53C 3HVDA 1S0FA 3HBZA 4FT8A 4V2VA 3VBFB 2JDUA 4LT5A 2C9KA 3AYAA 3GBGA 3KLSA 4CP2A 2PHDA 2GNTA 2OKXA 1IG3A 2D6NA 1C5IA 2RE9A 3USSA 1NCQC 3OJBA 3GHNA 2RJ2A 5T5OA 3LA2A 5D8AC 1MS8A 1SQ4A 4FO9A 1K12A 4AHWA 1G6NA 1HIXA 2GH2A 3IN9A 2D6OX 2XWJB 4I0BA 3TNPB 5CFCB 2PHTA 5E16A 1GZWB 2E32A 4HLTA 2VTXA 1RUF1 2ARCA 2E26A 1W6PA 3J26N 3VHRA 4COUA 2QDRA 5T3NA 2JG8B 2JDKA 1RXFA 4PDWB 4XJZA 1OKOA 2WRAA 3MF6A 3P3NA 4QPIC 5AVAA 3OGRA 1BHGA 4FBFA 5BNPA 4NWVA 3NV3A 4CDXC 3VZJA 2TUNA 3DPRC 3RZHA 5FZKA 2VCMA 4BE3A 4ZONA 3VBUA 4PBPA 4P08A 1E5SA 2PHXA 3WNNA 1SCRA 4JGZB 2UURA 5JUVA 1QJY1 1M06G 1LOAA 3G7DA 4K1ZA 5DAXA 2Y8KA 2BPA2 2H0BA 1HB2A 4XFIA 4A2UA 4A3XA 4D3WA 2D97A 3BCWA 3IAQA 1AYM1 1W9TA 5DG1A 2ZACA 1DQ2A 2HEWF 4XAEA 3K46A 2X8KA 4RS5C 5T5LA 3I97A 3IT8A 3KM5A 3J7HA 1QQP3 1UOJA 4D7YA 1QEXA 1AL21 4XCBA 1ULDA 3OBRA 1Q5OA 5FP7A 1QQP2 3E6BA 4JDNA 4UWDA 5HV4A 4LKEA 2HWF3 1I5ZA 4D69A 1EAH1 1VRH3 3JD73 2EAKA 1HXS3 1V9U1 1X36A 4JDOA 4CEYC 5K7PA 4DRVA 5I8SA 1QF3A 1S0DA 2EA7A 2YB7A 3I3DA 4HANA 4QM9A 3ZFGC 1VRH2 5A7WA 2BYVE 1HXS2 5F3IA 4GH4B 3C8XA 2JG9B 2J22A 1DGLA 3FLPA 4XJ8A 1JYNA 1UMIA 5JMCA 1WLWA 2GC0A 2JIGA 1EY2A 2A6VA 4QKBA 1GNZA 2HJIA 4ASLA 3VN4A 2BWCA 3ZN4A 3OEAA 4XCAA 3UKNA 1POV0 2NZ9A 4LBMA 5FK8A 1GWLA 2D44A 3WXPA 2CDPA 3QH6A 4Y26A 1P8JA 2VZPA 3ZYIB 2YC2A 1LOFA 5FZIA 1NUKA 4FFFA 1HRV1 5A3LA 1OLRA 1TNFA 5FV3A 5IJRA 3IB3A 4LO6B 1ZZ6A 1AR93 2VMDA 1H9PA 1L3JA 4BZ4A 5FQ0B 2VQUA 2WZEA 1W6OA 1RB8G 5FZ9A 1WD3A 1AR92 2ARAA 3A0NA 1RUD3 2WWUA 2Z5WA 4QT6A 1CZVA 1XNCA 3LEKA 1W03A 3NO8A 1QOSA 5CFDB 1JZ2A 2XJSA 1RUD2 4NRPA 3RZGA 3MICA 4PF1A 1E5HA 1FI2A 1UYYA 3O14A 2VQTA 1H8TC 2YHJA 1DQ6A 4CRQA 4NHYA 4XW3A 3I2DA 1W9WA 2C5DA 2Q1ZB 2XLGA 1RUJ3 4QX3A 1T6GC 4N43B 4YW7A 2P1BA 2ZGOA 3KCYA 4CDWC 2A3XA 1R083 2DVAA 2DBNA 1RUJ2 3CQOA 1XNDA 2V5DA 3NVCA 4ET7A 3FFZA 3MEPA 1GFF2 1MS1A 4JTNA 1TE1B 4R9BA 3WDWA 5HCBA 1R082 3AMNA 3WW3A 3ZYPA 5FUPA 4H7LA 4U36A 1PK6B 4AHZA 1ENXA 2Q1FA 