2GNFA

Protein kinase a fivefold mutant model of rho-kinase with y-27632
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
341
structure length
339
Chain Sequence
SEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTIGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYMPGGDMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIKVADFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Structural analysis of protein kinase A mutants with Rho-kinase inhibitor specificity
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
total genus 107
structure length 339
sequence length 341
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2gnfA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2gnfA02
3W8QA 4CD0A 3SA0A 4IWOA 3IW5A 3EMGA 3RALA 4D2TA 4I93A 2GNHA 2WTVA 2UW8A 4ZY4A 4KIOA 4BBMA 3CKXA 4BDFA 1WBVA 1ZMUA 2OZOA 1DI9A 1JWHA 2PVNA 2UVZA 3EN9A 1ZYDA 3KRRA 2A1AB 1TQMA 2P4IA 2ZYBA 2Y4PA 4HNFA 5HORA 2UW7A 1XBBA 4YP8A 4RJ7A 3BLQA 2JDOA 1H8FA 2PE2A 5JZNA 2ZB1A 4MYGA 5KBQA 4JQ7A 4U40A 2CLQA 3EB0A 5M44A 3R1NA 4DTBA 3IOKA 4CYIA 3H9OA 4KBAA 1OKZA 4JAIA 5ACKA 2XA4A 3R7YA 4O21A 4WKQA 1YQJA 4FV0A 2VU3A 1SVGA 4IADA 4NW6A 4TZRA 5A6OA 4G9RA 3FY2A 4BZNA 3LJ1A 3R8LA 3Q96A 5BVKA 3SG9A 3ALNA 5DEYA 3COKA 4KBCA 5K0XA 5IUHA 4YZBA 4DEBA 2Z7LA 5CALA 4DEDA 4GS6A 4HJOA 2C5XA 4DFYA 4FSZA 1DI8A 3DT1A 4IAIA 5E91A 5EK7A 4HCVA 4B6LA 3PSDA 4I92A 4AFEA 4TYIA 4DEIA 5KO1A 3KU2A 3A7FA 3D4QA 3A8XA 4O96A 3LMIA 3MBLA 4IAKA 2RFEA 5DFPA 1OKWA 2IVSA 2Y4IB 3PIYA 4WBBB 3DAJA 5CSVA 5HG9A 2YN8A 4BCFA 4BDGA 3KK9A 3EN7A 1TKIA 4G6NA 3WZKA 1KWPA 3BV3A 2GTNA 4YTHA 4GL9A 3ORLA 3ZXTA 4WUAA 2GS2A 3TIYA 5CS6A 5LCKA 4IM3A 3CD8A 3MVLA 2C6OA 3BHVA 3HV4A 4MCVA 4RIYB 5HG8A 4BCIA 5IPJA 4GIIA 3R04A 4FI1A 2YACA 3T3UA 3FXWA 3UZPA 5CQUA 4NW5A 5AP5A 3QLFA 4NH1A 4L3JA 3ELJA 3FSKA 3TZ8A 4Z3VA 4YURA 2F57A 4CG8A 3PFQA 4WSQA 3REPA 3L9MA 2H6DA 3LOKA 4CFNA 4AN9A 2BAJA 4RA4A 2BDFA 2ETMA 3FKLA 4F08A 1GNGA 4U79A 1M14A 3ZLWA 3ATTA 3PPZA 3NWWA 5CNNA 3FC2A 4DEGA 4XS2A 5FUTA 2CDZA 5EG3A 1WFCA 2VO7A 2Y4IC 3MW1A 4L45A 2WQOA 4QRCA 3C9WA 2VO0A 3CXWA 3F3VA 2H9VA 3P86A 3LCSA 3HA8A 4O27B 3QRTA 4MF1A 3A60A 4QYFA 5TO8A 3EFWA 2QU6A 2E9UA 4AU8A 3DDPA 3RJCA 3HAMA 5DA3A 4R7BA 3L9PA 4FTJA 4XP2A 2WTDA 4DLJA 4ZTMA 3PP0A 5A4TA 3EHAA 5M53A 5J1WA 3QC4A 4TY1A 3NNXA 5M06A 5AV1A 4ACMA 2PE1A 3WE8A 4ZIMA 3RPOA 4IDTA 4BDHA 5DT4A 2OW3A 2GU8A 3GCUA 5IH6A 4AWIA 5HNIX 1OPLA 2FA2A 3PWYA 3QU0A 2XZSA 2P2IA 1H24A 1U59A 1UNLA 2OO8X 2XJ0A 3DK7A 3DTWA 3MS9A 1OL6A 5FWKK 2VTSA 3QD0A 4BBEA 3G6HA 2OJGA 1JBPE 1YVJA 2QKWB 2X8DA 4U3YA 4KD1A 4YPSA 4CFFA 3ZONA 4C36A 1NVRA 5FXRA 3K3IA 3I6UA 1JKSA 2ERKA 2OJIA 3C4WA 5GINE 5HD7A 5HNBA 1A06A 2YJSA 2X2LA 2AC3A 4FL2A 4FZAB 1HCKA 4M12A 1OITA 3Q53A 4I5PA 2QOCA 2SRCA 1W84A 4IEBA 4R8QA 5K4JA 4DGNA 3LQ3A 2IZUA 3ZLYA 2WMTA 2Z7RA 3FI2A 3FPMA 4Y8DA 5AUXA 4DN5A 1WVWA 5CXHA 2YCSA 2GFCA 1GZNA 2BRGA 1LEWA 2PPQA 3MB6A 2J5FA 1KE5A 1FVTA 1IA8A 2JITA 4O6EA 4QYEA 4I0SA 5HCXA 4F7LA 2YZLA 1ZYCA 2YZAA 2Y6MA 2AC5A 4J1RA 2QOHA 1E9HA 5B2LA 4FV9A 2OXDA 4DFNA 5CTPA 3ZBFA 4QMUA 1P4OA 2OF2A 3FZPA 3EQFA 4FOCA 4XG9A 3F5GA 2IJMA 2C6LA 3UJGA 3DJ7A 3SV0A 5KKRB 2P0CA 1IASA 3GC9A 3Q9XA 1H07A 3MGYA 2VO6A 1ZYLA 4MNEA 4NIFA 4XLIA 3LFCA 4W8DA 4IZYA 5FEDA 2UZUE 4YTFA 2X8EA 2UZTA 2J0JA 4WNOA 2W1ZA 3W10A 2CCHA 4NUSA 5I3OA 3FXXA 1MRUA 5JK3A 2VNWA 5DT3A 3U4UA 4BCGA 5CU2A 3VS2A 4X21A 3OCSA 1K3AA 5DI1A 3FKOA 1PF8A 5T3QA 4F1TA 2O65A 2I0YA 4ALWA 4AA5A 4GH2A 3DPKA 5IQFA 3QD3A 3SXSA 3ZSIA 4RFMA 3DNEA 4D2VA 3EJ1A 2X39A 3V5PA 3VBWA 3LFNA 4B8MA 3KXZA 4IBMA 1P4FA 3OTUA 3FZSA 3PVGA 2F9GA 3DZQA 4FG9A 4XV3A 5AUWA 3VO3A 5KKRC 4FIHA 4MXAA 2J50A 3EFKA 1U46A 4UMPA 5DNRA 2O2UA 4JQEA 5JEBA 2I0EA 2VZ6A 2R3RA 2IZRA 3R2BA 3PYYA 5C03A 4NFMA 2BTRA 5HTIA 3QTUA 4BKJA 4F9CA 3ZXZA 4BYIA 3KULA 4PPCA 3F5UA 2B7AA 4LOQA 5CI7A 1XH8A 3ROYA 4BCJA 2W5BA 4KSQA 4LGHA 4O22A 4YTCA 1XBAA 3L8PA 4N4SA 4FV2A 2IVUA 2OSCA 4PF4A 2WTIA 4I0TA 3AXWA 5CX9A 3A2CA 4E6DA 4XJ0A 1S9IA 3UPXA 4MKCA 5J95A 1KE9A 1H1QA 5I0BA 4S31A 4ANSA 5J7HA 3N4TA 3HMOA 4L00A 4JI9A 3TNPC 5IKWA 5J9ZA 4QTDA 3D15A 4FKWA 4UZDA 4I41A 5J9LA 1YWNA 2VTTA 3RWQA 2UZLA 1UWHA 3ZH8A 2BZKB 1YHVA 3LFSA 4WSYA 5ANKA 2OJFE 5IQHA 5HVKA 3L8VA 3U55A 2R3HA 3CP9A 3SKCA 1PMNA 4TPTA 3UVRA 3R21A 2PHKA 2PSQA 3MI9A 5D1JA 4N0SA 4EWHA 3MWUA 2XMYA 4FV1A 3UYTA 4OLIA 2XCKA 3QYWA 3CJFA 3IW4A 5HOAA 4OAVB 4D2SA 1BKXA 3LMGA 4C3FA 2XNEA 5GIPE 5M4CA 1W0XC 2C5OA 1H27A 1XH9A 3KMWA 2F7XE 1I44A 4Y73A 5IEXA 4BTMA 4FTIA 4A9SA 2VWXA 3D0EA 3FLSA 2XKDA 4LM5A 3I4BA 4IE9A 2JDSA 3RK5A 3D7TB 4FKGA 2ETKA 1PXLA 4OW8A 4E26A 5AAEA 2F7EE 5EDPA 3CBLA 3SW4A 4YJRA 3FMMA 4M8TA 5CSHA 2OI4X 5L8JA 3AG9A 4HVHA 2PVJA 3U6JA 3LW0A 4DH5A 4O0UA 3EFJA 4HZRA 4O38A 5IZFA 4U41A 1CDKA 1B38A 2W06A 5AP3A 4C58A 4EONA 3VBXA 3OFMA 4LMUA 3BEAA 3V5LA 1SVHA 2P33A 3MY1A 3NUSA 1Z57A 4X2NA 1WBWA 4EH4A 4K77A 5A4EA 1SYKA 3V8SA 1KE8A 3MH0A 3L8XA 3OBJA 1XH6A 2V55A 2VTJA 5IDNA 5A9UA 4D2PA 4DF3A 3C5UA 3TUCA 2ITXA 3V8WA 2J0IA 3NR9A 1YDSE 4FIEA 3KK8A 3OVVA 4OTWA 4PRJA 5F95A 3GCQA 4FGRA 3OCBA 3QFVA 4O86A 2BRNA 4CXAA 2EXCX 3W8LA 