2GNMA

P. angolensis lectin (pal) treated with edta for 39 hours
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
240
structure length
240
Chain Sequence
EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interplay Between Metal Binding and cis/trans Isomerization in Legume Lectins: Structural and Thermodynamic Study of P. angolensis Lectin.
pubmed doi rcsb
molecule keywords lectin
molecule tags Sugar binding protein
total genus 51
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2gnmA00
2CYFA 4XXAA 5GZFA 3GNEA 2ZHLA 3D5OA 4WV8A 3ZSJA 5HCAA 1N1YA 1MS5A 1MZ6A 3SITA 3DGTA 1D0HA 3IMNA 1AJKA 2A70A 5CBLA 4OZXA 4U2AA 4BLIA 1UL9A 2P3KA 2D43A 1NLSA 2PHUA 3HN1A 1Q56A 5GLWA 2D44A 3OY8A 2DTWA 5H9QA 4AVTA 3O0WA 2A3XA 3RS6A 1I3HA 1R1ZA 1LODA 3ATGA 4YG0A 4YM3A 4P14A 2A6ZA 1LEMA 1AXYA 4Y26A 5DUWA 1G9AA 2DVGA 4Y1UA 1AVBA 1DHKB 1W6PA 2WLQA 3CNAA 4L8QA 3ZSMA 1QOSA 2A71A 2ERFA 2ZZJA 4Q8LA 3AZWA 3A0NA 1QDCA 3R4UA 4LBQB 3AP4A 2ZGQA 4LBOA 4TYSA 2AUYA 2SBAA 3W58A 4FQ4A 2NN8A 5KXEA 1SLCA 2HYKA 1RINA 4UW6A 1V00A 1S1AA 2ZGPA 5GZEA 1CPNA 3AYAA 1LGCA 2PHFA 1AZDA 1LHUA 3AXDA 1G9FA 4M3CB 4M00A 5T5OA 1AXKA 4YW3A 1IOAA 2DU0A 1V6IA 2ZGOA 3N7MA 2WQZC 4P9WA 3RG0A 1YO8A 2D6LX 1KDKA 1DYPA 2NM1A 1W6MB 2C9AA 1WUVA 4NOTA 1FV2A 2JD4A 3USUA 3OGGA 3POWA 3UK9A 3VKNA 1UN1A 3WHUA 3D6EA 3R4SA 4YG6A 2CWSA 1A8DA 2EXJA 2I2SA 2YZ4A 4ZXKA 3IPVA 1MS9A 2UWCA 4P9YA 2R0HA 3T1LA 1H9WA 3FUOA 4GKYA 1YXWA 3WDXA 2CWMA 4AVVA 4XIKA 1F5FA 3WCRA 1GANA 1VALA 1JYIA 1SLIA 3ZXFA 4UW5A 1AX0A 5GLVA 2ZHMA 4Y1VA 1UAIA 2ES3A 3VKMA 1QNYA 3INAA 5JOYA 1JOJA 1N3QA 4Y24A 5CNAA 5H9PA 1YI7A 1AXZA 1IKQA 1S0IA 3ILRA 4K1ZA 2CL2A 2R0FA 3PVNA 1HQWA 2YMZA 2OUHA 3NV4A 5H9RA 5F5QA 2E6VA 4UW3A 1W6OB 4K20A 2D6OX 3BTAA 1J1TA 1O4ZA 1S0BA 1GNZA 4Q8KA 4ZKTB 3BODA 5DZEA 1SCRA 5KXBA 4JRAA 3U4XA 1LCLA 1X50A 2SLIA 1GZ9A 2YROA 3N36A 5JVVA 2UWBA 1LOFA 1CJPA 1ENRA 1LOEA 2WT0A 4FPOB 5JMCA 1N47A 1GV9A 2D6KA 3M1HA 2LTNA 1BZWA 1WCSA 2W68A 1QNWA 3BOPA 3IKWA 3N7LA 5DZFA 1NXD1 1OFSA 4FOVA 2ZGRA 2CNAA 4PQ9A 1LTEA 4WZFA 3ZYPA 1H9PA 1WD4A 1LHWA 1IS6A 3AJZA 1MS8A 2XG3A 4YGCA 2A6XA 1WD3A 1MACA 2AH2A 1QU0A 1G8WA 2ZGSA 2ZGKA 2ZABA 4M3CF 4YGDA 2DYCA 4YZ3A 1AX2A 1UZYA 3MW2A 4P9XA 3WUDA 2D7FA 3WNXA 1DZQA 1S0DA 3H0OA 4FPKA 4YGBA 2CTVA 2NMOA 4I30A 3RMXA 3ZSLA 2VW0A 4ISRA 2R16A 2VH9A 5KXCA 5T5PA 1CPMA 4XTPA 2YY1A 4Y20B 2AREA 1DQ0A 3C2UA 3RMYA 1HLCA 1SFYA 2ZGMA 1Q8PA 2UU8A 4AVSA 5DZGA 2V5YA 1S0GA 4XYXA 3ILFA 1BJQA 3UL2A 1LHOA 1DBNA 4YM2A 4FPEA 5JLVA 4ATFA 4FPYA 1W6NB 1JN2P 2Q5TA 4LBLA 5KXDA 3N7JA 4YGEA 3WUCA 3JUUA 1G9CA 2WT2A 4FOQA 1C1LA 2GALA 3B69A 1S0JA 2GN7A 1JHNA 1N1SA 2AENA 5EYXA 1CONA 2A6VA 4BM8A 2GNTA 4Y22B 1F31A 1WLCA 5AVAA 3FFZA 1GICA 1SBEA 2RHPA 4XXPA 1MVQA 1MS3A 3ZXEA 3O0VA 1ULDA 4FOYA 1V6OA 3V0AA 2NZ9A 1JBCA 4DPNA 1Q8QA 4LBKA 2A3YA 2E7TA 4DFSA 5CAZA 1W6QA 2EAKA 1Z0HA 2B7YA 3AP6A 3QCWA 3MPPG 1GKBA 3N35A 1B09A 1N1VA 4XJZA 2A6YA 2AYHA 3ZSKA 4BLJA 1LOAA 3B3QE 1LOCA 4R9AA 2WKKA 2ZACA 1SBDA 4RA0A 3I4IA 2ZMKA 5T52A 5GJ6A 3SH5A 2DUOA 1UKGA 4FPGA 1URXA 4XJWA 4YW2A 2R1BA 3WG1A 5EYYA 3HR9A 1SLTA 1PZ9A 1LECA 2C5DA 4FP2A 4KBBA 3ZYRA 3ZPYA 1VIWB 2W39A 3WDTA 1S0CA 3VKLA 3R05A 1ZM1A 3WLUA 1MS4A 1YYNA 4Z8BA 5T50A 2DU1A 4FPLA 3N3HA 3WG3A 1FYUA 2VY0A 4XZPA 4LBQD 3OYWB 3V0BB 1SLLA 1ULGA 1Z78A 2DWRA 4LBNA 4XIOA 3WG2A 1V6JA 1VAVA 2E7QA 2VW2A 2ZHKA 4LBJA 5EWSA 2W08A 1GZWA 1KITA 1C1FA 2LALA 4WVVA 3B01A 1KDMA 3OPZA 5F9TA 2XB6C 2H0BA 2YV8A 3RRDA 1FAYA 3MW3A 1GZCA 2GDFA 1FATA 2JE9A 3PVOA 3AK0A 2FMDA 2ARBA 1Q8VA 2A3WA 2D3PA 4BMBA 4TZDA 1W0OA 2D6MA 1CN1A 2D3SA 2VUAA 2W52A 3DUIA 4Q26A 4AYUA 5JOXA 4R9DA 4XILA 3OJBA 2D6NA 1RITA 3LCPA 3NV3A 4Y1XA 3I8TA 4U36A 4DRVA 3ILNA 4HANA 4R9CA 2VXRA 4YW5A 3VV1A 1V6KA 4ISQA 2DV9A 2GMPA 3M3CA 5E89A 1BKZA 3FUQA 4XMIA 5FREA 1KJLA 4JC1A 2ZGUA 2Z42A 5BYNA 3MW4A 3AZZA 5HCBA 3LSEA 1V6LA 4YZ1A 1DLLA 2P2KA 3NV1A 2GMMA 2PHTA 4XJUA 1MR5A 4YFZA 3AZYA 3APBA 5DG1A 4CTEA 2E53A 1IS4A 1LOFC 4YM0A 1YRZA 2GNMA 2P3JA 3OY8B 2WSVA 1CVNA 5GZGA 1ULCA 4PBPA 1DIWA 1Y7BA 1GBGA 1JUIA 2DVFA 2NP0A 3AP9A 4YZ2A 5GALA 4GXLA 2ENRA 4LBQA 1GLHA 2ZKNA 5DG2A 2JECA 4RL7A 1W6PB 2R1DA 4CRQA 2ZAAA 1AJOA 4AGGA 2A6WA 3O5SA 4Y1ZA 3WVJA 1WLWA 1HKDA 2AGSA 3N7KA 3WDWA 1ZA4A 2GMEA 1DGLA 4M3CA 4XHXA 3ZXLA 1BXHA 3T1MA 1KJRA 3D4KA 4ITCA 1XQNA 1LGNA 3A0KA 4Q1RA 1W6MA 3AYCA 1DQ1A 3FLPA 5DUUA 1FNYA 4PBOA 5DUVA 2EXIA 4XOGA 3V65A 1DQ6A 