4Z07A 5C4WB 1GNHA 5F39A 3V56A 5ISLA 1MZ6A 2CGPA 1S0JA 4FFGA 4DUWA 2LTNA 5FYTA 1WLTA 5A3WA 4B1LA 4LNVA 1HRI1 4YLZA 2AACA 2WNUA 2ZS6B 2ID4A 1XJAA 3I4IA 2GN7A 4JC1A 3VBHA 1G9BA 2W92A 5HCFA 3P6BA 4MSVA 1LAJA 5LASA 1F2NA 4XXAA 4L11A 5LA9A 4FOWA 3BPZA 2Q8DA 5L19A 4DB5A 3KCCA 1ZBA1 5HCHA 4NHLA 2GP5A 2Y64A 5JSRA 1IG0A 3E1F1 5FWJA 3WQBA 3VBUB 1LU2A 1RUI3 5A80A 1AXYA 3BB6A 2ZAHA 2R042 1UCXA 1BEV2 3DYOA 4UW3A 1RUI2 3MBWA 3U75A 4EN7B 4QHOA 5FPZA 3T30A 3NRUA 3FZ3A 4ISRA 3WW1A 2UWAA 2VBPA 2DVFA 1UOFA 2XJTA 3MFCA 1OXCA 1CESA 1IQAA 1EP0A 5ABJC 3UESA 1RYYA 3DXTA 1LCLA 1ND2A 5FUNA 5CKNA 5LA0A 2RDQA 2BUKA 2B42B 5LEJA 1NG0A 1UPIA 2JDYA 2XBO1 2BJSA 5K9YA 5LY1A 5JOYA 4W6XA 1YYNA 5A7QA 1D0HA 1PO21 3ILNA 2DUQA 4UAPA 3WCSA 2WT2A 5B2GB 2GMEA 2Q0AA 2RS33 2D7FA 1ND3C 4A7ZA 3DF0A 3GJBA 1BVP1 5FBZA 4A6OA 2RS32 1C3HA 1GV9A 5GLWA 5FCCA 2G9ZA 4LEJA 4FAGA 1HW5A 1O8PA 1VR3A 5JZGC 1WUVA 4EV0A 2RS13 4Z1VA 4S2GA 2JE7A 2E63A 3EYPA 5IK7A 4BK5A 2BBAA 3J8F3 4MO3M 2RS12 4RD7A 1ENQA 5ANNA 3AP9A 3VUOA 2WFF3 1H1MA 2ZHNA 4YVWC 3J8F2 3SHRA 4TTGA 1A34A 3LEMA 2VZQA 5CISA 4HOOA 2WFF2 1LOCA 1ENRA 2RHPA 5GLZA 5LY2A 1MZ5A 5A6YA 2JENA 1G7YA 1REEA 2YFZA 1W8TA 3AYDA 1KS4A 1W05A 3VD9A 1YQ2A 3HNBM 3OPTA 1WBLA 5L36A 1DDLA 1YQ8A 1NQDA 4DS0A 5ACA2 4PLMA 5EJ3A 4YM3A 2IXKA 3PHMA 3SC7X 5KHHA 2C0ZA 4AI1A 3N7LA 4RR3A 1Q8QA 1V6MA 3ORJA 4MXWB 2X5IB 4TXWA 3VBSC 3RWKX 2XVKA 2V09A 4MH0E 4QQLA 2UU8A 2YMZA 1PMHX 1BEV1 2XXZA 4GZ9A 3WUDA 4BMEA 1PZ8A 5F9TA 3GYDA 2HH9A 3H8UA 1UN1A 2R49A 4P9YA 4OI4A 3WG1A 3ZXFA 3AL6A 4CXXA 3WHUA 4JVAA 3MIHA 2P2KA 5IT6A 3H0OA 1JZ7A 3CZJA 4HSLA 2Y26A 4HSJA 4I3GA 1J3QA 4LO5B 3U14A 3U37A 2DV9A 1NZIA 2R16A 2CSGA 2P3JA 1SLIA 2DCYA 4Q5OA 1B35B 5FRAA 3VDCA 3FX3A 4CVUA 1IS5A 3RWNA 3T0AA 4HN1A 3OGVA 5KHGA 3SEEA 3WVJA 1NKGA 1HJGA 1ST8A 2VOTA 3OD0A 2ZBJA 3PJQA 3ZYHA 4GKXA 3IIIA 4LBQB 3K77A 1T6BX 1NLQA 3O0VA 3M3EA 3WNXA 2YBSA 4Q4V1 3ZR5A 4D94A 1ZBE2 4Z2AA 3I54A 3C7GA 2XL7A 2GALA 