4F65A 2VWBA 3ORIA 3G9NA 3IW7A 4KIPA 4M69A 1H28A 3A7JA 2JDRA 3Q32A 3OW4A 4G3EA 3C51A 4CKIA 3MA3A 4YNOA 4YJTA 4ALVA 3OT3A 3FLZA 5AM6A 3PJ2A 2QURA 3CY2A 4NTSA 3RVGA 5M09A 1REJA 1H01A 4DTAA 3TL8A 1H1SA 4EOJA 4F0IA 1U54B 2YAAA 5E8XA 4FV4A 3VUMA 1OI9A 1ZXEA 3OY1A 2P55A 3O7LD 4EOIA 2FUMA 4O0RA 4TYHB 1XKKA 2R3QA 1ZOGA 4ITJA 4CFMA 1OM1A 4D2WA 2I0HA 2G2FA 4LRJA 2VWUA 5FXQA 2V5QA 5A46A 3R7GA 3R73A 4FTKA 2JDVA 3FMLA 2QODA 1TVOA 4RPVA 2Q83A 3ODZX 4E4LA 1XJDA 5ANDA 2IN6A 3ALOA 4IAFA 4U80A 4JL9A 3THBA 3GOPA 4FC0A 2HWPA 3I60A 5B2KA 5I9YA 4YC6A 2J7TA 5HCYA 3C50A 5IA4A 2FVDA 2G1TA 3MVHA 3ZBXA 4ASEA 4Z16A 2ITOA 3FAAA 5BUJA 2WKMA 2XYUA 3UQCA 5L2QA 3R1YA 3UG2A 5BUEA 2Q0NA 3KN6A 3MFTA 2R7IA 3PG1A 5CANA 2OH4A 3UC3A 1ZLTA 1JLUE 3QWJA 2ZDTA 4LL5A 5DT0A 3TG1A 3KRLA 4IHPA 3EQDA 4Y85A 4O1PA 4GG7A 3ZSGA 1JVPP 4IB5A 3AC5A 2R3FA 5EQEA 2VNYA 3AD5A 3R01A 3OXZA 3FZOA 2YERA 4FV5A 4CMTA 4FVPA 1Y6AA 2WMRA 3AC1A 1H4LA 3ULZA 5A54A 2VUWA 5H9BA 5EHLA 2J0MB 3NRMA 4YHTA 4BDCA 2PUIA 3BEGA 4MEDA 4G16A 4K0YA 3U6HA 3L9LA 3HUCA 3VS0A 2HY0A 2Y7JA 3DKOA 4TT7A 2HZIA 3P7AA 1V1KA 5CF4A 2VTLA 4KRDA 4EK6A 5FTQA 3G0EA 4R77A 4BHZA 1PXKA 4R3PA 4G31A 4RFZA 5CEQA 2JBOA 3E7VA 3F5PA 3LIJA 2FO0A 3K5VA 4XOZA 4ANLA 5IQCA 4IVCA 3TZ9A 3PY0A 1PW2A 4FEVA 1VJYA 3F3WA 4NKAA 1J1BA 4U7ZA 1FGIA 3VW8A 3QTZA 4E4XA 3I7BA 5IQEA 4FZ6A 4LOPA 2HYYA 2XVDA 1R0EA 1RE8A 3QRKA 3ITZA 1I09A 3QCSA 4EBVA 3GU7A 3QHWA 5AUZA 3ORTA 4IX5A 4KKEA 4DH8A 4L3PA 1UU9A 4FA2A 4LGGA 4EEVA 3NUUA 3FXZA 4QD6A 3KXXA 3UE4A 4I5HA 3QGYA 5DGZA 4D2RA 3ZLXA 5AA8A 2VWWA 1H25A 1UU7A 1UVRA 1BUHA 4AW2A 4CEGA 5LOHA 4K18A 4F1MA 4WG5A 1KE6A 4E73A 3R22A 5FM2A 1A9UA 4EHEA 4RIYA 5M4FA 4X2JA 4QMOA 1MQ4A 4XUFA 1Q8YA 2H96A 3UOHA 2WD1A 3F9NA 3FMJA 4HYHA 4BI2A 3NVMB 1PYEA 1OGUA 4QP1A 5DHJA 1IRKA 2E9PA 4K2RA 4PPBA 4O7RA 3A7IA 2CPKE 4NM5A 3AT3A 1F0QA 3QC9A 1W98A 1HCLA 4FKVA 4FNYA 5AP7A 4EC8A 3PA4A 5DN3A 2JBPA 4HVDA 3V04A 2QOIA 3QTQA 4BCNA 1OECA 2BAKA 1FPUA 4I6QA 4CQGA 4GVAA 4TW9A 3DQXA 3VULA 4BCHA 2GDOA 4RC4A 1UU8A 4BKZA 4J96A 3H0ZA 2ITWA 2VTMA 2PL0A 4ANMA 4EQUA 5I9UA 5FP6A 4K11A 5G6VA 4YLJA 3BELA 4YHFA 3FQSA 4J95A 4GKIA 2W7XA 2C69A 4FYNA 4IH8A 3PWDA 4XG2A 3DKCA 4Y95A 4YGAA 5L2IA 4F9BA 2PUPA 1GZ8A 4YZCA 5BVFA 4D1ZA 3U6IA 4TWNA 3FSFA 3TXOA 4NTTA 3PA3A 5DBXA 4BI0A 4MBJA 3RAHA 2XKFA 1UNHA 1M2QA 4TXCA 3FJQE 3NYVA 4F4PA 2VTAA 3DOGA 3IDBA 4F99A 4OTIA 4UV0A 3U9NA 5LMKC 4F7NA 2BILB 2VX1A 2JC6A 2C6TA 2RG6A 3I7CA 4Q9SA 5IUGA 5IA5A 3KREA 5JGBA 2YCFA 1JSTA 4JQ8A 2R5TA 2YM8A 4QMQA 4AG8A 3IPHA 3TTJA 2WOTA 3MN3A 2R0IA 2UW6A 2IVVA 3PRFA 2XM9A 3LQ8A 2NO3A 2X6DA 3QZGA 4FSMA 3Q60A 2BKKA 1KV2A 1M17A 3ZUVA 4BIBA 3NUAA 2HELA 4O83A 4ZXTA 3JVRA 3C1XA 5CEIA 3BPRA 3Q5ZA 3LXKA 4AZTA 4BDDA 2HZ0A 3NUXA 4YO4A 4EHZA 4FKRA 4PQNA 2PZYA 2GFSA 3HMIA 3IOPA 2WEIA 4O1OA 3NZ0A 5FRIA 4BZOA 3BZ3A 3VS5A 1H0VA 4QPMA 3U4WA 3NSZA 3HMPA 2LGCA 4GEOA 5E8UA 3A4OX 2X4ZA 5A14A 4N6ZA 4WBOA 3BQCA 5HO6A 3WYYA 4ENXA 5FDPA 5EI6A 3ZMMA 4PMSA 4OR5A 4UYNA 4FT5A 4FL1A 3FLNC 3CQUA 4Z9LA 2QONA 4ZZMA 3MJ1A 2O8YA 3LCOA 4MWIA 3T9TA 3QZFA 3D14A 2Q0BA 4FZFB 4QMTA 4O7SA 4EWQA 3OW3A 4K33A 5F1ZA 2GQRA 3VRZA 3PY3A 5BMMA 1CM8A 1YOLA 1QPCA 3IONA 5HG5A 2VTIA 3H30A 4WNKA 4RRVA 2O64A 1YI4A 4QYYA 5EW3A 3WF6A 2HAKA 5I5ZA 4FIJA 4NEUA 3GI3A 4HCUA 2OWBA 2EB3A 1P2AA 4YSMA 2WU6A 1MRVA 2G2HA 3LFFA 5JN2A 2FB8A 5KE0A 4ZTRA 4F6WA 1WBOA 4KWPA 4QOXA 4Q2AA 3WE4A 4X6QC 3ZTXA 4BWPA 2VAGA 5JH6A 4E6AA 1X8BA 3ODYX 4WRGA 4CKJA 3PZEA 3WI6A 3PVWA 4IX3A 4ZTSA 4C4FA 4L9IA 2Z8CA 3Q4TA 4GG5A 5CASA 5E7RA 5DRBA 2WMSA 2ZV7A 5AAGA 5IUIA 3ORKA 5TKDA 2XNOA 3D5XA 3L1SA 3N4UA 4WD5A 3DFAA 1OPKA 4FT7A 5GZ9A 4QQ5A 2CKOA 3FMKA 3KL8A 4APCA 2EWAA 2JFLA 4G3DA 1Q97A 4WOVA 1FGKA 2QCSA 4GKHA 1AD5A 3TNIA 3HRBA 4TN6A 4V01A 2OIDA 2W9ZB 4QTBA 1ZAOA 1BMKA 2IVTA 3DFCB 3RPVA 4EOSA 1KV1A 4BCMA 3NX8A 4RJ5A 2X1NA 2Z7SA 1Q8ZA 3MY0A 2HK5A 3SRVB 3CR0A 5FP5A 2R3NA 1XR1A 1JSUA 3POOA 4I6HA 4TKSA 5FD2A 5K5NA 5IQIA 3OEFX 4BWKA 2JGZA 1PYXA 2R4BA 2Y0AA 3W1FA 4LYNA 3KB7A 4F70A 4B8LA 4IVAA 2DS1A 3DJ5A 3T9IA 2UZDA 4A4LA 2ZM3A 4EYMA 1J1CA 3DXPA 4KUJA 3P7BA 2JIUA 5G1XA 4JBQA 2J51A 2OK1A 5B0XA 4LG4A 4RC2A 4C4IA 4FF8A 4FKPA 4BC6A 5IEYA 3G9LX 4JG8A 5CSWA 4ZOGA 4XEYA 3BBWA 5IH5A 4I0RA 3D2KA 3NCZA 2GMXA 3MPMA 1R1WA 2UUEA 5HE0A 1H1WA 4GIHA 4KRCA 5HG7A 3VUIA 4RIWB 4F9WA 2XIKA 3S4QA 3CTQA 2C68A 1S9JA 2ITZA 3LJ2A 4FBXA 4XG8A 2WB8A 5ANEA 4FSYA 3D7TA 3UP7A 3M11A 3Q9WA 4D5KA 2XNBA 5IG1A 4QYGA 4U97A 3VS4A 5DYJA 1FOTA 4BN1A 4FKLA 3AOXA 3UG1A 2WQEA 4AZFA 3ACKA 1ERKA 1UNGA 2NRYA 2UV2A 3FMHA 3OWPA 2YDJA 2BCJA 1T46A 5CT7A 5ICPA 3P08A 1LUFA 4IVDA 4QP4A 4NL0A 3RINA 2C3KA 2UZBA 4L44A 2V0DA 5DVRA 4C3PA 1R78A 5IU2A 3ORXA 4UX9A 4JX7A 4B9DA 2ZVAA 3OBGA 4EK3A 4AX8A 4YO6A 3HP5A 1CTPE 3F82A 3KEXA 1WMKA 3MA6A 5DR6A 4A07A 2IG7A 2XK6A 3C4ZA 4DFLA 4V04A 4AE6A 4UBAA 4FUXA 4P4CA 3PIZA 3KCKA 1NA7A 5HU9A 5CF6A 3ORZA 1YW2A 2RGPA 4RZVA 3MB7A 1B39A 5AR2A 2HZNA 3QQLA 1GIIA 3QAME 5IISA 2G9XA 4BTJA 5CZHA 2XK3A 4I5CA 4EK8A 3PY1A 2AYPA 3LZBA 3MIAA 4MXZA 3AMBA 3N4VA 2R3IA 4AACA 5JQ5A 5K3YA 5LVOA 5D9HA 5KHXA 2XNMA 4MX9A 2ZV2A 4ZSGA 3OF0A 2BPMA 4OTPA 1IA9A 4IANA 