4XBNA 4NO4A 2JE7A 2EXKA 1G7YA 2PHWA 4HL0A 5GLUA 5IK8A 1AF9A 1LHVA 4FQZA 1WW6A 1UMZA 3PMEA 1WW4A 5GM0A 1CQ9A 1LHNA 2A75A 3AXEA 2OVUA 5T55A 2G4IA 3WDVA 1ULEA 1DQ4A 3M2MA 2ZHNA 4GA9A 4M01A 4XBQA 1QKQA 5L73A 4C1XA 5CA6A 3FBYA 1G9DA 3IPVB 1GSLA 2PHRA 2ZMNA 1N3OA 1WLDA 5CB7A 4WVWA 5IT6A 3POSA 2VW1A 5GZCA 4Q27A 2ZGTA 2E51A 3SLIA 1ONAA 1G9BA 1LULA 4Y1YA 3O12A 1PZ8A 4YG3A 3SH4A 1CESA 4AGRA 2P37A 1A3KA 1BQPA 4BQ1A 4FPJA 3SISA 1U0AA 1W6OA 3M3EA 2WNEA 1VAMA 4H55A 5IK7A 3JU9A 4XHBA 5JOWA 3AP7A 3ZXKA 3B00A 1G86A 2OUJA 3WCSA 1APNA 3KM5A 1LJ7A 2CY6A 4Q1PA 3RQ0A 1QGLA 2NMNA 1H30A 2TEPA 2D6PA 5HCFA 1RIRA 5IK4A 2ZBJA 1A78A 3MEPA 4FPHA 5EXOA 4FVVA 4PCRA 1TEIA 2UWAA 3WG4A 1F9KA 3ZXJA 5IK5A 1LOGA 3AX4A 3QLQA 4YM1A 3UJOA 3VKOA 4R9BA 3VKFC 4ATEA 5IUQA 5SV8A 2DTYA 3IM0A 3W59A 1IS3A 4XBLA 1LGBA 4YFWA 3UJQA 3HMYA 2EIGA 3AFKA 4MYEA 4YW1A 1CIWA 5JOZA 3NV2A 2JDZA 3AYDA 1QMJA 1C4RA 1ENSA 1QOOA 1SLBA 2DURA 2EXHA 2AR6A 2JKBA 2VU9A 1D2SA 4Y20A 3FLRA 3ENRA 2DVDA 1GNHA 1OKQA 3AZVA 1DFQA 2ZA9A 3PVEA 3A4UA 3ASIA 4GKXA 4XE9A 2YXSA 4K1YA 2UURA 5GZDA 2R49A 5FRAA 3V64A 1W6NA 4XJ8A 5JDBA 1O4YA 1Q8OA 2GNDA 1DYKA 4XDQA 4BOWA 1LESA 1SBFA 3NWKA 3AYEA 4ASMB 3FLTA 4FPFA 1LU2A 3WDYA 3RSJA 4FOWA 3M3QA 3WOGA 3ZVXA 1QF3A 2OW4A 3VUOA 4DS0A 5T5JA 1MVEA 2P3IA 1LENA 1LOBA 2A7AA 4Y22A 3WV6A 1SCSA 1WBLA 4XJAA 4FP3A 4K21A 4CZSA 2DUQA 1MZ5A 3Q9OA 1UZZA 4BMEA 2ZGNA 2DVBA 1V6MA 2WSUA 1PZ7A 3WHTA 4Q2FA 1AX1A 1N1TA 2FHRA 2WT1A 4D69A 1KRIA 2ARXA 1S0FA 1IKPA 3BIWE 4LBMA 1HQLA 2JJ6A 1JW6A 4GWMA 5T54A 3OBTA 3TB0A 2A5ZA 2V73A 1BYHA 4M3CE 4PF5A 1JXNA 1EPWA 3V0AB 4GWNA 1UX6A 3AZXA 2DUPA 1W6QB 1ULFA 1S0EA 4JCKA 1LU1A 3L2YA 4W65A 1SLAA 2PELA 3AP5A 4YLZA 1SACA 5GLZA 2D3RA 4DQAA 1KQRA 1V6NA 1JYCA 1Q8SA 5T5LA 2WJSA 3TAYA 4XTMA 1FV3A 1WBFA 2EALA 1DQ2A 3LSDA 5E8AA 2BQPA 3B9CA 4XJ9A 3SH3A 3WZ1A 4AWDA 1N3PA 5GLTA 3OBRA 2ZGLA 1YIFA 1IS5A 5DXDA 5E88A 4IQPA 4YW4A 3OYWA 2DVAA 3V0BA 4DRRA 2ZMLA 1GYKA 1QOTA 1MS0A 1VLNA 4F83A 1W0PA 4YZ5A 4YZ4A 5H9SA 3AJYA 3O0XA 1UPSA 1WW7A 5LK5A 4AGVA 1HDKA 1QDOA 3POYA 1ENQA 1FNZA 4SLIA 3SNMA 1C57A 1WW5A 2GN3A 3T2TA 3USUB 2EF6A 1MS1A 2NYYA 4C1WA 1DQ5A 3WDUA 2KM2A 3M3OA 4XMAA 3IN9A 4FPCA 1GZWB 2GNBA 2P34A 1CR7A 1FX5A 1LEDA 3PJQA 5DUXA 1I1EA 1OQ1A 3GALA 4UW4A 4BPZA 4GALA 3KQRA 2PHXA
chains in the Genus database with same CATH superfamily
4N90A 4XXAA 3FBMA 5FY1A 1EV12 3V56A 4EN6B 5KC6A 2TNFA 3VLBB 1ENXA 1OLME 3IMNA 3BN6A 4UFHA 4ET7A 2W91A 5FZIA 2CSGA 4U2AA 5CBLA 2PHUA 4W4ZA 5A32B 3C7GA 4Q4V3 1VMHA 4D7SA 1Q43A 2JDKA 3KB5A 1XNBA 2WRAA 4OHZA 1IQDC 2A3XA 2J1VA 2XBO1 4N43B 1K12A 1LODA 3ATGA 4YM3A 4P14A 3U10A 3VZLA 5FDBA 1AXYA 3N4MA 3I2FA 4H7LA 3BU0A 5I93A 1LR5A 2MEV3 4Y26A 1WZXA 2DVGA 4HFSA 1AVBA 2V4AA 3T30A 4LQRA 2P5BA 1B35C 2WNVB 5FYMA 4Q8LA 2GU9A 3MFCA 5FPBA 2HLEA 4JGYB 4ASKA 4NIIA 4EZHA 2RS53 4TYSA 1RUG3 5IVCA 4AQ6A 5DAQA 1SLCA 2XJPA 4MO3M 4UF0A 1BEV3 2ZGPA 3W20A 5C8CC 3AYAA 2PHFA 1PHMA 1UD1A 3OB8A 3RZMA 1CAVB 5C9AC 1AXKA 3DYPA 3OUIA 4BZ4A 1Z7S3 2NPIA 3N7MA 4N8MA 5F6KA 5L9RA 2LRPA 2NM1A 2CAUA 1PMIA 2QNKA 1WUVA 2JG9B 3POWA 2CDOA 2QQLA 4BDVB 3ZYFA 3FX3A 4BQ3A 3D6EA 1HB2A 2DFBA 3R4SA 4O9EA 5FO8B 2CGNA 2EXJA 2JG8A 1GU3A 4ZXKA 4CDXB 3IPVA 3AMHA 3W5NA 4RQPB 1RUC2 1PMHX 1LB2A 1T6GC 3MF6A 2VL4A 2CWMA 2BVBA 1SEFA 4NN0A 1F5FA 3WCRA 2ZCWA 3GGLA 1RUI3 2XQRA 4OUEA 4GWJA 4UW5A 1BVP1 1PO11 2X5IB 1KEXA 1H2NA 4YVSC 4HVOA 2W95A 3VKMA 3PUQA 1CAXB 2VZ3A 1YWKA 4FTSA 4DO0A 3NJZA 5F2SA 5HI0A 5H9PA 1YI7A 5IVEA 3WP5A 4K1ZA 2NLRA 3KGZA 3M3IA 5H9RA 5K0UB 4NRPA 2QQWA 4K20A 1NLRA 4CXYA 1S0BA 4AEDA 2HEWF 1GNZA 1TVGA 1XJAA 1W05A 3SEPA 4CDUC 4CDWB 1ZREA 5KXBA 2HWC3 3MFAA 4LE4A 3O1SA 2SLIA 3MV01 3KCCA 4IERA 1LOEA 3ACGA 3I59B 4BQYA 4LO8A 1AR92 2D6KA 2QUOA 3M70A 3RNSA 1OSGA 3S7IA 5BNNA 5DZFA 4IEOA 1S2BA 1FOD3 5IAXA 2D40A 2VGDA 3POGA 2ZGRA 2CNAA 2N7GA 5EQUA 4YGCA 5IVFA 2UYAA 5JWPA 1WD3A 1PMJX 2VOTA 1GOGA 2VC9A 3DPRA 3RZKA 4YZ3A 3WUDA 5CZKA 3WNXA 1L7QA 2G19A 2RS11 4EZ4A 4FFHA 4IEVA 5BNPA 4FPKA 4AFMA 5JXIA 2CTVA 4LKFA 4MV2A 2RJKA 3LDRA 1BMV1 5BNQA 3E97A 2Z2SB 3NJXA 3TWIA 2RV9A 2VH9A 4EWDA 2DCZA 1CPMA 3ME2A 4CCMA 4FSJA 1ND3A 5F8PA 5A6ZA 3N9MA 1DQ0A 1XXNA 4WZCA 4QX8A 2B9VA 3GJBA 1Q8PA 2UU8A 3M8LA 4IV1C 5FMOS 3OF1A 4XYXA 3ILFA 1BJQA 1E5SA 3MLKA 2P1BA 3UETA 4CPBA 2JD9A 4AVCA 4YM2A 3T2QA 1NXMA 4FPEA 2RMU3 4FPYA 2GH8A 4XUOA 3Q8CA 1OF4A 1NCRA 5DPNA 3SKJE 4CDQC 1G9CA 1CWPA 1RUH2 4FOQA 4BQ2A 