1R1A1 2PHLA 3D8CA 4GULA 3VHPA 5BV6A 2VBBA 1AXKA 4Y5SA 2GH8A 4XACA 4DMIA 5C71A 1UYZA 4CCOA 2WSVA 2NLRA 4N7UA 2I45A 4CU7A 5A3OA 1OOPA 4IE5A 2F4LA 5LA2A 5D8AA 2VPVA 4XBQA 2FQPA 2WT1A 3HR9A 5G05L 1ASJ1 3BU7A 2ZHMA 2UYAA 5J98B 3W21A 3FC0A 1KEXA 3OB8A 1ZNPA 4HPKA 4KBBA 5FZ8A 3VKNA 4AXOA 5FO7B 4CCJA 3GXUA 1WBFA 4CPBA 4GKYA 3TNQA 5JVVA 4BLJA 4CUCA 5BY5A 2F4PA 3S5QA 3VZNA 4CP9A 1RUH1 1NE6A 2BW8A 1YHFA 3RNSA 1HQLA 3LA7A 4FP2A 5GZGA 4QAWA 3PURA 4NHKA 4EN6B 2P34A 1DU3D 3DPRA 4CEWA 3UGGA 4XF0A 1JYTA 1HV0A 3CJIB 2R32A 4COVA 5FMOS 1UZYA 4P00B 3T0DA 5EIYB 5CKMA 4C91A 2XJRA 5JOWA 1OI6A 4Q2FA 4AFDA 4D6RA 4EZHA 3V0BA 1BZWA 2FDGA 2X10A 1GUIA 4UFIA 5SV8A 4ATEA 4RS5A 4ONUA 3ZX7A 3U10A 4PI0A 2K0GA 3ZSKA 2ZGLA 4QPGC 5FZHA 3H8XA 4UFKA 1ZVFA 2CV6A 4YZ4A 4I30A 2P37A 4KQ7A 2WNOA 4W8JA 3VDDA 5C6CA 1BBT1 4AAPA 2DCTA 3QH7A 3D4KA 4IERA 4E8DA 2AENA 5LBBA 4DXSA 1WD4A 5C8CA 5J7MA 2Y6GA 2CHHA 3GGLA 4GJYA 3LAGA 5FJKA 1J3PA 1SCSA 1A3KA 4JAAA 4IV3A 4EWAA 2XLAA 4GWJA 4QB2A 2WKKA 2BGPA 3THDA 1H2MA 4EE2A 4IEYA 3GALA 3NJZA 5CADA 5JPMB 4UFHA 5FXZA 1SHWB 4FAHA 5FPBA 1V6JA 1CIWA 3R05A 2TBVA 4IEXA 2JDPA 4LO8A 3O12A 4LKSA 3AKRA 1COV1 3LOIA 3WG4A 4EQVA 3H42B 3OTFA 1RL3A 5FMCA 1BVVA 2WS91 3PUAA 3AMPA 3ZFFB 1LGNA 2WO3A 4LOTA 1AR63 3LDRA 1IPKA 1RGSA 1UMZA 1UZVA 1LESA 3KT1A 5BNPC 5KC6A 5J37A 4MZUA 1DGRN 5F6LB 1QJX2 1SFYA 1AR62 4NRMA 3AZZA 1YWKA 3LSDA 3EBRA 5A70A 2VMHA 3OY8A 3ZSMA 2OW4A 3AVRA 1O7FA 4B7KA 2XPJA 2NM1A 2QQWA 5KR7A 3BTZA 1MQTC 1PVXA 1YI7A 3ZYRA 5A6QA 5EJ1B 4YW3A 1OPOA 4MLOA 3D0JA 1F4HA 5IW0A 4AF9A 4MVTA 2XQXA 4FPKA 3E5UA 2Q8OA 2A6WA 2DFCA 2RM21 3RDIA 2VZRA 2KA3A 2D3SA 5JIAA 1EV12 3A23A 2E33A 4B1MA 3U1XA 5GJ6A 3IPVA 2ZX4A 5CZKA 1YQ5A 1PMJX 2HBTA 4YVSB 4HL0A 2R061 4LO4B 5FZCA 1PGW2 1DCSA 4IGOA 4QD2A 4AEDA 3UNPA 4LE4A 2DURA 1N1SA 4N53B 4XDOA 3AM2A 4CDWA 1S0IA 4XDPA 5FZ7A 3CKHA 4OVEA 3LFMA 4HZFA 3NNJA 3B94A 1DP0A 1H4GA 1Y9GA 1NCQB 4KU8A 3M2MA 5FYYA 2XONA 1GP6A 4FP3A 