4H05A 3IGGA 4KS7A 3N51A 5CWZA 3NCGA 4L8MA 5FG8A 4O84A 4E4NA 5C8KA 3SVVA 3OEZA 3VBQA 3ZM4A 3UNJA 2BIYA 4D0XA 3R6XA 3FZTA 3OUKA 2X7GA 3QWKA 4PX6A 3RK7A 4ZTNA 2GHLA 3GQLA 3MYGA 1U54A 3WF8A 1WBPA 4C02A 1PRYA 5GIOE 3KXNA 4HW7A 4LUEA 4FOBA 4TYHA 4YNEA 4I94A 1GZOA 2QHMA 3HEGA 2C30A 4BDIA 1ZZLA 4O2PA 2XIYA 3MV5A 3VUGA 2ONLA 2E9NA 4X0MA 3ZZWA 4C37A 5HHWA 1H1PA 4O91A 2PMNX 4PPAA 2UVXA 5BVEA 4HYIA 4R1YA 3EL8A 2B1PA 4YLKA 2HOGA 4YC3A 4C38A 1HOWA 5JRQA 4AUAA 4ACDA 3MFRA 3F3ZA 2UVYA 4I3ZA 3EKNA 3R02A 5AMNA 2WQMA 4TRLA 2JKKA 3HL7A 2JAVA 3V51A 2WMBA 2CGXA 3T3VA 2J0KA 1OKVA 4JS8A 2Z2WA 4MD9E 4QTCA 4DHFA 4DBXA 1U5QA 4FIFA 3UQFA 3KRXA 4RG0A 3UIMA 3DNDA 3HVCA 5EDQA 4C2VA 4C7TA 3HECA 1YDTE 3QF9A 4HGLA 3R7OA 3TDVA 1RQQA 4EL9A 3EQCA 3EN5A 5HBHA 3NUNA 2WU7A 2W1IA 4ANQA 3TIZA 3RPYA 4NM7A 5I4NA 2X4FA 4BZDA 2OZAB 2VGOA 3NLBA 3D94A 3OTVA 2YIXA 4LV5A 3UQGA 1FMKA 3PLAE 2CLXA 1VYWA 2R3JA 4XP0A 3DQWA 5FLFA 3DK3A 3AMYA 3FLWA 4RVMA 3WZDA 4PTCA 3R9NA 1WBNA 2FSTX 4FTOA 2VWVA 3OMVA 4FTAA 4BTKA 2YIRA 3MVJA 4JG6A 4QMSA 4CTCA 4IW0A 4K1BA 1OKYA 5AJQA 4EZ5A 1WBSA 4ZJJA 3O71A 4JDIA 5C9CA 4IMYA 3FI4A 4KIKB 5CF8A 2PVFA 3QHRA 4GUBA 3QGWA 3LKMA 5EYDA 1FVRA 4H3PA 3GVUA 5KMNA 3H10A 5L8LA 3GCVA 3ZDIA 4ITIA 2HENA 5HLPA 5AX3A 4CSVA 1NXKA 3H4JA 3SXFA 4ASDA 3SC1A 4DEEA 4DC2A 2W1DA 1YXTA 2CSNA 3WIKA 5FEEA 4FEXA 2YDKA 4AGWA 4R6VA 4GT4A 4XOYA 3W2PA 5IA1A 3E8CA 3QCXA 5AP4A 5HX6A 4KS8A 3E63A 4PDPA 4RBLA 4M84A 4BKYA 2X7FA 4U9AA 3QUPA 4V0GA 3HV7A 1M2RA 2UZOA 4FTQA 3QA8A 4FTMA 4C62A 4FT3A 4XG6A 4EH2A 4C4EA 3QTWA 5ETAA 4M0YA 3RAKA 3MY5A 3VUHA 2IWIA 4USEA 1JSVA 3ZRLA 4F7SA 2BR1A 2R3GA 3ORPA 1Q5KA 5LVNA 3TKIA 5H8GA 4X2GA 5E4HA 3OD6X 2JAMA 4JIAA 4OTFA 4C4JA 1GZKA 5J87A 3ATSA 4ZLYA 3OOGA 3GC0A 1NVSA 4C2WA 2NRUA 4CFWA 3DBDA 3E5AA 3E64A 5EYKA 3MVMA 3V6SA 5HICA 1O6KA 3TV7A 2BIKB 4QMXA 4B0GA 5LMKA 1G5SA 1WVXA 3WIGA 5CEOA 3KGAA 4D0WA 4C57A 5I9VA 2YITA 2KULA 4MH7A 3VQUA 4QMLA 3IQ7A 2XS0A 2ETRA 3UC4A 4DITA 3O23A 4JBOA 2YM5A 2GPHA 3L9NA 2QO2A 2WTCA 4AT3A 1ZRZA 4XNEA 5D10A 4HVSA 1Q8TA 2OJJA 4R3CA 4Y5HA 4FG7A 1CKJA 3EQIA 4G3GA 4AN3A 5L2WA 2F2UA 4NT4A 5K0KA 3R9OA 1YI3A 3ZCLA 4O7ZA 3FEGA 2W1FA 2XYNA 4A7CA 2CNUA 4E6CA 2QO7A 4QTEA 4R5SA 5EM6A 3PA5A 3SLSA 4Z7HA 5BQ0A 2JFMA 4QQJA 4AFJA 5BYYA 4DFUA 4CT2A 2E9OA 3E8EA 3POZA 4JT3A 3SAYA 3G0FA 3KF4A 1LP4A 2W99B 4FIIA 4NU1A 1QPDA 3W55A 4AGUA 4QQTA 5IA2A 2VN9A 3DKGA 1L3RE 4FKQA 4JG7A 4CNHA 5HVYA 4GFOA 4RMZA 3R0TA 4CCUA 1Y8GA 3TNHA 4L7FA 2YLEA 1R0PA 5CEKA 3DXQA 4H39A 1QCFA 1PKDA 3MTFA 2B53A 2PMLX 2WIPA 4C61A 3HA6A 2C6DA 3VN9A 3NGAA 5ETIA 4O0VA 4RWKA 2PE0A 4GYGA 3EWHA 2XNPA 3SOCA 4BHNA 1SNXA 4BDAA 1G8SA 3AD6A 2C0IA 4MK0A 4ZLZA 5HIEA 4U42A 4UMQA 4I22A 5A4LA 5C8NA 4XRLA 4IC8A 3Q2JA 3KVWA 3CCNA 4ZMFA 3OC1A 5L4QA 1YXUA 4PL4A 4DINA 2B0QA 3TNWA 1PXMA 2ZV9A 5CEMA 4YJOA 1WBTA 4YZ9A 3UODA 4GV1A 3EH9A 3BHHA 1FVVA 2VWZA 5M57A 1OBGA 4FV3A 2EB2A 4ONAA 3EQRA 3OXIA 4X3JA 2OG8A 3AC4A 2C3IB 3VJNA 2I40A 2WMVA 3EL7A 3BWJA 3C4XA 5AR5A 4EQCA 3GC8A 1M2PA 4KB8A 2RFSA 3C0HA 3B8RA 1PXJA 2PZPA 3RCDA 2DUVA 3LLTA 5LVMA 3VF9A 3PE1A 2E9VA 5HEZA 3ZU7A 2UW4A 3BYOA 3FWQA 3WZJA 5C8MA 2C1BA 2IZTA 3WYXA 4G6OA 1IAJA 4MNFA 1SMHA 3SGCA 1OL5A 2R3LA 4NJDA 4L6QA 2REIA 2R2PA 4BCQA 5TR6A 4FGBA 1KOBA 5EM8A 4CMOA 3PPJA 3LM5A 4NWMA 2X8IA 4I24A 3HMNA 4LMNA 5IA3A 4A9RA 5JSMA 5GJDA 1OMWA 2XK4A 3R83A 3PXQA 3GENA 3EQPA 4EZ7A 3C7QA 4O0XA 3D83A 3UZRA 4NK9A 5L2SA 3KN5A 3WILA 3RBWA 4MVFA 3COMA 3RZFA 1P5EA 4KKGA 5ANOA 1OUKA 4D9TA 3QTRA 4GJ3A 2V62A 3DKFA 3V3VA 5HCZA 3MH3A 3NNVA 3VRYA 4J71A 3ROCA 3SRVA 5CU6A 2ITVA 3IECA 4EBWA 4YSJA 3F2AA 3BHTA 5D11A 3KVXA 4QP8A 4CV9A 3HUBA 4C4HA 5CNOA 5HGIA 4C34A 2WFYA 4AS0A 4HVGA 2HZ4A 5F9EA 4PDSA 2ZM1A 3ZOSA 1GAGA 5KUPA 3CD3A 1PMVA 4XBUA 4ZAUA 3RNIA 3UOLA 4IACA 4GMYA 5C27A 3UO4A 3KXHA 3O7LB 4EH8A 5ACBC 5LVPA 2PU8A 2C6KA 4I20A 4AE9A 3PTGA 3O0GA 2BRMA 4CFVA 4N70A 2OU7A 1J7LA 3FMDA 2R7BA 4JDHA 5A4QA 3ID6C 4DFBA 3SG8A 2AUHA 3P0MA 4EYJA 2BMCA 2UZVA 3NIZA 1Y57A 2CGUA 4Y72A 4OBQA 3N9XA 4RJ6A 3DLSA 4ALUA 3C4FA 1YHWA 5AV3A 4X3FB 5CF5A 4RIWA 2GNIA 3LHJA 4NM3A 5HO8A 3IKAA 1Q24A 3ZO2A 3NAXA 4BIEA 1NW1A 4O7TA 3RI1A 4A9YA 3A7HA 3TV4A 3MSSA 3CPCA 5HVJA 4GK4A 4KBKA 1VEBA 4AF3A 3QTIA 3V5WA 1Q61A 4FVRA 2GNJA 5GJGA 3V5JA 4DT9A 3C4CA 2W4OA 4UYAA 4C33A 4CFUA 3R71A 2OLCA 2X9FA 4DH7A 2HWOA 3Q6UA 5LVLA 5L6PA 5AUTA 2WTWA 4TYJA 5HU3A 2J0LA 2FGIA 2WO6A 4IDVA 5AP6A 4IAAA 3KFAA 3LAUA 4YJPA 3IW6A 2CHLA 2EVAA 2HW7A 3GXLA 3HV3A 4BB4A 3D9VA 4ZTLA 4X3FC 4BDEA 3DJ6A 1PKGA 1VYZA 3KRWA 3I79A 4BF2A 5JQ8A 2YM3A 1QPEA 1ND4A 2PVRA 3E88A 3JYAA 4R7IA 4UXLA 4E1ZA 1Q62A 2C5YA 3DU8A 4H1JA 3QCYA 4G2FA 4EH7A 3ZO1A 5E8YA 3S3IA 3S0OA 4P2KA 3S2PA 4O7WA 5JMSA 2V7OA 3KMUA 4ZSJA 1UV5A 2I6LA 3OT8A 5FM3A 4O0TA 5I9XA 3B2WA 3UNKA 4JX3A 2CNQA 1YWVA 3GUBA 4L43A 2Y8OA 5AV0A 2YABA 1GJOA 1W83A 3PXZA 3ZEWA 2V22A 5EFQA 2ZV8A 3PRIA 3AC2A 4OGRA 2LAVA 1PXNA 2WIHA 4HYUA 2F49A 4YJSA 3LVPA 1BYGA 5M08A 4JXFA 5JT2A 4FKTA 3KMMA 5DR9A 2YWPA 2QD9A 2OFVA 3E3BX 2Z60A 4O2ZA 2QLQA 4TNDA 4EZ3A 4FKSA 4UWCA 3RK9A 3AT2A 1H0WA 4APPA 3G5DA 4MF0A 4EOQA 3E8DA 4W4XA 4Y83A 1H26A 1ZMWA 3LJ0A 3RCJA 