1C1LA 3TN92 3IT8A 4QMAA 2JDUA 2KXLA 2LM3A 2R7EB 2XLFA 4PI0A 5EYXA 2KD7A 2GNTA 5FY4A 1F31A 1NOVA 5AVAA 4BK4A 3FFZA 1L7RA 1MS3A 1CAWB 3O0VA 2YG0A 4FOYA 3POBA 1UU4A 4Q4Y2 2CDPA 4D6RA 4FXKB 1I5PA 2VMCA 1JZ5A 1U5YA 4DFSA 4Y5SA 2EAKA 5CAZA 2GC1A 1DZRA 1POQA 1CX4A 1EYBA 2XLAA 4Q4W1 4XUQA 1B09A 5FK8A 4XJZA 3ZSKA 1JZ4A 3I2OA 1PGL1 4FFIA 1XNAA 5KHKA 2OYZA 4QQLA 3KV9A 2VUJA 1URXA 2W1SA 3UV9A 4XJWA 1DGRA 2DCKA 5FXZA 4LK7A 3HR9A 3RYKA 5CKNA 3RWKX 2JDPA 1TNRA 1FXZA 4XAAA 1DZTA 2W39A 3WDTA 1S0CA 4CDUB 1WMEA 3KT7A 2Y6LA 5D21A 2Z79A 1MS4A 1W0NA 2PAKA 4JHZA 1W3XA 4Z2WA 3LIHA 3H50A 4JX0A 3WG3A 1D4M2 4DMIA 2VY0A 1HXS1 4LBQD 1SFNA 1UXXX 2O8QA 2Q4SA 2VR4A 4LBNA 2YDEA 4OYUA 5IVBA 4OLLA 1ALYA 2QQJA 5HXVA 1ND2C 5EIYB 1VAVA 2VW2A 5A1LA 1UOJA 3IAPA 2W08A 1GZWA 1KITA 5EWSA 4B7EA 3WD5A 1RUNA 4WVVA 3RPQA 1KDMA 2VOXA 4AOCA 2WZR1 3HJRA 3J7NA 1OUXA 2D97A 3MW3A 2EICA 4GMP3 2WABA 4NHLA 2X09A 1Y9MA 3PVOA 1K5MC 5I8SA 3WT3A 2VMHA 3EHKA 1W0OA 5FWEA 2RJLA 5AC93 2Y6HA 4AYUA 2QQPA 2OIIA 1H4HA 3AMQA 4R9DA 3OJBA 1QHDA 3JBG3 1W8TA 3WF2A 5FYYA 5JIAA 5HPOA 1DU3D 4DINB 5CU1A 1TG7A 4KWLA 4IV1B 4I3PA 1O59A 2DV9A 2GMPA 4ISQA 4RS5C 3M3CA 3ZYIB 4XMIA 3B02A 5A32A 5JXJA 3DKWA 3VB9A 1ZBA3 4E27A 2Z42A 5BNOB 2R073 2RM23 3AZZA 2Z5WA 4JDOA 5HCBA 1R64A 4CDQB 5IHRA 4Z07A 4N43A 4MGTA 2VUDA 1MEC3 1U5XA 1X36A 4AZZA 1MR5A 3T0AA 4K7JA 5FY0A 1RXFA 2GC3A 1HV1A 4IGQA 2E53A 1PO21 4R4XA 2OT7A 3K3OA 4YNIA 4LR4A 2GNMA 4OI4A 1CVNA 4TWTA 2WNVA 1DIWA 4KMQA 4JGYA 3HQXA 3CZJA 3HNMA 1RVF3 4XF0A 4HXCA 2Y26A 2E32A 3RYPA 4CXXA 3GM8A 1W6PB 4AVAA 1UIJA 1W8HA 1DGRN 2BZDA 4UFMA 1RUD3 2A6WA 1UXZA 1JUHA 3N7KA 3WDWA 1RUF1 1M4WA 1WMFA 1CAVA 2XHKA 3WR0A 3EJKA 4G3YC 3QH6A 1BXHA 4OVEA 5A3LA 5A1AA 1RUJ1 2LROA 4O9GA 1WLTA 3A0KA 1WCDJ 1AL21 4OI1A 2JIGA 2YGLA 2DCJA 3AYCA 4GJZA 1DQ1A 1VRBA 3LAGA 2JG9A 1FNYA 4AW7A 3NJVA 2XJRA 3TEXA 4CDXA 1AR81 2JE7A 2IXHA 4B1MA 1JODA 4CXWA 4FQZA 2VCAA 4RQPA 4TZDA 1RMU3 5B4NA 3AB0A 2ZX2A 1FPN3 4XCBA 3FJSA 1JI6A 3ZFGC 2OVUA 3WQ0A 2BJSA 2PA7A 1ULEA 2UY9A 4PLNA 1R091 3ZXDA 1ND2B 2ZHNA 4M01A 3BOWA 4JTOA 4C1XA 4A6SA 3FBYA 1G9DA 1GSLA 2X5IA 2XR4A 1N3OA 4META 5HXMA 3O1OA 3VBFC 1CAXA 1ZVFA 1K3IA 4IE5A 3POIA 1PZ8A 1O7FA 2P37A 3DYMA 5K0UA 4WVMA 4IE7A 1U0AA 2YGMA 1OBNA 3X29B 3M3EA 4XETA 1VAMA 4H55A 2OQ7A 3JU9A 4PIXA 5J1XA 3WF0A 5IFPA 2WC2A 1VBC3 3A21A 3AP7A 4CCDA 2XHNA 3GCXA 1BK0A 1FI2A 1OVPA 3M4FA 3H8RA 4RS5B 1XOYA 4Q4V2 4CCEA 1APNA 2Y6KA 2HWF1 1UPIA 3RQ0A 3VBSC 4HT1T 3I59A 4IW3A 2BOJA 1PVC3 1V70A 4EN8B 2JXAA 4RR3C 2H6BA 4Q4X2 5FZHA 3NNMA 2TEPA 2D6PA 4NWVA 3RGBA 3OD4A 3JXSA 2MEV2 5EXOA 4FVVA 5FZFA 1LAJA 3WG4A 1DG6A 2LW8A 3AX4A 3G6JB 4QQHA 3UJOA 3VKOA 4R9BA 3OPTA 2FMYA 5SV8A 4EROA 1V9U2 2IUWA 4NROA 5HV0A 2DBNA 3HMYA 2RS52 2BNNA 2WA4A 1O8SA 1YFUA 1OF3A 2LUWA 1OH3A 5IW0A 3I3EA 3UK9A 2EXHA 2VU9A 2XBO3 5LZ6A 1QXJA 2X10A 3THTA 1BEV2 1HW5A 1UZ0A 1GNHA 1OKQA 1XNTA 4IE6A 2ZA9A 3PVEA 1EAH1 2J1UA 1AUYA 1Z7S2 3NRUA 5A7SA 3VZOA 2R49A 4B4RA 5DDJ1 2PHDA 4FAHA 3T3YA 5JDBA 2Z4FA 1F4AA 3D0SA 4QKNA 2F6BA 5J37A 1LESA 1SBFA 3NWKA 4ASMB 2Y6JA 4LT5A 5JR2A 2ID4A 1TNFA 1YJKA 2J7MA 3DL3A 2ARAA 2BGOA 3M3QA 1QF3A 2VZTA 3DKQA 4AI1A 3VUOA 2XUEA 1MVEA 4YARA 3GCWA 4CZSA 4K21A 3MGUA 3S30A 1XSRA 1UZZA 1CAWA 2R6QA 1GWMA 3NJYA 1ST8A 4KL1A 1RUI2 3WW2A 4Q2FA 4QPGC 2ADEA 1PGW2 1TME3 3K46A 2ARXA 4NMIA 1KXGA 3I2GA 1S0FA 4KWUA 4RGAA 5FBZA 1VJ2A 4XDOA 1W8FA 5J7MA 3TBDA 2XWJB 1X82A 3TB0A 2YC2A 3OEAA 2JENA 4MXWB 5LEJA 3E6BA 3IMMA 1SG3A 1R1A1 1C8M1 1MPXA 1W6QB 4CCNA 1T2XA 4QAWA 1O8PA 2CGPA 4HLTA 1KRIA 5JIUA 1J3QA 1NE6A 5FPVA 3AP5A 4DQAA 4ZPIA 1RUOA 2D3RA 2B9UA 4CDUA 2VMEA 2HWC2 1ACCA 5JI9A 2WN3A 2WJSA 4LJHA 3WY6A 1NCQC 4LHLA 3PJYA 4D7YA 1DQ2A 3LSDA 3RFRA 3CIHA 1QWRA 2IXCA 3Q8BA 3ZPOA 3SH3A 4AWDA 1N3PA 1QJZA 5A7NA 5GLTA 1FOD2 4FXGB 4O7XA 1IS5A 2MHFA 5E16A 4IQPA 4YW4A 4BB3A 4QXKA 2WUHA 1GR3A 1GYKA 1MS0A 4L11A 1REEA 4F83A 1UY1A 3UYJA 1STMA 1W0PA 3O1VA 3OUHA 5L19A 3O0XA 1HB3A 1VBB1 2C26A 2WS91 3I2DA 1JYXA 3T08A 3WNMA 3HEIA 1OA4A 1VP6A 3T2TA 3J8F1 3LEIA 2QJVA 2BEOA 3NVCA 4NVPA 4C1WA 5I8YA 2XPJA 2J1EA 3IN9A 2GNBA 3URFA 4I02A 3IIIA 2AC1A 3PJQA 1D7PM 1I1EA 4UT5A 3WINE 4F3JA 3D82A 1OQ1A 3GALA 4YZ2A 4IV1A 3CZUA 4L2NA 3MV11 3VBHB 1WMDA 1JU4A 4GALA 2RMU2 5IJRA 2W92A 5BNOA 4QX5A 3GNEA 1GQGA 1OLQA 3WNLA 3D5OA 3ZSJA 2XMLA 4B4QA 4CDQA 1L7LA 5FLIA 5FP3A 3DGTA 3SITA 1RHI1 1AJKA 4XDPA 4GH4B 3S0MA 4UI9L 2P3KA 4A7ZA 2D43A 1TQ5A 