4OI1A 4LQRA 3VBRC 1RHI1 1W8ZA 5BNNA 5H9PA 1CAUA 5FXWA 2VW0A 1OF4A 1PX4A 2VOVA 3D0SA 3K4DA 3T2TA 4FXKB 5A32A 1MZEA 2A3YA 4MHUA 2VUJA 1LRHA 2WSUA 1D4M3 2VZTA 1HB3A 2ZGQA 1AHSA 3MW2A 4XJAA 3ZXAC 2VH9A 5IVJA 1UY0A 5KHJA 5HI0A 4QDRA 4QPIB 1GQHA 2GMPA 1LOFC 1QGLA 2DCJA 3ACLA 1CAWB 3EQEA 3R0RA 4FCAA 1W6MA 3WV6A 4IEUA 4CDXB 5I0SA 1MEC2 4H2AA 2VECA 3AP7A 3DPRB 3POYA 2W5FA 5FLHA 4E27A 1LEMA 3M3CA 1C8M2 4M4RA 2XVGA 2VTFA 1ULCA 2WNEA 4XJ9A 2RVAA 2YGLA 4CP0A 4QX8A 2GMMA 2WYFA 1YFWA 2VXJA 4FFIA 1CONA 2ARXA 2EXHA 3ATGA 4K6BA 4E2SA 5HXMA 3KWVA 3P5BA 1QJX1 2Y6HA 4QDQA 2P3YA 2ZJCA 2PAMA 1MS5A 3KV9A 3VZKA 1CAXA 4LKFA 4CA9A 5ABJA 5H9RA 2Q1MA 2XKOA 1VMJA 2WAAA 2MPFA 4E2GA 3I49A 4CZSA 3BU0A 4V1PA 2XL9A 1W9FA 3PUSA 3ZKUA 4CCDA 1JYWA 2LRPA 2JE8A 1RINA 3D3AA 4HONA 5FY8A 1POV1 2B9UA 4CEYB 3O1SA 1MS9A 1ND3A 2QFEA 3Q9OA 3RZJA 2P5BA 1YUDA 3ZFGB 3ZSJA 1EV11 1FMD3 3TEWA 3VDBA 2VNRA 1CD3G 4AGVA 2QQOA 1H2NA 2XHKA 2HEYF 1FMD2 3TBDA 1XE8A 3NNGA 3UJOA 3WOGA 2ORXA 5FYBA 3RZKA 3H3LA 4C90A 2GNBA 1XSRA 2YU1A 1PNGA 1WMDA 1ZZBA 5CG8A 4I2OA 4LR4A 5IYYA 1LEDA 3NAPC 3H8OA 3H50A 3MPBA 3I3QA 2WZR3 4Y22A 4DXTA 2BQPA 4FQ4A 5FIXA 2VW2A 3RI8A 1NLSA 2V73A 3TRSB 2HWD3 2B5HA 4UF0A 4QXKA 4OUMA 3CLPA 3PLQA 4M0HA 4MADA 4XBLA 3M3OA 3HBKA 4OHVA 5B4XA 1FV3A 2HWD2 3OY8B 5LBEA 5IVEA 5JPNB 1UX7A 3E5QA 3FFQA 1VRBA 3OSDA 3B01A 4RQPB 2CGOA 3WF0A 3O1VA 3JUUA 3TWIA 1NQJA 3BTAA 2CYFA 3H7JA 4XQDA 4J25A 5C3RA 4FPLA 4RN5A 1BJQA 1GZTA 1LTEA 3LEIA 5T55A 4TLGA 2OUHA 3WP4A 3MIGA 5C9AB 2ZX0A 4LORA 2ET1A 4WM7A 1VBA1 2ZOEB 1H8TB 4YW6A 1VB2A 1YI9A 2HWE1 1FOD1 5JXGA 1YJLA 4Q4W3 2J1RA 1HN1A 1A78A 4LIVA 1YLLA 1MS4A 1VBC1 1OKQA 1CWPA 4Q4W2 1AF9A 2RMU2 4BXSV 3ACFA 1S0GA 5I8TA 4XFBA 1WW5A 1V70A 2WINB 4XF9A 3AC0A 4PQ9A 1UPSA 1VB4A 4PHZA 1T2XA 1W3XA 4CDQA 2FCTA 3O1TA 4YFZA 4M3CE 1F9KA 1RUG3 5GZFA 4Z82A 1AVBA 4NPRA 4Y33A 2D43A 1HLCA 1SACA 1RVF3 2VD7A 3ACIA 5A32B 4YYOA 3HD8B 4Y1UA 5FZ3A 4BQWA 1WCUA 2WABA 4DRRA 5J09A 1RUG2 4RSUA 2ZTNA 5EPAA 2AGSA 3FWEA 1C1FA 1RVF2 2BGOA