3E7OA 4RJ8A 1ZYJA 3LPBA 3QD2B 2XK9A 3QTXA 3CQWA 5B2MA 5L2TA 3BYVA 3QA0A 4GW8A 5IQAA 5HBEA 4II5A 5E8VA 3GEQA 4EUTA 3MDYA 3RMFA 3BCEA 2GS7A 3VS3A 4LOOA 3FYJX 2A19B 2PVHA 2BFYA 5AWMA 4X2KA 4AOJA 4UN0C 3ZYAA 2YLFA 5FTOA 2EUFB 4F9AA 4H36A 2W4KA 2YCQA 2WOUA 4MTAA 3I1AA 2X2MA 5CU3A 2B9JA 1BL6A 4FTCA 1AQ1A 3OWKA 2CGWA 4C35A 5K4IA 5DOSA 3GOKA 5BVNA 4L01A 2X6EA 2QOKA 4IIRA 4CZTA 3BU3A 5AP1A 3RM6A 2OXYA 3Q3BA 4LGDA 2GHGA 2R3PA 4FSQA 4X7QA 3S95A 4ASZA 2QNJA 3GU4A 3V6RA 4AQCA 4EH6A 5GNKA 4PNKA 4UMUA 5FXSA 4TYEA 3HYHA 2PVMA 2HXLA 2WMUA 1OUYA 3W2CA 1OB3A 4HPTE 3VS1A 2OZAA 1M7QA 4P5QA 1W8CA 4QP7A 3G90X 4J53A 5J79A 2FH9A 4EOKA 5ANIA 2WQBA 3D2IA 5HIDA 3ETAA 3FZRA 3OS3A 3DS6A 3HMMA 3KXGA 3GT8A 5EHYA 5M4UA 5FDXA 5DE2A 3HLLA 2C3LA 4LFIA 3OROA 3EYGA 4L3LA 3SX9A 3WZUA 3PJ3A 4R7HA 4D58A 2JIIA 3IDPA 3JVSA 2VX3A 3QYZA 5HLNA 5KMLA 1M7NA 3PIXA 4J97A 4IAYA 4QMMA 5D12A 1BL7A 3LXLA 5JFSA 4H1MA 2B55A 2BAQA 1URWA 3FC1X 5CSXA 4TL0A 4FZDB 4WG4A 3W2RA 5HD4A 4K9YA 3DV3A 3FMNA 3JXWA 4KIKA 3EZVA 4CLJA 5KMJA 5H3QA 5IMEA 4KA3A 2GNLA 3P79A 3V5QA 3GCSA 3VUKA 4D5HA 4H3QA 4M68A 4W9WA 3MTLA 2XIXA 4RVLA 3PXRA 4O7NA 1Q99A 2XH5A 2EXEA 5DWRA 2V7AA 3GP0A 5CVFA 5LJJA 4QNAA 4YJQA 4AA4A 3O51A 4OTGA 3RHKA 4RX9A 2BUJA 1XH7A 2W4JA 3VHEA 2OIQA 3QRIA 5CAQA 4BR3A 3QXPA 3NUPA 5M56A 3BX5A 3VF8A 2B52A 3NUYA 4EI4A 4U0IA 4RX8A 1OL2A 3ANQA 5AV2A 4ANBA 5HE2A 2CNVA 3KC3A 3ORMA 4FX3A 3IS5A 3C5IA 1J3HA 3EKKA 3C0GA 3I81A 2VWYA 5L6OA 3PPKA 4YZMA 2GNFA 4GVJA 5HESA 4S34A 4ACHA 3BLRA 4NJ3A 2WEVA 3HV6A 4OTRA 4OT5A 4WA9A 4WO5A 3SW7A 3VVHA 3G2FA 3DK6A 4MBLA 2W05A 4X2FA 3KA0A 5CAPA 4EHVA 4F64A 4GUEA 5E1SA 5EDRA 3WBLA 4Q5HA 4F9YA 1JPAA 3FZ1A 1APME 4O7YA 2FYSA 3U51A 4KINA 5CSPA 4ZEGA 4ZS0A 2WTKC 3F66A 3BU6A 3S1HA 1PMEA 2VTQA 3JPVA 4YHJA 2Y9QA 4FTRA 5D7VA 1T45A 2YIYA 5KCVA 2VV9A 3DDQA 4ENYA 2PY3A 1OVEA 4HZSA 4FNWA 5CAVA 1O6YA 3JY0A 2R9SA 3R1SA 1FBNA 2G01A 4XX9A 4ZK5A 1VZOA 2XBAA 2YA9A 2W17A 2W0JA 4RC3A 2UW5A 3KXMA 3NDMA 5CXZA 4QP9A 1WAKA 4RQKA 1LPUA 1NT2A 2I7QA 3R1QA 5EOBA 4QTAA 4BCOA 5GJFA 2PWLA 2O63A 3NNUA 5EKOA 2XBJA 3U9CA 4IM2A 2PZ5A 3R63A 3VNTA 2BHEA 2XRWA 5GZ8A 5J8IA 1Y91A 4C8BA 2GTMA 3DBCA 4HCTA 3HKOA 3EQBA 2UZEA 3F7ZA 1E1XA 1TQPA 3MH1A 4AT5A 3BE2A 3UDBA 3TI1A 3KCFA 4O0SA 3HAVA 5BYZA 5AV4A 4G3CA 1CKIA 2C47A 5CY3A 3R7EA 4CGAA 3FQEA 4IFCA 4ZSLA 3ZFYA 3VUTA 1SM2A 4ZMEA 5ITAA 3TWJA 3KKVA 5AAFA 2VTNA 5AP2A 2QOBA 3R00A 2YISA 4D28A 4DT8A 2PULA 4XG7A 2F7ZE 2BTSA 4AGDA 4BWXA 2QOOA 4UMRA 4U5JA 3FHRA 3H9RA 3BBTB 3A62A 4BDKA 5IDPA 3DTCA 4FV6A 4RA5A 3EFLA 2VTHA 2WHBA 4UALA 3I5ZA 3VJOA 4FSWA 2R0UA 3BGZA 3LQ5A 2PMOX 3NW5A 3LFEA 4K6ZA 5DLSA 4FKJA 5J1VA 3I6WA 5KZ0A 4JIKA 1XWSA 3M42A 4AA0A 4BTFA 4ERKA 3UO6A 2JDTA 3Q6WA 1ZWSA 2JD5A 5DMZA 1U5RA 3R8ZA 5HO7A 3FL4A 3GU8A 2RF9A 5BPYA 4YBJA 3Q2MA 4BDBA 2GHMA 3TUDA 3DLZA 2R3KA 2W1HA 5BUIA 1P14A 2XNNA 4RQVA 5T68A 3UOKA 3E62A 3ZZEA 2FSMX 2WGJA 3O8PA 4PDOA 5LWNA 4YJVA 3SDJA 3HRCA 3LMHA 2J5EA 3P23A 2XP2A 4CRSA 5KMOA 4KAOA 2RSVA 1OIRA 2GCDA 3H9FA 3KRJA 4QP6A 4RGJA 5E8SA 3R8MA 4C59A 3DAKA 4RVTA 4YZNA 4QP2A 1OIYA 5KMIA 3UGCA 3VS7A 2ZAZA 4DGOA 4F09A 3AQVA 3FLQA 2Z7QA 4WT6A 2WAJA 2CMWA 3M1SA 3TUBA 4EOMA 4KIQA 3VBVA 4EK5A 3UIXA 3UNZA 3QD4A 3OY3A 5KMMA 4FT0A 4QMWA 2EXMA 3LXNA 3H3CA 4GU6A 4QP3A 3OWLA 5EKNA 4A4OA 3G6GA 2HCKA 3TTIA 4AXAA 2E2BA 5JKGA 4QYHA 1QL6A 3VW6A 5DEWA 5AR7A 3E87A 5HIBA 4BY9E 5HQ0A 2CKEA 2BROA 3NYXA 3PXYA 3TCPA 4ZLOA 2YAKA 1OIUA 4IJ9A 4P90A 3CEKA 4MQ2A 4FSUA 4ARKA 4UMTA 5CVHA 5CVGA 2W5HA 3OCGA 3GGFA 4UB7A 2YHVA 4G17A 4V05A 2WPAA 3ZM9A 2OXXA 5JGAA 3RPSA 4F7JA 2YEXA 4RLLA 4GFGA 1F5QA 2BRHA 2WXVA 5EI8A 3G33A 4HVIA 2PVLA 1BI7A 4CTBA 2P3GX 4HGEA 1RW8A 5HZNA 5EYMA 4Q9ZA 4YPDA 3FMEA 3ZC5A 2ZDUA 2ITQA 1H1RA 2RG5A 1YXVA 5C1QB 3EN6A 3HP2A 2R3MA 4XV9A 4GRBA 2P2HA 3AC8A 3ERKA 5FGKA 2YFXA 1Z5MA 3DB6A 4I1ZA 4MHAA 5AA9A 2NNWB 3FY0A 4IVBA 4MD7E 4BI1A 2UW3A 4D4SA 1FINA 5CAOA 4ZJIA 2JLDA 3DGKA 5BYLA 3VBYA 3UTOA 2OIBA 2WMQA 3TZ7A 5E9EA 3RWPA 4QMZA 1XO2B 2Z02A 3EQHA 4K8AA 4L7SA 4FE2A 4EC9A 3NYOA 4XP3A 3W2SA 4I6FA 2B9FA 4AP7A 2W9FB 1YXSA 5I3RA 3ZDUA 3FE3A 2PZRA 1OZ1A 3Q5IA 3D5UA 4X3FA 3O8TA 4FK6A 4NCTC 2I0VA 3M2WA 3DXNA 5A3XA 3K54A 4CT1A 3UP2A 4AAAA 2PTKA 3A61A 3NW7A 2OBJA 3ACJA 4EORA 1J7IA 3OCTA 3MFSA 5CQWA 1SZMA 4O82A 3GC7A 3HGKA 4JVGA 1MRYA 3R2YA 4L52A 5HX8A 2WQNA 3AMAA 5BVOA 2GNGA 1WZYA 5IF1A 4PV0A 4RJ3A 3UMXA 3BGPA 4LI5A 3PSBA 1LR4A 3SOAA 4NFNA 2QI8A 1XH5A 2R64A 4J8NA 3CIKA 3QTSA 4PTGA 4O0YA 2B4SB 4IB1A 4EK4A 3W32A 2NPQA 3Q4CA 3CC6A 3QUDA 4NKSA 1SNUA 3W18A 4E7WA 3ZFMA 5JRSA 3WZEA 1W7HA 1K2PA 5E8ZA 5HI2A 3R7VA 1YXXA 4EH3A 1Y8YA 2C4GA 3F3UA 4JLCA 4ZJVA 2ZOQA 4ZS4A 2H8HA 5KZIA 4E6QA 1JAMA 1H00A 1NVQA 5EW9A 3O17A 4BRXA 4NZWB 3VS6A 1DAYA 3PJ8A 4ASXA 3ANRA 3MJ2A 4LRMA 2OF4A 4FV7A 2J90A 3EIDA 3QZIA 3DBQA 4W4YA 4U8ZA 4QO9A 4FIGA 5E8WA 3F2NA 1VR2A 5EQPA 1JKKA 3QQUA 3RHXA 4YBKA 3R7IA 3NYNA 4ORKA 4P5ZA 2ITUA 4CYJA 4BIDA 3IGOA 4JBVA 3OZ6A 4G9CA 3IDCA 1XBCA 5CI6A 2W1GA 2BZHB 4JJRA 3VAPA 4CQEA 1JQHA 3U54A 2YDIA 2JEDA 3EZRA 4UWBA 3WF5A 1ZY5A 4KSPA 4YZDA 5HKMA 1XHAA 5CU0A 4FMQA 3VUDA 1KUTA 4ZTHA 3DCVA 3TJDA 2JKMA 2BZJA 