3H8OA 1JMUB 3H1MA 4LLFA 5A6QA 4EQVA 2YFZA 3O0WA 1I3HA 3VBRB 2VCBA 1XE0A 3G7DA 3MO4A 2J22A 2EVXA 3RJRA 3NAPB 1C3HA 4QPYA 2IWGB 1D4VB 1W6PA 4Y1UA 4HVRA 1OA2A 3ZN6B 1QOSA 2A71A 2ERFA 3O14A 2ZZJA 3ON7A 3WF1A 3KCXA 4NIAA 4EN0A 1DF0A 1D4M3 1HV0A 2VVEA 4PF1A 1RJ7A 5K9YA 3I54A 3A0NA 4LBQB 2WFF2 3WQ1A 4ZZ5A 3W58A 4QDSA 2NN8A 5KXEA 2HYKA 2CAVA 1S1AA 3W9AA 1UW8A 5GZEA 1CPNA 5CADA 5A6YA 3H8UA 5ABJC 1YCIA 5LBBA 3AXDA 4M3CB 4M00A 2HWB1 5T5OA 4YW3A 1IOAA 1V6IA 2WQZC 5FXVA 1U5ZA 1Q5OA 4K40A 1ULPA 2VZPA 1Q3EA 1COV1 2Q1ZB 2C9AA 5FUPA 2QDRA 4XF1A 2Y33A 3KD4A 1UN1A 1W06A 3SCFA 1ND2A 5HBAA 1H1AA 3K51A 5EJZB 2YZ4A 4WM7C 2I2SA 5APAA 2RDQA 4W6WA 2GP3A 2R0HA 3GBWA 3T1LA 1H9WA 2FBEA 3TNQA 3FUOA 4MGKE 2RJ2A 4LE3A 5I0UA 4PIZA 3WDXA 5L9VA 5LY1A 4MGYE 3ZIWA 1K5MA 3CJIC 3ALQA 5AC92 1GANA 3PUAA 4GIQA 1JYIA 3ZXFA 3LPFA 3LZZA 5GLVA 3JBG2 1UZVA 4Y1VA 1ZZ8A 3INAA 3DECA 5JAXA 5JOYA 5A3NA 1JOJA 4AI2A 3BKZA 1N3QA 2DBIA 4F8AA 2FZ1A 2VVDA 2Y64A 1ZBA2 4RS5A 1IKQA 1S0IA 1UY3A 2R072 2RM22 3ILRA 3KCYA 3PVNA 1HQWA 2YMZA 4KU8A 2WZR3 3N9QA 2E6VA 1XU1A 4JDMA 1QXRA 2VBBA 1MEC2 3BTAA 5A7QA 4E8CA 1O4ZA 4ZKTB 4UFJA 3BODA 5DZEA 4C91A 2P6HA 4CU9A 4OHWA 2UWBA 2RR11 3BPSA 3IBMA 4HKOA 4UOJA 5JMCA 3ACIA 1OQDA 2W9XA 1OQEA 2ZTNA 1GV9A 3OEBA 5K8SA 1BZWA 1WCSA 2RS31 3BOPA 1R081 2X29A 3E5UA 4G9SB 4QB6A 1NXD1 1RJ8A 4Y5Z0 3BALA 4WZFA 4UXAA 3S7EA 1LTEA 3ZYPA 5F3IA 1IG3A 1WD4A 3AJZA 4IL7A 4BK5A 4S2HA 4CCKA 2AH2A 4W6YA 2ZGKA 1RUD2 3EBRA 4YGDA 4Q0PA 1DZQA 3HVDA 1PNGA 1SDWA 2PLV2 5FP9A 4ZXEA 1SFPA 1W8OA 1PO23 3E5XA 1OURA 2NMOA 3RMXA 2BPA2 3RI9A 2VW0A 4ISRA 1NA1B 1US3A 3MLJA 2E31A 5T5PA 2HYXA 4XTPA 3T0BA 2YY1A 4P9LA 4Y20B 5FLHA 3ZYGA 4AAPA 4CEWC 3LEMA 5CYYA 3C2UA 1HLCA 2EIEA 2PAMA 1T6BX 4JAAA 2XJSA 4AVSA 1W2OA 1FT9A 1S0GA 2V5YA 2WZPP 5F37A 1XU2A 1LHOA 1UKRA 1MZEA 3EQEA 4DY5A 1ZZ7A 1RMU2 1WGPA 3WP6A 1FPN2 1W03A 2Q5TA 1RUF3 3WEZA 5A3UA 4YGEA 4LTAA 3JUUA 3WUCA 2WT2A 5KXDA 4BXSV 5CG8A 1YQ2A 2GALA 3WP4A 1NT0A 2PAEA 3B69A 1SHWB 4QU1A 4XUPA 4IUGA 4QKDA 5FMBA 1AL23 2AENA 4S2GA 3HQUA 2YC4A 1WLCA 2RG4A 4N53C 1SBEA 3LFMA 2VXJA 1MVQA 4NIDA 3ZXEA 1ULDA 4Q4X3 1V6OA 4MXWA 1AYM1 3CHXA 4DPNA 2UYBA 4XPVA 1ZRRA 1IPKA 1WCKA 1W6QA 4DY3A 2B7YA 2JE8A 3GZTB 1KD7A 3TYJA 3N35A 3J7MA 1VBC2 1H8TC 4L99A 5JPNB 2HH9A 2AEYA 1R093 5F3EA 2WKKA 5A3OA 3VD5A 1RUE1 3I4IA 1V9U3 5CKQA 2B42B 4B1LA 3HN3A 1OMIA 3I2HA 2ORXA 3KT1A 3OPWA 1PVC2 2GP5A 5EYYA 4CCOA 5HCHA 2XL7A 3PUSA 1UQXA 1PZ9A 4NAOA 4QM8A 4KBBA 5G04L 3ZPYA 2AEZA 4XUNA 4ZU7A 2BRTA 2QQKA 2O14A 2WWSA 1ZM1A 3PVBB 3TEWA 3CL1A 1E5RA 2DU1A 1W90A 4FPLA 1QJU1 4HK8A 2WYFA 3N3HA 2XLGA 4EWAA 3CEWA 3UGFA 3ETQA 2IXKA 4XZPA 2QZ3A 2VBDA 3V0BB 1Z78A 2DWRA 4Z2AA 4BCUA 2JICA 1V6JA 2ZHKA 3HT2A 2XBO2 2C9KA 2WO7A 3ZFEC 2CV6A 1C1FA 4AG4A 3J4UH 3WNPA 3CO2A 1W8NA 3ZLIA 2XB6C 4AFDA 3ACFA 2JE9A 2XONA 3VBHA 4EN7B 4DUWA 3KF5A 3WP3A 2BYVE 4BMBA 5J09A 2WNUB 2D6MA 2VUAA 3I3MA 2W94A 1X7NA 2D6NA 2RE9A 4ES8A 5L36A 1E57A 1RITA 3NV3A 4U36A 4PHZA 5ISLA 1DYOA 4XFHA 3ZOIA 1UMHA 1RTVA 3ORJA 1V6KA 3OG2A 1J3PA 4GH4A 4LLOA 2Q8DA 5C6CA 1UZWA 1X8EA 1YEWA 3FUQA 4BU2A 3A7QA 3RI8A 4CUGA 3H3LA 1XNCA 2ZGUA 5BYNA 3KV6A 1SMVA 4E4HA 4Q5OA 1VBA1 1W39A 4WVMB 3ZXAC 4DNYA 3I49A 1H8VA 3NV1A 3VBRA 2W5FA 3LEGA 2VG9A 4RGKA 5TSWA 1EAH3 2JDYA 5FY5A 4FFGA 4GAZA 4YFZA 5J36A 3AZYA 4E2SA 2D5FA 5FJKA 4FAGA 4HVQA 5JZGC 3USSA 5DDJ3 1TME2 3APBA 3NAPA 4WM8C 2DCYA 1IS4A 2VQAA 1LOFC 3OGVA 3WSOA 1YRZA 3GYDA 4FT8A 3ZN6A 2P3JA 5GZGA 4COWA 3QD6A 2XJUA 3CKHA 1Y7BA 4MADA 3ZO0B 5FYUA 5FO9B 3H8XA 3I3QA 4Q0QA 2G9FA 4P02B 3LGRA 2NP0A 3AP9A 3NNJA 2W87A 3QH7A 4GXLA 4LBQA 5GALA 1GLHA 3T2PA 2ZKNA 3KHBA 4KG8A 2K46A 4RL7A 2YUEA 3E6CC 4CRQA 1AJOA 4AGGA 1B35B 3NQHA 3O5SA 3RZZA 3WVJA 2V5DA 4DXTA 1WLWA 1UF2C 1XYOA 3VDDC 1H0BA 1PO12 1NCQA 1W2NA 1OHFA 3ZN5A 4AFAA 4AHZA 4M3CA 4XHXA 3K4AA 3CBNA 3NW4A 5BY5A 4ITCA 2VTXA 2RDNA 4Q1RA 4DIQA 2QQUA 5JXHA 3IB3A 5F3GA 1BK1A 3PLQA 4XQWA 5FZ4A 1QQP1 3GJAA 2DFCA 3K77A 3N9OA 5DUUA 4PIYA 5C8CB 1R1A3 1C8M3 1HB4A 5DUVA 1YQ5A 2Y38A 4KI5M 5LBCA 1UO9A 2B45X 1RXGA 3AVSA 4XBNA 3V65A 4EV0A 3ZIXA 1F5JA 5C9AB 4HL0A 1L3JA 5DMYA 4I0WB 4LKDA 1LHVA 3MICA 2J1AA 2JKXA 3HOBA 1W9TA 5JI7A 4LITA 4BHPA 1BCXA 4AI0A 5KWRA 1CQ9A 1FMD1 2A75A 5ANNA 3KHCA 1HIXA 3WDVA 4J1XA 4MHRA 2K0GA 2BDRA 2VULA 4GA9A 1NKGA 4XBQA 5FZ1A 2FDGA 1XNDA 4LA2A 3B5LB 2VW1A 3KZ4C 5GZCA 5FY7A 3SLIA 3HQRA 4BE3A 4Y1YA 5FPAA 3O12A 4QX3A 2KR2A 1VBB3 1HQNA 3FWEA 