chains in the Genus database with same CATH topology
1AR82 2BTVC 4PBOA 4PLOA 2FMDA 1OQEA 1IPJA 4Q26A 1PVC3 1TMF1 3VL8A 2XJQA 3AYEA 3M70A 3KS7A 3D6EA 1V6OA 1PVC2 5DZGA 1EYBA 4P14A 3I7DA 4B4RA 1EPWA 4YW1A 1FYUA 1LJ7A 4XQ4A 1SMVA 2UY9A 1DZQA 2QUOA 3GZTB 4K3UA 3GBWA 3OF1A 1RIRA 4DPNA 4FTBA 2B8MA 1SLTA 3INAA 4Q4X2 2WNVB 4H3WA 4BHPA 1BQPA 4IV1C 1FNYA 4UBHA 2B7YA 1O91A 2ZAAA 3ZIWA 1DYPA 2DYCA 3WZ1A 5FREA 4BM8A 4GB33 1H0BA 2ES3A 4L2NA 1W6QA 1PZ9A 3B5LB 5E1RA 5JZGB 4AFMA 5DDJ1 4GB32 2GU9A 4XIKA 3VZLA 5KXBA 4RHV1 1PGL2 4B29A 1DG6A 4QPGA 2E6VA 4GQ7A 4Y5Z0 1J3RA 1QJU1 2SBAA 2OZ6A 4J1XA 2BNOA 1AL23 4YM1A 4YVWB 4AE2A 5CBLA 1VP6A 2WLQA 2RR11 2VXRA 5T5PA 1C4RA 1K5MA 1H8VA 4HVOA 3RZZA 1GYKA 2AUYA 4YGEA 1EAH3 2V5YA 3AMHA 2IWGB 1N3QA 4OHXA 2QCSB 5KXEA 5AC93 1OOPC 5FAXA 4AG4A 5AC92 1PNFA 1WGPA 1S0BA 4COZA 1G8WA 1Z7S1 4KGQA 1NY71 3GBFA 4ZU4A 1UIJA 1PHMA 2WFPA 3VBSB 1KXGA 2JKBA 2PA7A 4KU7A 1TQ5A 2PLV3 3MF9A 5AVPA 1AR73 1VAKA 3MZHA 2PLV2 4MXVA 4CEWC 1RMU1 1AR72 2RS53 3AMMA 3VZMA 3H7YA 1SLCA 3AXDA 4L97A 3JBG3 2JICA 3GHMA 1MQTA 4CDUB 2FBEA 2RS52 4KGGA 3JBG2 3TB0A 4AEKA 4F3JA 1FPN1 3AXEA 4YGBA 1DIWA 1PO13 2MEV1 2YY1A 2K9ZA 3AZVA 4GMP3 1H30A 2ZGTA 1C57A 5T54A 3VDDC 4JGYC 4RGGA 1QOTA 1PO12 3MLLA 3ASIA 1UAIA 4AEJA 1XE7A 5C8CC 3MIBA 5GLVA 2I2SA 1QWRA 2PHFA 4IV3C 2HWF2 3J4UH 3JD72 4BOWA 4NO4A 1W6NB 2PQQA 3VBRA 5I93A 3MYXA 4URTA 4AQ6A 4HN0A 4OULA 3FHIB 1HQNA 3WQ7A 5CB7A 2QE3A 4IEZA 1PMIA 5LK7B 4TWTA 4XTPA 2O1QA 4PLNA 1VBE3 1X7NA 1JYIA 4LHNA 1R1ZA 2QKDA 4QGNA 4Q27A 5AFEA 3NV4A 1RUNA 1ZBA3 1RJ7A 1KD7A 1VBE2 4AVTA 1X82A 2QVSB 2QDNA 1LB2A 1VJ2A 3B02A 3CF6E 3OBTA 2DTYA 1H9WA 2Z69A 4Y20B 2QNKA 2R30A 3THPA 3VL9A 1XU1A 1OQ1A 1LOBA 4XETA 4SBVA 2WA4A 5GZEA 5FO9B 4ES8A 5LRSA 4XILA 2ZGRA 1X8MA 1DGWA 3I59B 1JUHA 4B8EA 1I6XA 3JB8A 4JRAA 3RG0A 1KFUL 1XNBA 1AJOA 1XYOA 1V6LA 1ZRDA 1IGOA 3C2UA 3JCIA 4ITCA 4LUKA 2R0HA 