4DG0E 3COIA 4RLKA 3DY7A 3LFBA 2ERZE 3QKLA 3U87A 5I9WA 4ZTQA 5M55A 2YWVA 3UVPA 3SXRA 4BCPA 4YUQA 4FVQA 5C4LA 2PYWA 3F2RA 3I0OA 4E5BA 4FKIA 4RSSA 3OP5A 2I1MA 2YM4A 4DGGA 4G34A 4WHZA 2IPXA 2J6MA 4CCBA 4I21A 3W2OA 3FV8A 4F0FA 2XF0A 3DZOA 1NY3A 3AGLA 3FBVA 2C1AA 2ZJWA 3F69A 3FUPA 4FKUA 3ZHPC 3ZLSA 3B2TA 4M3QA 5FTGA 2XIZA 3UIUA 3BKBA 5ANGA 4A9UA 2VO3A 2ITPA 3BQRA 3F3TA 5FBNC 1JNKA 4BGHA 5HLWA 3NMUF 4ZZNA 4OBPA 4FICA 2B54A 3JUHA 4BVUA 4IJPA 3PXFA 5DH3A 3I5NA 4FNXA 1UKHA 3Q4UA 3VC4A 1REKA 3FKNA 5JZJA 3VIDA 1FMOE 3CTHA 4TWOA 4DGLC 4C0TA 4CFXA 3AD4A 5AUUA 2W96B 3EOCA 5F20A 4E3CA 2QC6A 1DAWA 4HYSA 4USFA 2GQSA 1JOWB 5AUVA 4O7LA 3TN8A 4UY9A 4EJ7A 3PSCA 4ZY6A 3ET7A 3L8SA 3W2QA 2QO9A 4EOPA 3FL5A 4EOOA 3A99A 1BLXA 2IZSA 4G5PA 3QQFA 3CJGA 4M97A 3D5WA 5EM7A 4OBOA 1Q41A 4TNBA 3OG7A 2UW9A 2QU5A 3RM7A 4PY1A 1Q3WA 3QCQA 1O6LA 1W82A 4JBPA 5AX9A 2CKPA 4IQ6A 5F4NA 2XCHA 3P7CA 4A9TA 4D9UA 2X81A 4XMOA 4BICA 3MIYA 3VBTA 3HNGA 3UOJA 4RIXB 2HIWA 3LCKA 4FZ7A 2G15A 4E5WA 4E8AA 4BFMA 3UZTA 4ACCA 4KNBA 2XEZA 1KSWA 4HOKA 3HRFA 4YMJA 1QMZA 3CKWA 3UYSA 3O50A 4PDYA 1V0BA 4Y5QA 1PHKA 3PJ1A 3DBFA 3D7ZA 5DRDA 3F7WA 5J7BA 1ZY4A 4Q5EA 3UVQA 4BYJA 4ANNA 3PDTA 2XJ2A 3MPTA 4AOTA 4WG3A 2CGVA 3GFWA 3RNYA 1OL7A 3FYKX 5M51A 3NAYA 3PVBA 4ACGA 4QMNA 4XLVA 5KHWA 3ULIA 1YHSA 4L68A 4XH6A 4JNWA 2C0OA 5HNGA 4OAUC 1YDRE 4I5MA 2QHNA 3P5KA 2YM7A 2J2IB 4FL3A 5AR3A 4YU2A 3TM0A 5IH4A 2JKOA 3CGOA 5JFXA 4I4EA 3AC3A 4FTTA 3LXPA 2XKEA 3BYMA 3QX4A 5AADA 4EKLA 3I0QA 4HGSA 4J52A 4XV1A 4LRKA 1ZZ2A 2BKZA 3GNIB 5CENA 2VRXA 5K9IA 3C0IA 4N57A 2XIRA 5D7AA 2CCIA 3TACA 1IG1A 1YWRA 1V0PA 3VQHA 4WIHA 2YJRA 5EI2A 2QOQA 4S2ZA 3KF7A 3MPAA 3UMWA 1GIHA 1RDQE 1TQIA 3RKBA 3ENMA 2OGVA 4OTHA 5C4KA 1JKTA 1XQZA 1GIJA 4UWYA 4S33A 4FTUA 4W4WA 3CS9A 5B7VA 3UBDA 3PUPA 5TE0A 3KY2A 4YJNA 5HTBA 1ZARA 2ZM4A 2C6EA 4H3BA 1M52A 2GS6A 3QUEA 4IB0A 1YRPA 4R1VA 4RFYA 5ETCA 4RX5A 5LWMA 4R78A 4MAOA 3QL8A 1PXOA 3R8VA 3LE6A 5AUYA 4ZZOA 3UPZA 4PP9A 4NSTA 4RWIA 3NEWA 4GCJA 5IA0A 4QNYA 4U43A 4G6LA 1ATPE 5F94A 1FQ1B 1ZOEA 4DH3A 5JFVA 5AFVA 4M7IA 3Q9ZA 3RPRA 2UW0A 1UWJA 3HX4A 4RIOA 4PMTA 4HGTA 5DPVA 4EUUA 4E5AX 5AEPA 4TWPA 4U81A 3Q4ZA 4UZHA 5EH0A 3H0YA 5BX0A 5L8KA 2HW6A 4O0WA 2F2CB 2G2IA 1A48A 3NIEA 4JDKA 2FSOX 4FSRA 4Z55A 3BIZA 3D5VA 4FKOA 3JY9A 4FNZA 1OBDA 4JAJA 2BVAA 2XKCA 3CPBA 5ETFA 1R3CA 3GU6A 3CSVA 3FI8A 5D41A 5L3AA 5ANJA 4L53A 3PLSA 5CT0A 3RAIA 4FTLA 4YR8A 3COHA 4FSNA 4FG8A 2QR8A 1R39A 2BDWA 3R28A 4PL3A 5H8EA 2VWIA 4DEHA 3DAEA 4ERWA 5E1EA 3QRUA 1EH4A 4O7VA 2ZMCA 2OH0E 3QQHA 2PK9A 4WNMA 4YJUA 4BBFA 2PUNA 1PXIA 4E93A 1Q3DA 3ZC6A 3R8UA 3A8WA 4YLLA 4IZ7A 3K3JA 4KABA 4XRJA 5GHVA 3U8WA 2WMAA 3OUNB 5J9YA 3P9JA 2ZMDA 4MXCA 3G51A 2IW8A 5K5XA 2QR7A 4YTIA 3BHYA 2XK7A 3SQQA 2OJ9A 2A2AA 2QKRA 4AW5A 3RAWA 2C6IA 2ACXA 2KTYA 4OUCA 1DS5A 3QRJA 1PMUA 4GU9A 4JR3A 5AM7A 4AZEA 2A27A 3NVKI 2ONLC 4QT1A 4CLIA 4D1XA 1OPJA 4F63A 2J9MA 2PVKA 4FK3A 3TT0A 4CG9A 5TT7A 3HDMA 4F6SA 2J4ZA 3VWAA 1O9UA 5HE3A 3LM0A 4NM0A 4QPSA 4IWDA 3W33A 4DH1A 3R9HA 4F6UA 4FTNA 5IMXA 3R9RA 1ZOHA 5A4CA 5IQBA 3QQJA 3IO7A 2YIQA 1ZYSA 4IB3A 3QX2A 3R30A 5CZIA 5TF9A 4U3ZA 3ZUTA 4FEWA 4RJ4A 3C13A 3IG7A 3QKKA 3CGFA 1UKIA 2ITNA 4X6RA 4F1OA 2C3JA 2ESMA 3TV6A 2ITYA 4BDJA 2PUUA 2BFXA 3P4KA 4P7EA 3ZEPA 3G15A 3Q9YA 4ZP5A 3OXTA 3ZS5A 4EKKA 1MP8A 4J99A 5EW8A 5GZAA 4AZWA 3BU5A 3QXOA 4EH5A 4CZYB 4EOLA 4DE4A 4FV8A 5LMAA 3CTJA 3DBEA 3EYHA 1YI6A 3QQKA 3RZBA 4DBNA 4G3FA 2BALA 1Q4LA 4LV8A 4QMPA 5AIKA 2PMIA 3T8OA 3RP9A 4CMUA 2YCRA 5HTCA 5KX8A 3CLYA 5JFWA 5LXMA 3E93A 1OL1A 5IQGA 5AIRA 2X9EA 5FEQA 1UU3A 4G5JA 3PG3A 3ZUUA 4DCEA 2IW6A 3BV2A 5AP0A 4JDJA 4ID7A 3PE2A 4E4MA 1PY5A 2XB7A 3FLYA 4PMMA 5L6WL 5LCJA 2UZWE 3VHKA 4RX7A 5H8BA 4L46A 4PP7A 4IC7A 3SHEA 3GB2A 4R3RA 4XG4A 3LFQA 5BVDA 3GBZA 1ZMVA 3QKMA 1J91A 3SD0A 2RL5A 2HY81 4B4LA 2XM8A 4L67A 4O6LA 3BI6A 4S30A 4U45A 3BYUA 4V0GB 4NCTA 4MNEB 4NIFB 3ZRMA 4I6BA 4IZAA 2RKUA 4IX4A 2GQGA 4XV2A 2O3PA 4PMPA 1J7UA 3JR1A 4OTQA 2QG5A 4EQMA 2XEYA 4DG2E 4CRLA 4TTHB 3K5UA 5E92A 1IEPA 4CVAA 4DGMA 4ZSAA 3HZTA 2H34A 1B6CB 4DCAA 4E20A 4AZVA 1QPJA 3TJCA 4I23A 3MH2A 3AGMA 4ZY5A 5CU4A 3PJCA 2A0CX 5LMBA 4J8MA 3WF7A 4RZWA 3F6XA 5LARA 1XH4A 2R3OA 5AR8A 1MQBA 4AW0A 5FQDC 3HDNA 3FHIA 3Q04A 4IX6A 2Y6OA 3ENHA 2VGPA 5HBJA 2XNGA 2BZIB 3PVUA 4OT6A 2QG7A 4Z7GA 4XHKB 4M67A 1CSNA 3NW6A 2W1CA 3FQHA 4FODA 4XG3A 3TKUA 4MQ1A 3GFEA 3KULB 4JRNA 4USDA 2X0GA 3TNQB 5J5SA 5LQFA 4XCUA 5AR4A 1H08A 3RGFA 1Z9XA 4MXOA 4DFXE 3LLAA 4WRSA 1IAHA 3OOMA 4D4RA 4RWJA 4PTEA 3S00A 2QOLA 4N6YA 4PUZA 4Y46A 4PNIA 4LQMA 4U6RA 2DWBA 3UIBA 4WNPA 4O81A 5FBOA 3W16A 4B7TA 4QPAA 5KMKA 3UO5A 2UZNA 3F5XA 2IO6A 4DTKA 5J5TA 4EJNA 5EQYA 5CEPA 4F0GA 3MESA 3V5TA 5KNJA 4MXYA 2C6MA 2JKQA 2QQ7A 5H2UA 4DYMA 3E3PA 3PXKA 4DAWA 3R8PA 4IAZA 4C3RA 2HXQA 2CJMA 4G1WA 4GYIA 4MWHA 4FEUA 1JKLA 4MBIA 2JIVA 1PXPA 1V0OA 3V01A 3ZO3A 4AGCA 4CV8A 4DEAA 2OICA 1YOMA 3BGQA 4M15A 3EN4A 4IFGA 4W9XA 2WZJA 4BL1A 2O5KA 2A4LA 2C5NA 4AOIA 1SVEA 5DR2A 2WTKB 1URCA 1K9AA 4YC8A 3FPQA 3BYSA 4D55A 1E1VA 3AT4A 3IW8A 4MXXA 2XK8A 4BGGA 3QLGA 5E8TA 4FSTA 5C01A 1G3NA 2CN5A 2PVYA 4AN2A 2ITTA 2BDJA 