4KNCA 3MF9A 3VBUC 4IEWA 1OT5A 1VR3A 4FBFA 5J96B 2VM9A 3J8F3 4YVSB 5IK7A 1BMV2 2ZEYA 4QGLA 2QBXA 5EJ3A 5LA2A 5D8AC 1DGWA 3O1TA 4QHZA 4YVWC 3ZX7A 2OUJA 3KM5A 2CY6A 3JCIA 4OCTA 4ZY9A 1ZBE3 2B46X 2WFF3 4IE4A 5FZKA 3ZXGA 4AI9A 4X8NA 4DEVA 4TTGA 1TE1B 1POV0 1H30A 1OLMA 1UU5A 1A78A 1HRI1 5CFDC 1RB8G 1TEIA 1KS4A 2JDNA 2JWPA 3GBFA 5FCCA 2XUMA 3ZXJA 1LOGA 5EJ1B 1VRH1 5F32A 3U78A 3NSTA 1RHI3 4MZUA 4RHV1 5IUQA 4N9HA 3VKFC 3LEKA 2FDFA 1IS3A 4JGZC 4P00B 4XBLA 5FOBB 4QT6A 5IVVA 3UJQA 1IGOA 2WAAA 4P9IA 1DP0A 4MYEA 2DDUA 1HJGA 5JOZA 2V72A 2P17A 1NA1A 2JDZA 4EJRA 1QMJA 2DURA 1ENSA 1QOOA 1SLBA 2JKBA 2WAOA 3N9NA 5FK7A 4Y20A 3KMHA 3ENRA 2DVDA 2OA2A 3U37A 3UKNA 1O3TA 3U1XA 1JZ6A 3AZVA 5JSPA 3W5MA 1O4TA 4DZGA 5ABJA 4NWWA 1HRV3 2VZRA 4Q4W2 1PGL2 3ABZA 2UURA 4KGGA 2Y60A 5FYSA 4MG2A 5A3MA 1Q8OA 2G9GA 2GNDA 1DYKA 1H2LA 3ES4A 3FLTA 4FPFA 3HBKA 1LU2A 5KHGA 5FZ7A 3WNKA 4FOWA 4NIGA 2VNOA 1VB2A 3HWJA 4GB31 5T5JA 1LENA 2A7AA 3WV6A 1W9SA 4B8EA 3PTYA 4IEQA 5A3WA 5A7PA 1W9WA 4BMEA 2HWB3 3VBOC 5F1RA 2WSUA 4D3WA 2QE3A 2PHLA 4BH9A 4QX1A 1PX4A 4DXRA 3T09A 1HXS2 3POFA 4JVAA 1COV3 1LKNA 3KT4A 1BBT1 4LA3A 1HQLA 4LBMA 3LQCA 2VZSA 5T54A 5I0SA 4PQQA 3POEA 4K8FA 2V73A 1JXNA 2VVFA 3V0AB 5C71A 2WZR2 2XDVA 4HSJA 4NHKA 3WXPA 1ULOA 3VBUB 4Y4YA 2VMIA 4MGIE 2FDJA 1S0EA 3L2YA 4YLZA 1SLAA 1QH6A 2D5HA 4NPLA 2XWBB 5FZCA 1NY71 1NUKA 3ZFFC 1JYCA 1UY2A 1F2NA 4XTMA 2PLV3 5CFCC 4XF9A 1OPOA 2BQPA 1AR61 1H1IA 4KU7A 5E8AA 3FHIB 4MGSA 3WZ1A 4E4SA 2BWAA 1NE4A 1WCQA 3C3VA 1I9RA 4FO9A 3BUCA 3OBRA 1XNKA 5DXDA 2BNOA 5E88A 4XFCA 3ST7A 5FY9A 3V0BA 4MGQA 3UNPA 4DRRA 5F3CA 1J1LA 2ZMLA 3ITQA 3RYRA 5CFDB 1VLNA 2VD7A 4A4AA 4XZUG 3B93A 4LO7A 3VHNA 4YZ4A 5FYZA 3NO8A 5LK5A 2F4LA 4AGVA 1QDOA 3POYA 2VMDA 3TNPB 1PO22 4HBNA 3KSCA 4K9SA 2RR13 2B39A 2NYYA 1J59A 3OGSA 1AYN1 4ORFA 2WNUA 2KM2A 5L7OC 3VHPA 3ZR6A 5K7PA 2RVAA 1VBE1 1OOPC 4QM9A 4CEWA 5DUXA 1JOPA 4XFFA 1O5LA 3D0JA 5FYCA 3NKTA 4X6QB 4Q0UA 1K5MB 4CE8A 2J1SA 4IV3C 3KQRA 2CYFA 5GZFA 4CVUA 1GQHA 2MEV1 1RUF2 3B94A 1JZ7A 2ZHLA 1ZA7A 5HCAA 1TMF1 3K75B 4C90A 1N1YA 4RN5A 1D0HA 1UOFA 2YBSA 1RUJ2 4QQOA 5C4WC 1YC61 1AL22 3HN1A 1Q56A 2VOKA 3E6DA 1O3RA 1REFA 2HWD1 5H9QA 2DTWA 1GMMA 1RUG1 1OLRA 4IEPA 3RS6A 4LOSA 1AR82 4YG0A 4YSFA 2A6ZA 2WINB 2PTMA 2NQYA 2QDNA 5DUWA 4P5YA 3HT1A 2Q1MA 3PL0A 1DHKB 2VOWA 2C4XA 3IIAA 3CNAA 5F5AA 3ZSMA 5JMOA 2ADDA 3VD9A 3GZAA 1R092 1B35A 1UYZA 3B7MA 5D2AA 4AEJA 4JTNA 3AZWA 4URTA 4COZA 4XAEA 4ZU4A 3F95A 5F39A 1H6YA 2W1QA 3R4UA 3NMBA 3AP4A 1RC6A 2ZGQA 5FXXA 3WX5A 4A7YA 1VB4A 4A44A 2SBAA 3ZN4A 1POV1 4YW6A 4HKLA 2W0XA 1AYM3 1JU3A 2JDAA 5C8CA 2I45A 1XE8A 4HPKB 5LA9A 5CFCB 2C6SA 1G9FA 2BERA 2WL1A 5IWFA 3RVHA 5C9AA 2VZQA 2W46A 2DU0A 2ZGOA 4GQ7A 3AKQA 4P9WA 3RG0A 4AHYA 2ZKLA 1KDKA 3K2OA 1OH4A 1HN0A 1RUE3 2LS6A 3H1YA 4Q0SA 1VAKA 1FV2A 2HWF2 2JD4A 3USUA 2G1MA 2YB7A 2L9LA 3OGGA 4MH0E 2XH6A 3FE5A 3BVCA 4KGQA 4NUBA 5FJHA 2OPWA 3BU7A 2JG8C 1A8DA 4HETA 1MS9A 1XYNA 3CU7A 4P9YA 1OFNA 1NZIA 4GKYA 1YXWA 3ZFGB 2WQ8A 1JZ3A 2OX0A 4XIKA 1VALA 3GZEA 2RDSA 4W50A 3LA7A 2HWC1 3ZDSA 1AX0A 5L7OB 2ZHMA 2FDKA 4LKEA 4XEZA 3DN7A 5A3TA 3THCA 4QPIC 4KH9A 4YVSA 3RDIA 4E2GA 3HAGA 3VD4A 3VBFB 5J48A 5C5TA 5LCWL 1W3VA 5FPLA 1G6NA 2XL9A 5LATA 1ZX5A 2E63A 4D8MA 4MVTA 4MGZE 1S55A 2OUHA 3NV4A 2BVVA 5F5QA 1RGSA 5AFEA 1W6OB 2D6OX 3IWZA 1EAH2 3ACLA 1J1TA 4AEDC 5EFUA 3ES1A 4Q8KA 2HKXA 2BGPA 2J1RA 2ZOEB 3FFQA 4QPWA 5DDJ2 1YFYA 4JRAA 1JZ8A 3U4XA 2XXZA 1LCLA 5C4WB 5DAXA 1GZ9A 2YROA 2ZJCA 3N36A 1PO13 3LD8A 1LOFA 1PIV1 5JVVA 3AKPA 3VBSB 1CJPA 1E5IA 1F8VA 1N47A 4Y33A 2LTNA 3IKWA 2W68A 3LF7A 4RR3B 1OFSA 2YPDA 4CYDA 4FOVA 4PQ9A 3ZKYA 3GHNA 1IS6A 4TSVA 1VBA3 1UIKA 3AL6A 3IDBB 4S2FA 3SQOA 3S57A 2A6XA 3H3ZA 1QU0A 1G8WA 1H1MA 2ZGSA 2ZABA 3DPRC 5IK8A 2HWE1 1AX2A 2P6CA 3MW2A 3MIHA 2QKDA 2RMU1 4P9XA 5FO7B 3CJXA 5BNPC 4OZOA 1OKOA 2BNMA 4I30A 5FAXA 1AR71 2OS2A 4Q0VA 3ZSLA 2R16A 1UWWA 5LRSA 5KXCA 2VQTA 3KS7A 5KHHA 3KLSA 5B2GB 5C3QA 4OQ8A 1O91A 4LXLA 1XC6A 4NE9A 4QKBA 4COVA 1A34A 4HKWA 1R1A2 1C8M2 1SFYA 4OFGA 4R8HA 3VGIA 3AM2A 3ZYBA 2ATFA 3SHRA 4H3WA 3MYXA 4PLOA 1DBNA 2JIJA 2VQUA 3JB8A 4NRMA 4QHBA 1YQ6A 4GJYA 5JLVA 4ATFA 3THPA 2RS13 2XKOA 2YYOA 4XQ4A 4ES9A 3JD71 2K9ZA 3N7JA 4LO5B 3T2OA 4V2WA 3MLLA 4B4PA 2Y0IA 4OHVA 4ZONA 5FZ9A 4AE2A 4Z92B 3AFGA 2IVJA 3PU8A 1WKYA 1JHNA 1W99A 1N1SA 3R4DB 3E5QA 1QQP3 4AFBA 4BM8A 2A6VA 1QJY1 1CD3G 4QWNA 1GICA 1UY0A 1CZSA 2RHPA 4XXPA 5LK7B 