1WW7A 3ALQA 1SFNA 4AEDC 2PHUA 1RUC3 3B9CA 1U5ZA 3WG3A 1F5JA 5CNAA 5CA6A 3MLKA 4WM8C 1RUC2 4XJWA 3ZSLA 2O8OA 3WDYA 2JECA 4ZKTB 4LHKA 5BNNC 3OCPA 3QLQA 1QQP1 2BEOA 2AH2A 3T1MA 4Q4Y3 4YZ5A 3AP6A 3AP4A 1PGSA 4NOTA 2K2SA 3ZIXA 1W6PB 3NAPA 4Q4Y2 1VBD3 1VRH1 4COYA 1HXS1 3ZN6A 5JCTA 5BNPB 2D6LX 1U5YA 1VBD2 2A5ZA 3RYPA 3ZSEA 3IDBB 4KWLA 2DUPA 2JX9A 1DQ4A 1GANA 1NOVA 4R9DA 4XPVA 4KL1A 5JLVA 4IESA 3E97A 3FLTA 4GA9A 2R0FA 4P5HA 2IXIA 2GN3A 3FUOA 4F83A 3AP5A 4AQ2A 4X6QB 1X33A 3UKVA 1ZRFA 1AR91 1U0AA 3IWZA 3VBOA 5GALA 4AI3A 4OLLA 3SCHA 1IKPA 4EJRA 1OSGA 5FTTC 1RUD1 3KT7A 5C33A 4QQOA 1REDA 3RRDA 4RGAA 3VBRB 1S55A 3D5OA 2YDEA 2ARBA 2D40A 4BWOA 5KXCA 2HYKA 5E89A 2DVDA 4DY3A 5T52A 3L9JT 3USUA 5EZWA 4TYSA 2ZCWA 1QMJA 4YGDA 4PF5A 1RUJ1 3KCXA 1GBGA 4XFHA 1NA1A 1S0CA 3M3QA 1XRUA 3GNEA 1R081 3NW4A 3ZFEA 2HWC3 1DBNA 4L8QA 1VAMA 1QDCA 5I91A 3IM0A 3BOWA 4I0WB 2HWC2 1R1A3 3LZZA 2LUWA 3B93A 1ZYBA 1W6OB 3VHOA 4HVRA 1B09A 5BNOA 1KITA 4Q29A 2WWSA 1WCKA 3SITA 2ET7A 4AQTA 1A8DA 5L73A 1I9RA 1NE4A 3IKWA 4IEOA 1RUE3 4WM7C 4XMIA 4OHYA 4DNYA 2A7AA 2GZWA 4YM0A 3AK0A 2R041 1RUH3 3TN93 3VBFC 1RUE2 1ZREA 1RUI1 2YROA 4LUMA 5C8WA 2F6BA 1O3QA 4IV1A 5AFBA 1LHVA 3TN92 3EHKA 5JOZA 4P9XA 4R52A 3PVBB 4Q8LA 2CGNA 1I1EA 1LHOA 3DN7A 5FPXA 1IZ3A 4K9SA 1OPMA 4AI8A 4CDQC 4CTEA 1JBCA 5CFCC 4JQRA 3W58A 5EV7A 1O3RA 2D6KA 5BNQA 4ORFA 1Q43A 3ZYJB 3ZXGA 2H0VA 4LO7A 2N7GA 1W0OA 5HCAA 2WNUB 4JV4A 5GKAC 3VBHB 3VKOA 1A8MA 5F6KA 3ST7A 4LA2A 2RS31 4ZXKA 3H1WA 3B69A 1S1AA 4XTMA 4WV8A 2OUJA 3SCFA 2RS11 2A6YA 3J8F1 4B4PA 1JUIA 2WFF1 4UW4A 1W0PA 4G4FA 4IQPA 1KJLA 1COV3 1SLAA 1VBB3 1ND2B 2W08A 2QQPA 5K0UA 4K7JA 4LBJA 3ZVXA 4XDQA 3I8TA 3PJYA 4EN0A 2ZMKA 1PZ7A 4XXPA 3GF6A 3O7OA 1FNZA 4LTAA 4M3CF 3DKWA 5E8AA 3NWKA 2E53A 3LB9A 3TYJA 2JEMA 1OQDA 1RUOA 3JZVA 4Z8BA 4AHYA 4AWDA 3EXUA 3HT1A 5KWRA 4HKWA 1CAVA 5KC5A 2BVBA 2NPIA 1MVEA 1ZZ7A 2JE9A 3DL3A 1Q8SA 1TNRA 2NN8A 1EPZA 5EYYA 4E4ZA 3CEWA 3HIFA 5LRRA 