2C5VA 4M13A 1G8AA 2ZB0A 2FSLX 4GK2A 4LL0A 4PL5A 1OIQA 2IW9A 3GQIA 3MFUA 2X2KA 3CE3A 2C0TA 5IEVA 5BNJA 5BMSA 3ZRKA 3FDNA 4M66A 2XJ1A 3LCTA 2WNTA 3P78A 5EYCA 2QLUA 2W5AA 2OFUA 4PWNA 3RTPA 4MD8E 3ZO4A 1RJBA 4HNIA 2XRUA 5CLPA 4ANOA 4GSBA 4IM0A 3E92A 2CKQA 1PJKA 2WTJA 2VD5A 3E8NA 4M0ZA 3BLHA 4GT3A 4L42A 3GCPA 4S32A 2VX0A 5JGDA 4J7BA 4WUNA 4JOAA 4BCKA 2BRBA 2QOFA 5M4IA 3A7GA 3QALE 3NPCA 4XBRA 4AT4A 4FEQA 2B9IA 2DYLA 4FUYA 5CYIA 5TOZA 3IK3A 3PP1A 3QQGA 3NS9A 3TKHA 4CKRA 1YOJA 4TWCA 4B99A 4IZ5A 1YKRA 3DA6A 4I4FA 4GK3A 3WOWA 4CZUA 2GSFA 4D4YA 3TZMA 2XUUA 4KKHA 2F4JA 4C4GA 4D1SA 4DFZE 1STCE 4M69B 3EQGA 4ITHA 1BX6A 3TDWA 1KOAA 3NNWA 3QZHA 3ZFXA 3K2LA 3WF9A 5IQDA 4GFMA 2RFNA 4RWLA 2DQ7X 3A4PA 3LCDA 3P1AA 4AW1A 5I9ZA 4NYEA 3B8QA 3LFDA 2PZIA 2OKRA 2O0UA 3OWJA 2WMWA 5DIAA 4XYFA 1L8TA 3O96A 1CMKE 4IWPA 4LUDA 4W4VA 3CY3A 4BGQA 4IXPA 5E90A 5C26A 2X7OA 1UA2A 1KE7A 3CQEA 4UXQA 3C4EA 4QMVA 2W1EA 3V8TA 3JS2A 4UEUA 2NP8A 1GOLA 4R5YA 3R9DA 2VTRA 1CKPA 4A4XA 2WELA 5A6NA 4M14A 5HE1A 5T6KA 1Q8UA 3BE9A 3F61A 4EH9A 3KQ7A 2WMXA 3F88A 3BRBA 2VTPA 4HPUE 5EOLA 3TEIA 2VTOA 1F3MC 4AZSA 4FR4A 4QMYA 4IWQA 3HV5A 5KBRA 4GT5A 4U44A 1WVYA 3DB8A 5M07A 1IR3A 3WARA 1BI8A 2BHHA 4A06A 1U4DA 4RT7A 4FT9A 4TYGA 3R7UA 3GU5A 4EHGA 2B9HA 3FI3A 4GJ2A 5BVWA 3BHUA 2YIWA 2CN8A 3O2MA 1AGWA 4RVKA 1GY3A 5EHOA 3II5A 4OTDA 2RFDA 4W8EA 3O8UA 4DLIA 5DG5A 3OHTA 3Q52A 4JR7A 4JRVA 4FYOA 4H58A 3BWFA 3QBNA 4D4VA 1Q8WA 3ORNA 4RIXA 3ZSHA 4DA5A 3LFAA 4DG3E 4QQCA 4ZSEA 2RIOA 1MUOA 1DM2A 2EU9A 2YM6A 5CAUA 5EM5A 3PZHA 2QVSE 1Y6BA 4J98A 1LEZA 1WCCA
chains in the Genus database with same CATH superfamily
3W8QA 4CD0A 3SA0A 4IWOA 3IW5A 3EMGA 3RALA 4D2TA 4I93A 2GNHA 2WTVA 2UW8A 4ZY4A 4KIOA 4BBMA 3CKXA 4BDFA 1WBVA 1ZMUA 2OZOA 1DI9A 1JWHA 2PVNA 2UVZA 3EN9A 1ZYDA 3KRRA 1W2FA 2A1AB 2XANA 1TQMA 2P4IA 2ZYBA 2Y4PA 4HNFA 5HORA 3UDSA 2UW7A 1XBBA 4YP8A 4RJ7A 3BLQA 2JDOA 1H8FA 2PE2A 5JZNA 2ZB1A 4MYGA 5KBQA 4JQ7A 4U40A 2CLQA 3EB0A 5M44A 2X0QA 3R1NA 4DTBA 3IOKA 4CYIA 3H9OA 4KBAA 1OKZA 4JAIA 5ACKA 2XA4A 3R7YA 4O21A 4WKQA 1YQJA 4FV0A 2VU3A 1SVGA 4IADA 4NW6A 4TZRA 5A6OA 4G9RA 3FY2A 4BZNA 3LJ1A 3R8LA 3Q96A 5BVKA 3SG9A 3ALNA 5DEYA 3COKA 4KBCA 5K0XA 5IUHA 4YZBA 4DEBA 2Z7LA 5CALA 4BJJB 4DEDA 4GS6A 4HJOA 2C5XA 4DFYA 4FSZA 1DI8A 3DT1A 4IAIA 5E91A 5EK7A 4HCVA 4B6LA 3PSDA 4I92A 4AFEA 4TYIA 4DEIA 5KO1A 3KU2A 3A7FA 3D4QA 3A8XA 4O96A 3LMIA 3MBLA 4IAKA 2RFEA 5DFPA 1OKWA 2IVSA 2Y4IB 3PIYA 4WBBB 3DAJA 5CSVA 5HG9A 2YN8A 4BCFA 4BDGA 3KK9A 3EN7A 1TKIA 4G6NA 3WZKA 1KWPA 3BV3A 2GTNA 4YTHA 4GL9A 3ORLA 3ZXTA 4WUAA 2GS2A 3TIYA 5CS6A 5LCKA 4IM3A 3CD8A 3MVLA 2C6OA 3BHVA 3HV4A 4MCVA 4RIYB 5HG8A 4BCIA 5IPJA 4GIIA 3R04A 4FI1A 2YACA 3T3UA 3FXWA 3UZPA 5CQUA 4NW5A 5AP5A 3QLFA 4NH1A 4L3JA 3ELJA 3FSKA 3TZ8A 4Z3VA 4YURA 2F57A 4CG8A 3PFQA 4WSQA 3REPA 3L9MA 2H6DA 3LOKA 4CFNA 4AN9A 2BAJA 4RA4A 2BDFA 2ETMA 3FKLA 4F08A 1GNGA 4U79A 1M14A 3ZLWA 3ATTA 3PPZA 3NWWA 5CNNA 3FC2A 4DEGA 4XS2A 5FUTA 2CDZA 5EG3A 1WFCA 2VO7A 2Y4IC 3MW1A 4L45A 2WQOA 4QRCA 3C9WA 2VO0A 3CXWA 3F3VA 2H9VA 3P86A 3LCSA 3HA8A 4O27B 3QRTA 4MF1A 3A60A 4QYFA 5TO8A 4AAYA 3EFWA 2QU6A 2E9UA 4AU8A 3DDPA 3RJCA 3HAMA 5DA3A 4R7BA 3L9PA 4FTJA 4XP2A 2WTDA 4DLJA 4ZTMA 3PP0A 5A4TA 3EHAA 5M53A 5J1WA 3QC4A 4TY1A 3NNXA 5M06A 5AV1A 4ACMA 2PE1A 3WE8A 4ZIMA 3RPOA 4IDTA 4BDHA 5DT4A 1W2CA 2OW3A 2GU8A 3GCUA 5IH6A 4AWIA 5HNIX 1OPLA 2FA2A 3PWYA 3QU0A 2XZSA 2P2IA 1H24A 1U59A 1UNLA 2OO8X 2XJ0A 3DK7A 3DTWA 3MS9A 1OL6A 5FWKK 2VTSA 3QD0A 4BBEA 3G6HA 2OJGA 1JBPE 1YVJA 2QKWB 2X8DA 4U3YA 4KD1A 4YPSA 4CFFA 3ZONA 4C36A 1NVRA 5FXRA 3K3IA 3I6UA 1JKSA 2ERKA 2OJIA 3C4WA 5GINE 5HD7A 5HNBA 1A06A 2YJSA 2X2LA 2AC3A 4FL2A 4FZAB 1HCKA 4M12A 1OITA 3Q53A 4I5PA 2QOCA 2SRCA 1W84A 4IEBA 4R8QA 5K4JA 4DGNA 3LQ3A 2IZUA 3ZLYA 2WMTA 3PUFC 2Z7RA 3FI2A 3FPMA 4Y8DA 5AUXA 4DN5A 1WVWA 5CXHA 2YCSA 2GFCA 1GZNA 2BRGA 5BV3A 1LEWA 2PPQA 3MB6A 2J5FA 2XALA 1KE5A 1FVTA 1IA8A 2JITA 4O6EA 4QYEA 4I0SA 5HCXA 4F7LA 2YZLA 1ZYCA 2YZAA 2Y6MA 2AC5A 4J1RA 2QOHA 1E9HA 5B2LA 4FV9A 2OXDA 4DFNA 5CTPA 3ZBFA 4QMUA 1P4OA 2OF2A 3FZPA 3EQFA 4FOCA 4XG9A 3F5GA 2IJMA 2C6LA 3UJGA 3DJ7A 3SV0A 5KKRB 2P0CA 1IASA 3GC9A 3Q9XA 1H07A 3MGYA 2VO6A 1ZYLA 4MNEA 4NIFA 4XLIA 3LFCA 4W8DA 4IZYA 5FEDA 2UZUE 4YTFA 2X8EA 2UZTA 2J0JA 4WNOA 3UDZA 2W1ZA 3W10A 2CCHA 4NUSA 5I3OA 3FXXA 1MRUA 5JK3A 2VNWA 5DT3A 3U4UA 4O4FA 4BCGA 5CU2A 3VS2A 4X21A 3OCSA 1K3AA 5DI1A 3ML1A 3FKOA 1PF8A 5T3QA 4F1TA 2O65A 2I0YA 4ALWA 4AA5A 4GH2A 3DPKA 5IQFA 3QD3A 3SXSA 3ZSIA 4RFMA 3DNEA 4D2VA 3EJ1A 2X39A 3V5PA 3VBWA 3LFNA 4B8MA 3KXZA 4IBMA 1P4FA 3OTUA 3FZSA 3PVGA 2F9GA 3DZQA 4FG9A 4XV3A 5AUWA 3VO3A 5KKRC 4DDIA 4FIHA 4MXAA 2J50A 3EFKA 1U46A 4UMPA 5DNRA 2O2UA 4JQEA 5JEBA 2I0EA 2VZ6A 2R3RA 2IZRA 3R2BA 3PYYA 5C03A 4NFMA 2BTRA 5HTIA 3QTUA 4BKJA 4F9CA 3ZXZA 4BYIA 3KULA 4PPCA 3F5UA 2B7AA 4LOQA 5CI7A 1XH8A 3ROYA 4BCJA 2W5BA 4KSQA 4LGHA 4O22A 3O5AA 4YTCA 1XBAA 3L8PA 4N4SA 4FV2A 2IVUA 2OSCA 4PF4A 2WTIA 4I0TA 3AXWA 5CX9A 3A2CA 4E6DA 4XJ0A 1S9IA 3UPXA 4MKCA 5J95A 1KE9A 1H1QA 5I0BA 4S31A 4ANSA 5J7HA 3N4TA 3HMOA 4QDVA 4L00A 4JI9A 3TNPC 5IKWA 5J9ZA 4QTDA 3D15A 4FKWA 