1OI6A 1QEXA 1VBB2 3V0AA 2NZ9A 1JBCA 2FCUA 1Q8QA 4H2AA 4QPGB 4QD2A 3VBUA 3AP6A 3J8F2 3QCWA 3MPPG 1GKBA 1WMXA 3QACA 1FMD3 1N1VA 4QPIB 4CA9A 4XW3A 5GKAC 4BLJA 1S2KA 1LOCA 1VMJA 2ZACA 5FZLA 3POJA 5GJ6A 2DUOA 1UKGA 1YLLA 4FPGA 3WQBA 2R30A 4YW2A 1ZBE2 5FP8A 3WG1A 3I97A 1SLTA 4I3GA 4OMDA 4Q29A 1CZTA 2C5DA 3VDBA 1VIWB 3P5BA 1OA3A 2WLPA 2WO1A 4A42A 4OULA 3GXUA 1KFXL 4NAMA 1NCQB 5CFDA 4GMP1 1YYNA 3VHOA 4EE2A 4Z8BA 4LHNA 4CUBA 4Q4W3 1RHI2 2V4VA 3AMNA 4AEKA 3Q8EA 1GP4A 2OXBA 1BHGA 1FYUA 1YQ8A 3LIGA 1SLLA 1ULGA 2XOMA 2IFWA 2Q8OA 1HB1A 4X6RB 1QJX1 2ZAHA 2VNGA 5A3PA 3KVBA 2JEMA 2P3YA 3OPZA 2IXIA 5F9TA 2FQPA 2VZVA 1AL0G 2H0BA 2RM21 4JKMA 4E9KA 3RRDA 1HRI3 1FAYA 3FHQA 4HZFA 4I09A 5K4LA 1GZCA 4HN1A 3SXWA 1HRV2 1PK6C 1JYVA 5DAVA 3MIFA 5FFOC 2FMDA 4AFCA 2D3PA 1VRH3 2VTXJ 2W52A 1CN1A 2R061 4RHV3 4Q26A 4XF3A 5JOXA 4MUVA 4XILA 3ZR5A 1HXS3 3CQOA 3IAQA 2XJQA 3NNFA 4Y1XA 5C8WA 1JYNA 4DRVA 5J98B 2ET1A 1W8ZA 1WA4A 2VXRA 2XQXA 4YW5A 2Q8EA 3VV1A 5JSOA 1O3SA 1K5JA 4LO6B 4CP2A 4DEQA 4RD7A 1RVF1 4B3NA 1BKZA 3C8XA 5FREA 5ACA1 1KJLA 3WW4A 1NQJA 2IC1A 4D6QA 4HONA 2WDBA 2R32A 3LSEA 1V6LA 3GZUC 4ARYA 1MQTC 1ZRCA 2HWB2 2I74A 2PHTA 4XJUA 2ZS6B 1H4GA 1GP6A 1VBD1 4MOAA 5SV5A 3PUIA 3MIGA 4M0NA 3FC0A 3OCPA 1COV2 3D8CA 4CTEA 2OKXA 3FHAA 5FV3A 4YM0A 5A80A 2R041 5IATA 2VTFA 3OY8B 2WNVC 3OGRA 2QCSB 1MZFA 3LFIA 1U12A 4I0BA 4JGYC 1GBGA 1GOHA 2GAUA 1JUIA 5F5CA 3ZM8A 4AI8A 2ENRA 5AVPA 4FCAA 4GB33 2HBUA 2W1UA 3ECQA 1VPHA 4H14A 2RDRA 4HK9A 5DG2A 3SCGA 3I7DA 4LK6A 3EYPA 1ASJ1 2ZAAA 5FPXA 4Y1ZA 5JXGA 2P4EA 3ZFFA 1EV11 5FZMA 5C3RA 4QX2A 1FPN1 2GMEA 1DCSA 2E33A 2ZEZA 4HPKA 4D0QA 2WWJA 5CFCA 2VE1A 1ODMA 2BWCA 3ZXLA 4X8PA 4QB2A 3T1MA 1BBT3 1A8MA 1QH7A 1IPSA 1LGNA 1XQNA 3CF6E 3L2HA 1BVVA 2XKPA 4LNVA 4XACA 5EP9A 4D6SA 1CIYA 2GC0A 2BGCA 3FLPA 3NNLA 2Q8CA 2JG9C 3U07A 2CU5A 3BPZA 4CCJA 4CUCA 3TEYA 4PBOA 3DF0A 4QX0A 4QKFA 4CEYC 2XVLA 3GF6A 4XOGA 1PM4A 5ABJB 4HN0A 1DQ6A 4CDXC 2MPFA 2EXKA 5FXWA 1G7YA 2PHWA 5GLUA 2JX9A 1Y9GA 3EMRA 4R4ZA 2VCCA 4BQ4A 3MUZ1 1GQPA 1WW6A 1I6XA 3WF3A 3PMEA 1WW4A 1JS9A 2RR12 5GM0A 3ZFGA 1LHNA 1YHFA 1AR63 4IESA 5T55A 2G4IA 1RUJ3 4MHUA 2RS32 3HIFA 3M2MA 3ZKUA 3PMSA 5CA6A 4QHOA 4N9IA 5L7OA 4WM7B 4AR2A 2PFWA 2X5IC 2PHRA 2ZMNA 3P1IA 3GHMA 4ONUA 4BISA 4JZRA 5CB7A 4WVWA 3UGHA 3VBFA 4Q27A 1H6XA 1F35A 3I2JA 4AVBA 2ZGTA 2EAAA 3PNAA 5IVYA 1ONAA 1ZYBA 4EWEA 1PK6B 1G9BA 3BGAA 1AR83 4UFLA 3CJIB 1BLZA 1UYYA 2X53S 5FTTC 3SH4A 5JCTA 2WYSA 3IZOA 2MNGA 3KV5A 1ZZCA 2CHHA 1A3KA 2OZJA 4AGRA 5K0UC 3BIEA 1C28A 1W6OA 1ZZ9A 2ZX4A 4BYYA 5JPMB 2WNEA 2XGXA 4OUMA 4WBBA 4XQDA 3T4HB 5C70A 4XHBA 1W8WA 4ZHNA 4P9JA 4CDWC 5LY2A 2F17A 1AYN3 2ILMA 2WN2A 1S2EA 3ZXKA 5C4WA 1G86A 1VBE3 1LJ7A 1PNFA 2VO5A 3VBSA 3WF4A 3NNGA 5LB6A 4OQ9A 2VPVA 1QGLA 4V2VA 1MQTB 3BB6A 4RR3A 1GP5A 4XABA 5C3PA 5G05L 3B9IA 4QX7A 4AQ2A 2D93A 1JH5A 2QQMA 2ZPXA 4PCRA 5EZWA 5DQ0A 2UWAA 1RUC1 1F9KA 3U11A 5IYYA 3JQWA 1TMF3 3VDCA 2VZ1A 5I0TA 3O1MA 3W59A 2XJVA 3U4SA 1X33A 3WW3A 4YFWA 5FUIA 5A33B 5CKMA 1XRUA 1W2AX 2HWF3 3AFKA 3GBGA 1CIWA 4YW1A 2IXLA 2HWD3 4YPJA 1C4RA 1AYM2 1I5ZA 1DLCA 1DFQA 3AVRA 2HJIA 2BUKA 4TN7A 3ASIA 4XE9A 2YXSA 4K1YA 2VMGA 5DAWA 5GZDA 5FRAA 5LRRA 1RUE2 4XJ8A 1TME1 2B8MA 4CEWB 1CX1A 4BOWA 4Y3OA 2JB8A 1AR91 3AYEA 4CEYB 4L9BA 1REDA 3WDYA 2UY8A 3RSJA 3AKSA 4R52A 1POV3 3PDQA 5LEKA 3ZVXA 1SPPB 3WNNA 1HJFA 1HX6A 2ETEA 1SCSA 1WBLA 2GZWA 4FP3A 3BTXA 3ETPA 4E2QA 4V1PA 1MZ5A 4CP0A 3PU3A 2ZGNA 4L92A 1QJU2 2DVBA 1V6MA 4IEXA 4K8RB 2FD8A 1N1TA 2FHRA 2YU1A 2WT1A 4JRLA 4D69A 4QPGA 2O0OA 5C5UA 2J1TA 1CAUB 4QPIA 1IKPA 3BIWE 1GFF2 2JJ6A 4N53B 1EUUA 3OBTA 4AXOA 2TBVA 4YW7A 1BYHA 3ZMOA 3MIBA 1JYWA 1GOFA 1Y3TA 2AACA 4AK3A 4A45A 2E26A 3N9LA 3TRSB 1XBFA 1ULFA 4JCKA 4LIVA 1LU1A 3WLUA 5GLZA 1SACA 4LOTA 1H8TB 1V6NA 5T5LA 4C0BA 2EALA 2Y6FA 4UYBA 3VZNA 3CLPA 1OC1A 1RUH1 4IGPA 3B9CA 3OGJA 4XJ9A 2O1QA 3P3NA 4URAA 5FPUA 3HNYM 3TN91 1YIFA 4AI3A 2DVAA 2ZX3A 1VBA2 1IZ3A 4KG0A 3L9JT 4YZ5A 3SMHA 4O65A 3AJYA 1QJEA 4LHSA 5IVJA 5FQ0B 1WW7A 4Q4Y1 2TUNA 1HDKA 4SLIA 1FNZA 4XUTA 1C57A 2ZX1A 2AZ5A 4J6GA 2VUCA 2GN3A 3USUB 1PIV3 1MS1A 2EF6A 1PGSA 4IEUA 4LORA 1C5IA 1DQ5A 3WDUA 3ZFEB 3LOIA 3M3OA 4FPCA 3PIJA 2P34A 2PQSA 4QXBA 2FZ2A 1ZZBA 3SEEA 1FX5A 1LEDA 2Q0AA 3ZSEA 4AHXA 5KR7A 3T4VA 4ASLA 2V09A 2Z69A 1HN1A 4NRQA 4BPZA 1J58A 5KC5A 2WS93 2HWE3 1VMFA 4UWDA 5BNOC 5LA1A 2PHXA 1UOGA 2RS12 4IDZA 4LUMA 3WW1A 1Y43B 4WV8A 2ET7A 3JB4C 1MS5A 