1FXZA 2WA3A 1GICA 5KXDA 2EF6A 3O0WA 4JGYA 2R063 4NN0A 3EJKA 2VOKA 5FO8B 1K5MC 1N47A 1YCIA 4BIOA 2Q30A 4Y4YA 4AHXA 3ZPYA 2QJVA 1V00A 4SLIA 4X8PA 2BWAA 1H2LA 2E7QA 4X8NA 5CFDC 4W6WA 1RHI3 4QM8A 4E4DX 3V65A 2DVGA 2A71A 3WDVA 1ZBE1 5GLTA 2IXJA 4R9CA 1ZRRA 3WLUA 3CNAA 4RR3B 5TSWA 3FBYA 3KMHA 1LENA 1ENSA 2GDFA 2R073 5DUXA 4N43C 4BLIA 1JTZX 1IOAA 4I01A 4XYXA 3CL1A 4B7EA 2R072 1NLRA 4IV1B 3NL1A 3ZXJA 3ZMOA 1AYN3 4E9KA 1UD1A 4GMP0 4I02A 1QH6A 1UKRA 3OGGA 3WP5A 4Y1YA 5C4WC 1RJ8A 1DYKA 4N7IA 1AYN2 4IXLA 2VNGA 5GZDA 4A7YA 2P3KA 2FZ1A 1UF2C 5IK8A 4FQZA 1VALA 5FFOC 1R093 3J9SA 1CJPA 4XHBA 2HWB3 1LHUA 3ZMNA 4F7ZA 5CIRA 2BNNA 3WW4A 2DU0A 1PIV3 1R092 4PJYA 2HWB2 2ZGMA 2EXIA 3AKQA 4DINB 3OYWA 4K21A 3M7AA 3B9IA 3PMEA 3S0MA 5BYNA 2HEVF 1WW6A 4QQ2A 1AXZA 5SV5A 4KWKA 1J1TA 4WVZA 4WM8A 4Q0PA 3V0AA 2IXCA 3RJ2X 1OOPB 5FOJB 3RQ0A 5D8AB 3NV2A 2XWBB 1D4VB 1SBDA 3ZO0B 2YUEA 2AZ5A 1ONAA 2UY8A 2WT0A 2ZX1A 5A33A 4HPKB 3VKMA 4HFSA 1DF0A 3ZN5A 1APNA 2CAUA 4AQSA 2FHRA 3AYCA 3JQXA 4TZDA 3POSA 1D4M2 5CVRA 2ZX3A 4K20A 3TAYA 4FPYA 5CG9A 3MW3A 4CEWB 2PTMA 4YSFA 1ZZ9A 2AYHA 1LKNA 2DWRA 4AYUA 2VVDA 3V0BB 3H9AA 1LGBA 3OD4A 3EO6A 1OFSA 4RS5B 5E88A 1AR61 1SBEA 4EN9B 4BCUA 4ISQA 3WD5A 1DZRA 4MGZE 3VDDB 2OA2A 5A3MA 1Y9QA 2Y0IA 4BH9A 1QH7A 2Y38A 5H9SA 3OPZA 5C8CB 1VBC3 2H6BA 4FSJA 1F8VA 1UX6A 5L7OA 5LK5A 1ALYA 3AMQA 4IV3B 5EFUA 1BMV2 2WQZC 3A0KA 4PIZA 3WW2A 1WMFA 1PGW1 3AKSA 2VMGA 2W68A 4OUSA 5IUQA 4Q0UA 1NCRA 2BNMA 3HAGA 4Y1VA 4C0BA 3QD6A 2WZR2 4INDA 2ZGKA 1O4TA 2ENRA 3KGLA 4XF3A 4C1WA 1O5LA 3UKTA 2BGCA 1ZRCA 4E2QA 4KG0A 1YFYA 4YW2A 3VGIA 1AX2A 3SNMA 1F31A 1MEC1 5J36A 4HK8A 4XFCA 4WVMA 5BPXA 4G9SB 1F5FA 5JI9A 3IPVB 4FXGB 3SXWA 3GZAA 1C8M1 2A75A 4QHBA 5FLIA 1H1IA 2NP0A 3VBFA 1QJZA 3QACA 3T1LA 4AEDB 4EWDA 1OA2A 3VBOC 4CDWB 4XF4A 1QKQA 3SH4A 2FZ2A 5GM0A 3PVNA 4IEPA 2EALA 5BNNB 1ULFA 5CFCA 1CAUB 2D93A 1GZWA 1TME3 5DDJ3 4ZU5A 1U5IA 1S0EA 2PELA 5JI7A 2JG8A 4PDWA 1C1LA 2E51A 2PHRA 