4UZDA 4I41A 5J9LA 1YWNA 2VTTA 3RWQA 2UZLA 1UWHA 3ZH8A 2BZKB 1YHVA 3LFSA 4WSYA 5ANKA 2OJFE 5IQHA 5HVKA 3L8VA 3U55A 2R3HA 3CP9A 3SKCA 1PMNA 4TPTA 3UVRA 3R21A 2PHKA 2PSQA 3MI9A 5D1JA 4N0SA 4EWHA 3MWUA 2XMYA 4FV1A 3UYTA 4OLIA 2XCKA 3QYWA 3CJFA 3IW4A 5HOAA 4OAVB 4D2SA 1BKXA 3LMGA 4C3FA 2XNEA 5GIPE 5M4CA 1W0XC 2C5OA 1H27A 1XH9A 3KMWA 2F7XE 1I44A 4Y73A 5IEXA 4BTMA 4FTIA 4A9SA 2VWXA 3D0EA 3FLSA 2XKDA 4LM5A 3I4BA 4IE9A 2JDSA 3RK5A 3D7TB 4FKGA 2ETKA 1PXLA 4OW8A 4E26A 5AAEA 2F7EE 5EDPA 3CBLA 3SW4A 4YJRA 3FMMA 4M8TA 5CSHA 2OI4X 5L8JA 3AG9A 4HVHA 2PVJA 3U6JA 3LW0A 4DH5A 4O0UA 3EFJA 3P5JC 4HZRA 4O38A 5IZFA 4U41A 1CDKA 1B38A 2W06A 5AP3A 4C58A 4EONA 3VBXA 3OFMA 4LMUA 3BEAA 3V5LA 1SVHA 2P33A 3MY1A 3NUSA 1Z57A 4X2NA 1WBWA 4EH4A 4K77A 5A4EA 1SYKA 3V8SA 1KE8A 3MH0A 3L8XA 3OBJA 1XH6A 3W0RA 2V55A 2VTJA 5IDNA 5A9UA 4D2PA 4DF3A 3C5UA 3TUCA 2ITXA 3V8WA 2J0IA 3NR9A 1YDSE 4FIEA 3KK8A 3OVVA 4OTWA 4PRJA 5F95A 3GCQA 4FGRA 3OCBA 3QFVA 4O86A 2BRNA 4O4CA 4CXAA 2EXCX 3W8LA 4F65A 2VWBA 3ORIA 3G9NA 3IW7A 4KIPA 4M69A 1H28A 3A7JA 2JDRA 3Q32A 3OW4A 4G3EA 3C51A 4CKIA 3MA3A 4YNOA 1ST4A 4YJTA 4ALVA 3OT3A 3FLZA 5AM6A 3PJ2A 2QURA 3CY2A 4NTSA 3RVGA 5M09A 1REJA 1H01A 4DTAA 3TL8A 1H1SA 4EOJA 4F0IA 1U54B 2YAAA 5E8XA 4FV4A 3VUMA 1OI9A 1ZXEA 3OY1A 2P55A 3O7LD 4EOIA 2FUMA 4O0RA 4TYHB 1XKKA 2R3QA 1ZOGA 4ITJA 4CFMA 1OM1A 4D2WA 2I0HA 2G2FA 4LRJA 2VWUA 5FXQA 2V5QA 5A46A 3R7GA 3R73A 4FTKA 2JDVA 3FMLA 2QODA 1TVOA 4RPVA 2Q83A 3ODZX 4E4LA 1XJDA 5ANDA 2IN6A 3ALOA 3BL9A 4IAFA 4U80A 4JL9A 3THBA 3GOPA 4FC0A 2HWPA 3I60A 5B2KA 5I9YA 4YC6A 2J7TA 5HCYA 3C50A 5IA4A 2FVDA 2G1TA 3MVHA 3ZBXA 4ASEA 4Z16A 2ITOA 3FAAA 5BUJA 2WKMA 2XYUA 3UQCA 5L2QA 3R1YA 3UG2A 5BUEA 2Q0NA 3KN6A 3MFTA 2R7IA 3PG1A 5CANA 2OH4A 3UC3A 1ZLTA 1JLUE 3QWJA 2ZDTA 4LL5A 5DT0A 3TG1A 3KRLA 4IHPA 3EQDA 4Y85A 4O1PA 4GG7A 3ZSGA 1JVPP 4IB5A 3AC5A 2R3FA 5EQEA 2VNYA 3AD5A 3R01A 3OXZA 3FZOA 2YERA 4FV5A 4CMTA 4FVPA 1Y6AA 2WMRA 3AC1A 1H4LA 3ULZA 5A54A 2VUWA 5H9BA 5EHLA 2J0MB 3NRMA 4YHTA 4BDCA 2PUIA 3BEGA 4MEDA 4G16A 4K0YA 3U6HA 3L9LA 3HUCA 3VS0A 2HY0A 2Y7JA 3DKOA 4TT7A 2HZIA 3P7AA 1V1KA 5CF4A 2VTLA 4KRDA 4EK6A 5FTQA 3G0EA 4R77A 4BHZA 1PXKA 4R3PA 4G31A 4RFZA 5CEQA 2JBOA 3E7VA 3F5PA 3LIJA 2FO0A 3K5VA 4XOZA 4ANLA 4O4BB 5IQCA 4IVCA 3TZ9A 3PY0A 3AKLA 1PW2A 4FEVA 1VJYA 3F3WA 4NKAA 1J1BA 4U7ZA 1FGIA 3VW8A 4BJJA 3QTZA 4E4XA 3I7BA 5IQEA 4FZ6A 4LOPA 2HYYA 2XVDA 1R0EA 1RE8A 3QRKA 3ITZA 1I09A 3QCSA 4EBVA 3GU7A 3QHWA 5AUZA 3ORTA 4IX5A 4KKEA 4DH8A 4DHJA 4L3PA 1UU9A 4FA2A 4LGGA 4EEVA 3NUUA 3FXZA 4QD6A 3KXXA 3UE4A 4I5HA 3QGYA 5DGZA 4D2RA 3PFYA 3ZLXA 5AA8A 2VWWA 1H25A 1UU7A 1UVRA 1BUHA 4AW2A 4CEGA 5LOHA 4K18A 4F1MA 4WG5A 1KE6A 4E73A 3R22A 5FM2A 1A9UA 4EHEA 4RIYA 5M4FA 4X2JA 4QMOA 1MQ4A 4XUFA 1Q8YA 2H96A 3UOHA 2WD1A 3F9NA 3FMJA 4HYHA 4BI2A 3NVMB 1PYEA 1OGUA 4QP1A 5DHJA 1IRKA 2E9PA 4K2RA 4PPBA 4O7RA 3A7IA 2CPKE 4NM5A 3AT3A 1F0QA 3QC9A 1W98A 1HCLA 4FKVA 4FNYA 5AP7A 4EC8A 3PA4A 5DN3A 2JBPA 4HVDA 3V04A 2QOIA 3QTQA 4BCNA 1OECA 2BAKA 1FPUA 4I6QA 4CQGA 4GVAA 4TW9A 3DQXA 3VULA 4BCHA 2GDOA 1TFFA 4RC4A 1UU8A 4BKZA 4J96A 3H0ZA 2ITWA 2VTMA 2PL0A 4ANMA 4EQUA 5I9UA 5FP6A 4K11A 5G6VA 4YLJA 3BELA 4YHFA 3FQSA 4J95A 4GKIA 2W7XA 2C69A 4FYNA 4IH8A 3PWDA 4XG2A 3DKCA 4Y95A 4YGAA 5L2IA 4F9BA 2PUPA 1GZ8A 4YZCA 5BVFA 4D1ZA 1XMMA 3U6IA 4TWNA 3FSFA 3TXOA 4NTTA 3PA3A 5DBXA 4BI0A 4MBJA 3RAHA 2XKFA 1UNHA 1M2QA 4TXCA 3FJQE 3NYVA 4F4PA 2VTAA 3DOGA 3IDBA 4F99A 4OTIA 4UV0A 3U9NA 5LMKC 4F7NA 2BILB 2VX1A 1TZDA 2JC6A 2C6TA 2RG6A 3I7CA 4Q9SA 5IUGA 5IA5A 3KREA 5JGBA 2YCFA 1JSTA 4JQ8A 2R5TA 2YM8A 4QMQA 4AG8A 3IPHA 3TTJA 2WOTA 3MN3A 2R0IA 2UW6A 2IVVA 3PRFA 2XM9A 3LQ8A 2NO3A 2X6DA 3QZGA 4FSMA 3W0NA 3Q60A 2BKKA 1KV2A 1M17A 3ZUVA 4BIBA 3NUAA 2HELA 4O83A 4ZXTA 3JVRA 3C1XA 5CEIA 3BPRA 3Q5ZA 3LXKA 4AZTA 4BDDA 2HZ0A 3NUXA 4YO4A 4EHZA 4FKRA 4PQNA 2PZYA 2GFSA 3HMIA 3IOPA 2WEIA 4O1OA 3NZ0A 5FRIA 4BZOA 3BZ3A 3VS5A 1H0VA 4QPMA 3U4WA 3NSZA 3HMPA 2LGCA 4GEOA 5E8UA 3A4OX 2X4ZA 5A14A 4N6ZA 4WBOA 3BQCA 5HO6A 3WYYA 4ENXA 5FDPA 5EI6A 3ZMMA 4PMSA 4OR5A 4UYNA 4FJVA 4FT5A 4FL1A 3FLNC 3CQUA 4Z9LA 2QONA 4ZZMA 3MJ1A 2O8YA 3LCOA 4MWIA 3T9TA 3QZFA 3D14A 2Q0BA 4FZFB 4QMTA 4O7SA 4EWQA 3OW3A 4K33A 5F1ZA 2GQRA 3VRZA 3PY3A 5BMMA 1CM8A 1YOLA 1QPCA 3IONA 5HG5A 2VTIA 3H30A 4WNKA 4RRVA 2O64A 1YI4A 4QYYA 5EW3A 3WF6A 2HAKA 5I5ZA 4FIJA 4NEUA 3GI3A 4HCUA 2OWBA 2EB3A 1P2AA 4YSMA 2WU6A 1MRVA 2G2HA 3LFFA 5JN2A 2FB8A 5KE0A 4ZTRA 4F6WA 1WBOA 4KWPA 4QOXA 4AXDA 4Q2AA 3WE4A 4X6QC 3ZTXA 4BWPA 2VAGA 5JH6A 4E6AA 1X8BA 3ODYX 4WRGA 4CKJA 3PZEA 3WI6A 3PVWA 4IX3A 4ZTSA 4C4FA 4L9IA 3AKKA 2Z8CA 3Q4TA 4GG5A 5CASA 5E7RA 5DRBA 2WMSA 2ZV7A 5AAGA 5IUIA 3ORKA 5TKDA 2XNOA 3D5XA 3L1SA 3N4UA 4WD5A 3DFAA 1OPKA 4FT7A 5GZ9A 4QQ5A 2CKOA 3FMKA 3KL8A 4APCA 2EWAA 2JFLA 3W0MA 4G3DA 1Q97A 4WOVA 1FGKA 2QCSA 4GKHA 1AD5A 3TNIA 3HRBA 4TN6A 4V01A 2OIDA 2W9ZB 4QTBA 1ZAOA 1BMKA 2IVTA 3DFCB 3RPVA 4EOSA 1KV1A 4BCMA 3NX8A 4RJ5A 2X1NA 2Z7SA 1Q8ZA 3MY0A 2HK5A 3SRVB 3CR0A 5FP5A 2R3NA 1XR1A 1JSUA 3POOA 4I6HA 4TKSA 5FD2A 5K5NA 5IQIA 3OEFX 4BWKA 2JGZA 1PYXA 2R4BA 2Y0AA 3W1FA 4LYNA 3KB7A 4F70A 4B8LA 4IVAA 