3NL1A 1MZ6A 5C3OA 1AR73 4QU2A 2A70A 2C24A 2XJTA 4OZXA 4BLIA 1UYXA 1D4M1 1UMIA 1UL9A 2C1FA 2WNOA 1NLSA 3HBZA 1QQP2 4LIUA 1Y4WA 5GLWA 5I0DA 4OI0A 2D44A 3OY8A 5F5IA 5LASA 4AVTA 2G9ZA 3I2IA 1AHSA 1R1ZA 1YFWA 3DEMA 5FZDA 1JTZX 4XFAA 1WCUA 4LEJA 2W2IA 1OVSA 4M4RA 5KHJA 1LEMA 2K2SA 4UAPA 1TZOA 1W9FA 5JZGB 1G9AA 4WM8B 2O8OA 2WWUA 3P3PA 3JD73 2WLQA 2IVIB 1FMD2 4L8QA 4OUSA 4NPMA 4P5HA 4TXWA 4IEZA 1W2UA 3VN4A 1PX3A 5EHDA 1IHMA 5JR7B 2FCTA 4IETA 5EV7A 2HEVF 5FYVA 1QDCA 2IZWA 4QDQA 2OQ6A 2WO2A 4LBOA 4NJ4A 2QFEA 1QJY3 2AUYA 2VNVA 3WNOA 3BTZA 4AQSA 5CG9A 4FQ4A 3FL7A 1ZRIA 1RINA 4UW6A 4QDRA 1V00A 3H3UA 5E1RA 1GZTA 2X05A 4W8JA 3VDDB 1LGCA 5DAPA 1AZDA 1LHUA 5LW9A 5FMOL 3FMGA 2QVSB 1YO8A 2D6LX 1DYPA 4O61A 1W6MB 4NOTA 4OHXA 5LWBA 3VKNA 3OOXA 3ROUA 3KWVA 3WHUA 4AF9A 3IDCB 3S6PA 4YG6A 4JKKA 2CWSA 3OD0A 3O1PA 1XYPA 4WM7A 3VZKA 1NAEA 1ZRFA 3C7FA 2UWCA 1HRI2 2W1WA 1P8JA 3C7OA 4LULA 1CZVA 3AMMA 3RZLA 3I2KA 2B5HA 4PDWC 1PK6A 4AVVA 5F7UA 1SDDB 1VRH2 1LRHA 1OD5A 3CJIA 4RHV2 1SLIA 4E8DA 4CP9B 3WQ7A 4HOOA 1H2MA 1UAIA 2ES3A 3MBWA 1QNYA 4FTEA 2XVKA 4MX3A 3KV4A 2OPKA 4KWKA 4Y24A 1QJX3 5CNAA 4CPBD 3I3DA 1AXZA 2HEYF 4Y4RA 1EUTA 2CL2A 2R0FA 3TOJA 1CJDA 3LDBA 2E7AA 4UW3A 3VHRA 4BIOA 5I91A 1MQTA 4WVZA 1PVXA 4K3UA 4M4PA 1SCRA 1U5IA 1RYYA 1UYPA 2R063 5LBFA 1X50A 5FKCA 5D8AB 3VZJA 4DXSA 4YVWB 1YQCA 5FZOB 1ENRA 1GWLA 2WT0A 4FPOB 4RFRB 3O1UA 4FI9A 3M1HA 2A73B 1W28A 1QNWA 1NLQA 2WFPA 3N7LA 3LKJA 1SQ4A 5FLJA 1NQDA 5B4XA 3W21A 3FZ3A 5A33A 5ACA3 3BI3A 4GB32 1H9PA 1LHWA 3AL5A 4FFFA 5DN2A 4L97A 5ERLA 3GDBA 1MS8A 3H42B 4A2UA 2XG3A 4ARXA 5A1FA 1MACA 4M3CF 4I0AA 1NG0A 4S2DA 1YUDA 2DYCA 2HBTA 1A6CA 1UZYA 1VBD3 4RYDA 5FP4A 2D7FA 3M7AA 1S0DA 3H0OA 4JGZB 4ZS3A 3J7HA 4YGBA 4E4DX 3UGGA 2R043 1BBT2 1X8MA 2BW8A 3K3NA 3KF3A 4YWAA 2RS33 4IE0A 5FZEA 1R083 3NKGA 4XF4A 4NIHA 3OBAA 2AREA 1ZNPA 5A7WB 4Q4V1 2ZXQA 3RMYA 3UESA 4BQWA 3U75A 2I07B 2ZGMA 5F6LB 4CEYA 3EO6A 4AEMA 2WR9A 3MIDA 5DZGA 5LBEA 4P9GA 5M0TA 3UL2A 4Q4X1 1ASJ3 1NY72 2QQIA 1SPPA 2WA3A 3MI8A 3ZYHA 4BA6A 1W6NB 4AQTA 5T3NA 1JN2P 1EV13 4LBLA 1QXPA 4MSVA 4XC9A 1AR62 4QXHA 1PM7A 5D1IA 1S0JA 4W6XA 4DXZA 1C8NA 5JUVA 4JKLA 5CISA 3MZHA 2BTVC 3K4ZA 1V9U1 2GN7A 4YRDA 5A6XA 4LPLA 3IDEA 2KA3A 4P08A 4ZZ8A 3BYWA 2RS51 2BBVA 1CAUA 1CONA 4Y22B 4BQ5A 1UY4A 4N53A 4PI2A 2QQVA 3EXUA 1KS5A 4NPRA 4PDWB 2ARCA 3VBOB 1BEV1 4PLMA 4BQXA 2YBKA 4LBKA 2A3YA 2E7TA 4GMP0 3ELNA 4QGMA 1Z0HA 2JB4A 2PN5A 3LPGA 4MLOA 1Z7S1 2A6YA 2AYHA 1AYN2 4D94A 1H8TA 1LOAA 3H9AA 4CDWA 3B3QE 2DCTA 4R9AA 4RA0A 1SBDA 3SH5A 3UT0A 2ZMKA 5T52A 1VBE2 4DOUA 5FMDA 3MPBA 2R1BA 3AMPA 4AHWA 3A22A 3U14A 1J3RA 2H0VA 5IFTA 1LECA 2OZ6A 2EA7A 1WWYA 4FP2A 1K45A 2WBKA 4LKSA 3ZYRA 5FZ0A 3VKLA 1W8UA 1ODNA 2VOVA 3R05A 1M06G 3ZFFB 5I8TA 1GWKA 4BIFA 1TMF2 5FKBA 5T50A 3ZDVA 2PXJA 3BTYA 4LMFA 4F7ZA 5FQ0A 1RUI1 1XPWA 3VD3A 5BUVA 5FMCA 1PGW1 2WO3A 4KBZA 2CGOA 3OYWB 1QIQA 3J26N 4GWIA 2H6CA 5FZBA 2HWD2 2BV4A 3LDKA 4XIOA 5FYBA 1RUG2 2VQ0A 3WG2A 2BOIA 2BU9A 2E7QA 3ZFEA 2IXJA 4LBJA 2LALA 3B01A 4A41A 3LOBA 4B7KA 2YV8A 2ZZQA 3UKVA 5CEHA 4PT6A 2WZ8A 5JSRA 3K4DA 3AKTA 4TLGA 3RWNA 4COUA 1RUC3 2GDFA 3BCWA 2ZX0A 3VBHC 1FATA 1OXCA 3HNBM 3AK0A 2VCMA 5IAVA 4EYUA 2ARBA 1Q8VA 2GSYA 1QJU3 2A3WA 3PIGA 3DUIA 2BFUS 2D3SA 3EB7A 4INDA 4QQPA 4K6BA 3SKVA 3AKRA 1OOPB 3SCHA 4BJ0A 3LCPA 3I8TA 3ILNA 4HANA 4R9CA 1C5HA 4GH4C 3LWCA 2ZEXA 4HMZA 1FOD1 5E89A 1YJLA 4JC1A 4IV3B 3MW4A 4RGGA 4YZ1A 1DLLA 4GULA 2P2KA 4XFGA 2GMMA 2YHJA 3VBRC 1JYTA 4B29A 5FWJA 1US2A 1XE7A 4RSUA 3PUHA 2EIBA 5C3SA 2FDIA 2EIDA 3NAPC 4HG6B 5JZGA 2JDMA 5DG1A 4WM8A 2QTWB 3C7HA 3ZYJB 1EY2A 2WSVA 5BV6A 1ULCA 1V0AA 4PBPA 4CCLA 1AR93 3LA2A 5BNNC 1GNYA 5F2WA 5CIRA 2DVFA 3DXUA 2JECA 4ZS2A 1EPZA 2R1DA 5FZ3A 1WA6X 3AC0A 5FUNA 2VBPA 3UKTA 1HKDA 2AGSA 3VDDA 4EN9B 1ZA4A 1DGLA 1W04A 4A3ZA 1X9PA 4UFKA 1KJRA 3D4KA 1QJFA 2VAUA 3T0DA 4GZ9A 4XCAA 1ND3C 1W6MA 1JOBA 2BFUL 1YNAA 4Z82A 4UF0B 5KHIA 3DCQA 2PMWB 1O5UA 4LUKA 2EXIA 2Q30A 4Y5TA 3OSDA 5DABA 1VE0A 4E4ZA 4OHYA 5EPAA 2VJXA 4NO4A 4XVHA 4TLFA 1NX9A 1AF9A 1JZ2A 1NCRC 4UBHA 1UMZA 1PIV2 5FZGA 1RUH3 3AXEA 3JZVA 3H1WA 3IDAA 5FZAA 1IPJA 1X9TA 1DQ4A 1O3QA 5L73A 2WQ4A 1QKQA 1W2TA 3TN93 2JG8B 1NZCA 2Y0OA 3VL8A 3VD7A 3IPVB 4CP9A 3MDPA 1WLDA 5IT6A 1ZBE1 2QQNA 2WFF1 3POSA 4FTBA 2E51A 1OD3A 5BPXA 1LULA 2WS92 2HWE2 5LA0A 1UU6A 1J84A 4JDNA 4Q4Y3 4YG3A 1CESA 2X8KA 3K48A 4ZU5A 4IGOA 1BQPA 3VZMA 3HPNA 3MIEA 4FPJA 4JQTA 