1TME2 4MUVA 1NA1C 4FPOB 3E6DA 1QOOA 1C8NA 1YNAA 2ZGSA 3SH3A 3ZFEC 4LULA 3LKJA 1FMD1 1W6MB 2P3IA 4JGZA 4CP1A 1AZDA 4HBNA 4Y24A 2B39A 4BIFA 1GQGA 4C0HA 2GAUA 3ETQA 4XJUA 5JDBA 4Z92B 3QCWA 3DUIA 2UWCA 1A6CA 2CY6A 3HWJA 4E4SA 5BNOC 4H14A 5DUVA 5ABJB 4MGKE 1CAXB 2VQ0A 3N7JA 1DHKB 2HWD1 4WZFA 1RUF3 1CGPA 4O9GA 4J1WA 3WDXA 4LBQD 3RYKA 4XFGA 1RUF2 2NYYA 4YW4A 5I0UA 4P9JA 4BQ1A 1G9AA 1ND3B 4GH4A 2YPJA 2JG9A 3MIEA 2NQYA 5DG2A 1RMU3 4PIYA 1QJY3 1FV2A 2IXLA 4LE3A 2XJVA 3WINE 1QJY2 1AYM3 1FPN3 4Q4W1 3ZFFC 3U0ZA 1WCSA 1OFNA 2RMU1 1AYM2 4UW5A 2MEV3 2XG3A 2R1BA 3AFKA 2DCKA 4Y22B 5ACA1 5K8SA 2E9QA 3UL2A 2VW1A 1G9FA 5FQ0A 1AL22 1QY4A 5IK4A 1Y43B 1KS5A 1C5HA 1V9U3 2ZHKA 1DQ1A 1G9CA 4YW5A 2ZGPA 3E6CC 1RUG1 2WLPA 1LECA 1EAH2 4D7TA 4YZ1A 4OI0A 1IS6A 1RVF1 1AR81 3SLIA 5CFDA 4FVVA 4FPJA 1JYCA 3WDTA 1CR7A 1V6IA 5DZFA 4Q8KA 3WQ1A 4LBOA 4Y1XA 5DUWA 3SH5A 1D2QA 4Q0SA 4B4QA 4WM7B 3ECQA 4YVSC 3IMNA 1PVC1 2YZ4A 3AKPA 4UXAA 4N43A 1ZZCA 2E7TA 5K0UC 4AW7A 1NXMA 1XQNA 2QZ3A 1W39A 1HRV3 1Q56A 2YXSA 4UBGA 1PK6A 3B00A 3RMYA 1HRV2 2R6QA 3IDEA 5C4WA 4MGIE 1N1YA 1SBFA 4CDQB 2AREA 4P9WA 2X53S 2Q5TA 3L2YA 4ATFA 3A4UA 3S7EA 4BA6A 1OA4A 1Q8OA 4Q4X1 2ZHLA 2DVBA 5F5QA 1HV1A 2TNFA 2EIGA 5J3UA 2NMOA 4KG8A 4QGMA 1CX4A 1XNKA 3WP6A 5CU1A 2WIIB 2D5FA 4XFAA 3L2HA 3TOJA 2GC3A 1UKGA 3W9AA 1DLLA 4GB31 1ULGA 1PGL1 3S6PA 1HQWA 3CO2A 4XOGA 1Q3EA 4FOYA 4G3YC 4AK3A 2TEPA 4X6RB 2XUMA 2Z79A 3BIWE 2CL2A 2DTWA 3POWA 3RSJA 4ASMB 1HRI3 2I07B 3R4SA 5D1IA 1HRI2 4YG0A 1DZTA 2BVVA 3KB5A 1OA3A 2B45X 3R4DB 4YG6A 2DFBA 4XHXA 2ZKNA 5AC91 2IZWA 2A73B 3VLBB 1ZBA2 2DF7A 4YNIA 4XEZA 4EN8B 1W6QB 1KDKA 3WQ0A 2JXAA 3S7IA 1PM7A 1C28A 2PLV1 3ENRA 4QPGB 4Y1ZA 1H1AA 4M00A 1AR71 2JD4A 1FX5A 1RTVA 1UU6A 4Q1PA 2XBO3 2RS51 1K5MB 3JBG1 2XKPA 1PO23 4K40A 4MYEA 2XBO2 2D6PA 4RQPC 3PMSA 3WX5A 4S2DA 1PO22 5T50A 1V6KA 2EXJA 5DUUA 5C9AC 3X29B 1PO11 1Y3TA 4GMP1 3N35A 2A70A 4MXWA 1YIFA 3K48A 2X5IA 3N3HA 3U11A 3JB4C 2LALA