2DS1A 3DJ5A 3T9IA 2UZDA 4A4LA 2ZM3A 4EYMA 1J1CA 3DXPA 4KUJA 3P7BA 2JIUA 5G1XA 4JBQA 2J51A 2OK1A 5B0XA 4LG4A 4RC2A 4C4IA 4FF8A 4FKPA 4BC6A 5IEYA 3G9LX 4JG8A 5CSWA 4ZOGA 4XEYA 3BBWA 5IH5A 4I0RA 3D2KA 3NCZA 2GMXA 3MPMA 1R1WA 2UUEA 5HE0A 1H1WA 4GIHA 4KRCA 5HG7A 3VUIA 4RIWB 4F9WA 2XIKA 3S4QA 3CTQA 2C68A 1S9JA 2ITZA 3LJ2A 4FBXA 4XG8A 2WB8A 5ANEA 4FSYA 3D7TA 3UP7A 3M11A 3Q9WA 4D5KA 2XNBA 5IG1A 4QYGA 4U97A 3VS4A 5DYJA 1FOTA 4BN1A 4FKLA 3AOXA 3UG1A 2WQEA 4AZFA 3ACKA 2XAOA 1ERKA 1UNGA 2NRYA 2UV2A 3FMHA 3OWPA 2YDJA 2BCJA 1T46A 5CT7A 5ICPA 3P08A 1LUFA 4IVDA 4QP4A 4NL0A 3RINA 2C3KA 2UZBA 4L44A 2V0DA 5DVRA 4C3PA 1R78A 5IU2A 3ORXA 4UX9A 4JX7A 4B9DA 2ZVAA 3OBGA 4EK3A 4AX8A 4YO6A 3HP5A 1CTPE 3F82A 3KEXA 1WMKA 3MA6A 5DR6A 4A07A 2IG7A 2XK6A 3C4ZA 4DFLA 4V04A 4AE6A 4UBAA 4FUXA 4P4CA 3PIZA 3KCKA 1NA7A 5HU9A 5CF6A 3ORZA 1YW2A 2RGPA 4RZVA 3MB7A 1B39A 5AR2A 2HZNA 3QQLA 1GIIA 3QAME 5IISA 2G9XA 4BTJA 5CZHA 2XK3A 4I5CA 4EK8A 3PY1A 2AYPA 3LZBA 3MIAA 4MXZA 3AMBA 3N4VA 2R3IA 4AACA 5JQ5A 5K3YA 5LVOA 5D9HA 5KHXA 2XNMA 4MX9A 2ZV2A 4ZSGA 3OF0A 2BPMA 4OTPA 1IA9A 4IANA 4H05A 3IGGA 4KS7A 3N51A 5CWZA 3NCGA 4L8MA 5FG8A 4O84A 4E4NA 5C8KA 3SVVA 3OEZA 3VBQA 3ZM4A 3UNJA 2BIYA 4D0XA 3R6XA 3FZTA 3OUKA 2X7GA 3QWKA 4PX6A 3RK7A 4ZTNA 2GHLA 3GQLA 3MYGA 1U54A 3WF8A 1WBPA 4C02A 1PRYA 5GIOE 3KXNA 4I6LA 4HW7A 4LUEA 4FOBA 4TYHA 4YNEA 4I94A 1GZOA 2QHMA 3HEGA 1G8KA 2C30A 4BDIA 1ZZLA 4O2PA 2XIYA 3MV5A 3VUGA 2ONLA 2E9NA 4X0MA 2ZFYA 3ZZWA 4C37A 5HHWA 1H1PA 4O91A 2PMNX 4PPAA 2UVXA 5BVEA 4HYIA 4R1YA 3EL8A 2B1PA 4YLKA 2HOGA 4YC3A 4C38A 4AXCA 1HOWA 5JRQA 4AUAA 4ACDA 3MFRA 3F3ZA 2UVYA 4I3ZA 3EKNA 3R02A 5AMNA 2WQMA 4TRLA 2JKKA 3HL7A 2JAVA 3V51A 2WMBA 2CGXA 3T3VA 2J0KA 1OKVA 4JS8A 2Z2WA 4MD9E 4QTCA 4DHFA 4DBXA 1U5QA 4FIFA 3UQFA 3AKJA 3KRXA 4RG0A 3UIMA 3DNDA 3HVCA 5EDQA 4C2VA 4C7TA 3HECA 1YDTE 3QF9A 4HGLA 3R7OA 3TDVA 1RQQA 4EL9A 3EQCA 2IEWA 3EN5A 5HBHA 3NUNA 2WU7A 2W1IA 4ANQA 3TIZA 3RPYA 4NM7A 5I4NA 2X4FA 4BZDA 2OZAB 2VGOA 3NLBA 3D94A 3OTVA 2YIXA 4LV5A 3UQGA 1FMKA 3UDTA 3PLAE 2CLXA 1VYWA 2R3JA 4XP0A 3DQWA 5FLFA 3DK3A 3AMYA 3FLWA 4RVMA 3WZDA 4PTCA 3R9NA 1WBNA 2FSTX 4FTOA 2VWVA 3OMVA 4FTAA 4BTKA 2YIRA 3MVJA 4JG6A 4QMSA 4CTCA 4IW0A 4K1BA 1OKYA 5AJQA 4EZ5A 1WBSA 4ZJJA 3O71A 4JDIA 5C9CA 4IMYA 1XMLA 3FI4A 4KIKB 5CF8A 2PVFA 3QHRA 4GUBA 3QGWA 3LKMA 5EYDA 1FVRA 4H3PA 3GVUA 5KMNA 3H10A 5L8LA 3GCVA 3ZDIA 4ITIA 2HENA 5HLPA 5AX3A 4CSVA 1NXKA 2IF8A 3H4JA 3SXFA 3SC1A 4ASDA 4DC2A 2W1DA 1YXTA 2CSNA 3WIKA 5FEEA 4FEXA 2YDKA 4AGWA 4R6VA 4GT4A 4XOYA 3W2PA 5IA1A 3E8CA 3QCXA 5AP4A 5HX6A 4KS8A 4MUQA 3E63A 4PDPA 4RBLA 4M84A 4BKYA 2X7FA 4U9AA 3QUPA 4V0GA 3HV7A 1M2RA 2UZOA 4FTQA 3QA8A 4FTMA 4C62A 4FT3A 4XG6A 4EH2A 4C4EA 3QTWA 5ETAA 4M0YA 3RAKA 3MY5A 3VUHA 2IWIA 4USEA 1JSVA 3ZRLA 4F7SA 2BR1A 2R3GA 3ORPA 1Q5KA 5LVNA 3TKIA 5H8GA 4X2GA 5E4HA 3OD6X 2JAMA 4JIAA 4OTFA 4C4JA 1GZKA 5J87A 3ATSA 4ZLYA 3OOGA 3GC0A 1NVSA 4C2WA 2NRUA 4CFWA 3DBDA 3E5AA 3E64A 5EYKA 3MVMA 3V6SA 5HICA 1O6KA 3TV7A 2BIKB 4QMXA 4B0GA 5LMKA 1G5SA 1WVXA 3WIGA 5CEOA 3KGAA 4D0WA 4C57A 5I9VA 2YITA 2KULA 4MH7A 3VQUA 4QMLA 3IQ7A 2XS0A 2ETRA 3UC4A 4DITA 3O23A 4JBOA 2YM5A 2GPHA 3L9NA 2QO2A 2WTCA 4AT3A 1ZRZA 4XNEA 5D10A 4HVSA 1Q8TA 2OJJA 4R3CA 4Y5HA 4FG7A 1CKJA 3EQIA 4G3GA 4AN3A 5L2WA 2F2UA 4NT4A 5K0KA 3R9OA 1YI3A 3ZCLA 4O7ZA 3FEGA 2W1FA 2XYNA 4A7CA 2CNUA 4E6CA 2QO7A 4QTEA 4R5SA 5EM6A 3PA5A 3SLSA 4Z7HA 5BQ0A 2JFMA 4QQJA 4AFJA 5BYYA 4DFUA 4CT2A 2E9OA 3E8EA 3POZA 4JT3A 3SAYA 3G0FA 3KF4A 1LP4A 2W99B 4FIIA 4NU1A 1QPDA 3W55A 4AGUA 4QQTA 5IA2A 2VN9A 4JMQA 3DKGA 1L3RE 4FKQA 4JG7A 4CNHA 5HVYA 4GFOA 4RMZA 3R0TA 4CCUA 1Y8GA 3TNHA 4L7FA 3W0SA 2YLEA 1R0PA 5CEKA 3DXQA 4H39A 1QCFA 1PKDA 3MTFA 2B53A 2PMLX 2WIPA 4C61A 3HA6A 2C6DA 3VN9A 3NGAA 5ETIA 4O0VA 4RWKA 2PE0A 4GYGA 3EWHA 2XNPA 3SOCA 4BHNA 1SNXA 4BDAA 1G8SA 3AD6A 2C0IA 4MK0A 4ZLZA 5HIEA 4U42A 4UMQA 4I22A 5A4LA 5C8NA 4XRLA 4IC8A 3Q2JA 3KVWA 3CCNA 4ZMFA 3OC1A 5L4QA 1YXUA 4PL4A 4DINA 2B0QA 3TNWA 1PXMA 2ZV9A 5CEMA 4YJOA 1WBTA 4YZ9A 3UODA 4GV1A 3EH9A 3BHHA 1FVVA 2VWZA 5M57A 1OBGA 4FV3A 2EB2A 4ONAA 3EQRA 3OXIA 4X3JA 2OG8A 3AC4A 2C3IB 3VJNA 2I40A 2WMVA 3EL7A 3BWJA 3C4XA 5AR5A 4EQCA 3GC8A 1M2PA 4KB8A 2RFSA 3C0HA 3B8RA 1PXJA 2PZPA 3RCDA 2DUVA 3LLTA 5LVMA 3VF9A 3PE1A 2E9VA 5HEZA 3ZU7A 4QEBA 2UW4A 3BYOA 3FWQA 3WZJA 3W0OA 5C8MA 2C1BA 2IZTA 3WYXA 4G6OA 1IAJA 4MNFA 1SMHA 3SGCA 1OL5A 2R3LA 4DEEA 4NJDA 4L6QA 2REIA 2R2PA 4BCQA 5TR6A 4FGBA 1KOBA 5EM8A 4CMOA 3PPJA 3LM5A 4NWMA 2X8IA 4I24A 3HMNA 4LMNA 5IA3A 4A9RA 5JSMA 5GJDA 1OMWA 2XK4A 3R83A 3PXQA 3GENA 3EQPA 4EZ7A 4AQKA 3C7QA 4O0XA 3D83A 3UZRA 4NK9A 5L2SA 3KN5A 3WILA 3RBWA 4MVFA 3VONA 3COMA 3RZFA 1P5EA 4KKGA 5ANOA 1OUKA 4D9TA 3QTRA 4GJ3A 2V62A 3DKFA 3V3VA 5HCZA 3MH3A 3NNVA 3VRYA 4J71A 3ROCA 3SRVA 5CU6A 2ITVA 3IECA 4EBWA 4YSJA 3F2AA 3BHTA 5D11A 3KVXA 4QP8A 4CV9A 3HUBA 4C4HA 5CNOA 5HGIA 4C34A 2WFYA 4AS0A 4HVGA 2HZ4A 5F9EA 4PDSA 2ZM1A 3ZOSA 1GAGA 5KUPA 3CD3A 1PMVA 4XBUA 4ZAUA 1VLRA 3RNIA 3UOLA 4IACA 4GMYA 5C27A 3UO4A 3KXHA 3O7LB 4EH8A 5ACBC 5LVPA 2PU8A 2C6KA 4I20A 4AE9A 3PTGA 3O0GA 2BRMA 4CFVA 4N70A 2OU7A 1J7LA 3FMDA