4XURA 3SISA 4BQ1A 3U0ZA 1AR72 3DXTA 1KGYA 5FYTA 3ZMNA 2WIIB 4JQRA 5JOWA 1OUSA 3PTRB 4JV4A 3B00A 5CVRA 5D8AA 3LB9A 3RZGA 3WCSA 4YVWA 3RZJA 5FYHA 4Q1PA 5FZOA 5FOJB 5C33A 1EP0A 3J7LA 3A23A 1UNBA 2NMNA 3O7OA 3PHMA 4AEDB 3KVAA 1LNSA 2FCVA 3I3BA 4CU7A 1E5HA 1RIRA 4J1WA 5HCFA 5IK4A 2ZBJA 3MEPA 4FPHA 5FZ8A 4XFIA 1IQAA 1SZBA 3JD72 3ACHA 2Y6GA 2D98A 3THDA 5IK5A 1HRV1 3QLQA 2WZEA 4YM1A 1ZZ6A 2YBPA 3H7JA 2QQOA 3KGLA 4ATEA 5AC91 2DTYA 3IM0A 5BNNB 2IFRA 2JDHA 5FYIA 1LGBA 4JGZA 2GH2A 3JBG1 2VMFA 2VNRA 1XB9A 1Y9QA 5A70A 2EIGA 5J3UA 5KBFA 1K42A 2W47A 1QJY2 2XVGA 3MUY1 3NV2A 1NA1C 1UCXA 1NYWA 3AYDA 4CP1A 2AR6A 3MHZA 1D2SA 1S4CA 3DPRB 1ZBA1 2ZEWA 3FLRA 4RFT0 5A7WA 4CUAA 2R071 2BBAA 3DYOA 5FY8A 5A7OA 4HSLA 4A6OA 3VDAA 3DV8A 4G4FA 5BNPB 2FDHA 1MEC1 3A4UA 3KQ4B 4GKXA 4IEYA 4C0HA 4Z1VA 3O1RA 4CSWA 1ZRDA 4H7MA 3V64A 1W6NA 1F4HA 3D3AA 1ND3B 1O4YA 3E1F1 4LO4B 2VZOA 4XDQA 4D7TA 5C7GA 2YFUA 2B4KA 4COYA 4NHYA 4DB5A 1RL3A 4LHKA 4QGNA 3LA3A 3WOGA 2OW4A 4KQ7A 4DS0A 5FR3A 1UX7A 2P3IA 2YC0A 1LOBA 4PJYA 1IG0A 4Y22A 2BP6A 3RJ2X 1NCRB 4CU6A 4XJAA 4N43C 2DUQA 2YU2A 3Q9OA 3Q8FA 3SC7X 3P6BA 4PDWA 1RUD1 4MXVA 5ANQA 3H7YA 2F4PA 1PZ7A 3VBOA 1DDLA 2VZUA 3WHTA 3RZHA 4A3XA 1AX1A 4DUXA 4I2OA 2PLV1 3OUJA 1F15A 5FPZA 3F2ZA 1YIPA 1H2KA 2VECA 1GUIA 4C8DA 4IXLA 4GWMA 1JW6A 1QJX2 3VL9A 4DUVA 2A5ZA 1DGWX 4J25A 4M3CE 4PF5A 4CU8A 1EPWA 2E9QA 3PURA 4BXFA 1YFXA 2Y8KA 4BWOA 4GWNA 4UFIA 1UX6A 2PQQA 3AZXA 3S5QA 3S5AA 2DUPA 4XFBA 1UOBA 3N9PA 4W65A 2QZ2A 3OTFA 4NHXA 2PELA 3FN9A 4M0HA 1XSQA 4QXCA 1KQRA 3C7EA 3QBQA 2R062 2C0ZA 1Q8SA 1RMU1 3TAYA 1FV3A 1WBFA 1OPMA 3Q8AA 4JHTA 1O6UA 2Q1FA 3TEZA 2Y34A 4UBGA 3J9SA 2A1XA 4QB1A 2W3JA 2ZGLA 1RVF2 4KWJA 5L9BA 2GC2A 5ACA2 5BXXA 3OYWA 4NHMA 2DF7A 4AAXA 1QOTA 5E6HA 5FZ6A 3R6SA 3JQXA 4AL9A 5H9SA 1D0GA 1VBD2 4L0PA 1D2QA 1UPSA 4N7IA 1CGPA 4RQPC 1ENQA 3HD8B 3SNMA 1WW5A 5FBJA 4OMCA 2R042 1YI9A 1J83A 4CCCA 3R0RA 4N7UA 5I0RA 1W9YA 5AFBA 1QY4A 1VBC1 2WNUC 4I01A 4A7KA 1R082 4XMAA 5FP7A 2J42A 5HV4A 4QQ2A 1GZWB 4YYOA 3CMGA 1CR7A 1JHJA 1OOPA 2PYTA 1KFUL 3CDZB 4GD4A 4OI2A 1PVC1 2YPJA 4NR1A 5FIXA 3QOPA 4UW4A 1ASJ2 3LE0A 4SBVA 2ORZA 4IV3A 3OBZA
chains in the Genus database with same CATH topology
4N90A 4XXAA 3FBMA 3V56A 1EV12 4EN6B 5KC6A 2TNFA 3VLBB 1ENXA 3IMNA 5CBLA 4U2AA 2PHUA 5A32B 4Q4V3 4D7SA 1Q43A 3KB5A 1XNBA 4OHZA 2A3XA 2XBO1 4N43B 1LODA 3ATGA 4YM3A 4P14A 3U10A 3VZLA 1AXYA 3N4MA 4H7LA 5I93A 1LR5A 2MEV3 4Y26A 2DVGA 4HFSA 1AVBA 1B35C 2WNVB 4Q8LA 2GU9A 3MFCA 4JGYB 2RS53 4TYSA 1RUG3 4AQ6A 1SLCA 2XJPA 5C8CC 1BEV3 2ZGPA 3AYAA 2PHFA 1PHMA 1UD1A 1CAVB 5C9AC 1AXKA 4BZ4A 1Z7S3 2NPIA 3N7MA 5F6KA 2NM1A 2CAUA 1PMIA 2QNKA 1WUVA 2JG9B 3POWA 3FX3A 3D6EA 3R4SA 2DFBA 4O9EA 5FO8B 2CGNA 2EXJA 2JG8A 4CDXB 4ZXKA 3IPVA 3AMHA 4RQPB 1RUC2 1LB2A 1T6GC 3MF6A 2CWMA 2BVBA 1SEFA 4NN0A 1F5FA 3WCRA 2ZCWA 1RUI3 4UW5A 1BVP1 1PO11 2X5IB 1H2NA 4YVSC 4HVOA 3VKMA 1CAXB 1YWKA 4FTSA 3NJZA 5HI0A 5H9PA 1YI7A 3WP5A 4K1ZA 2NLRA 3KGZA 3M3IA 5H9RA 5K0UB 4K20A 1NLRA 1S0BA 4AEDA 2HEWF 1GNZA 4CDUC 1ZREA 4CDWB 5KXBA 2HWC3 3MFAA 4LE4A 2SLIA 3KCCA 4IERA 1LOEA 3I59B 4LO8A 1AR92 2D6KA 2QUOA 3M70A 3RNSA 1OSGA 3S7IA 5BNNA 5DZFA 4IEOA 1S2BA 1FOD3 2D40A 2VGDA 2ZGRA 2CNAA 2N7GA 4YGCA 2UYAA 1WD3A 3DPRA 4YZ3A 3WUDA 3WNXA 2RS11 4IEVA 5BNPA 4FPKA 4AFMA 2CTVA 4MV2A 2RJKA 1BMV1 5BNQA 3E97A 2Z2SB 3TWIA 2VH9A 4EWDA 2DCZA 1CPMA 3ME2A 4FSJA 1ND3A 1DQ0A 1XXNA 4WZCA 1Q8PA 2UU8A 3M8LA 4IV1C 5FMOS 3OF1A 4XYXA 3ILFA 1BJQA 3MLKA 4AVCA 4YM2A 1NXMA 4FPEA 2RMU3 4FPYA 2GH8A 4CDQC 1NCRA 1G9CA 1RUH2 4FOQA 1C1LA 3TN92 3IT8A 4QMAA 2KXLA 2LM3A 2XLFA 5EYXA 2GNTA 1F31A 1NOVA 5AVAA 3FFZA 1MS3A 1CAWB 3O0VA 4FOYA 4Q4Y2 1UU4A 4FXKB 1U5YA 4DFSA 5CAZA 2EAKA 2GC1A 1DZRA 1CX4A 1EYBA 2XLAA 4Q4W1 1B09A 3ZSKA 4XJZA 1PGL1 5KHKA 2OYZA 4QQLA 2VUJA 1URXA 3UV9A 4XJWA 1DGRA 2DCKA 3HR9A 3RYKA 1TNRA 1FXZA 1DZTA 2W39A 3WDTA 1S0CA 4CDUB 1WMEA 3KT7A 2Z79A 1MS4A 2PAKA 4Z2WA 3H50A 3WG3A 1D4M2 4DMIA 2VY0A 1HXS1 4LBQD 1SFNA 2O8QA 2Q4SA 4LBNA 2YDEA 4OLLA 1ALYA 5HXVA 1ND2C 1VAVA 2VW2A 5EWSA 2W08A 1GZWA 1KITA 4B7EA 3WD5A 1RUNA 4WVVA 3RPQA 1KDMA 2VOXA 2WZR1 2D97A 3MW3A 4GMP3 4NHLA 5I8SA 3PVOA 1K5MC 3WT3A 2VMHA 3EHKA 1W0OA 2RJLA 5AC93 4AYUA 2QQPA 2OIIA 1H4HA 3AMQA 4R9DA 3OJBA 1QHDA 3JBG3 5JIAA 1DU3D 4DINB 5CU1A 4KWLA 4IV1B 4I3PA 4ISQA 2DV9A 2GMPA 4RS5C 3M3CA 3ZYIB 4XMIA 3B02A 5A32A 3DKWA 1ZBA3 4E27A 2Z42A 5BNOB 2R073 2RM23 3AZZA 2Z5WA 4JDOA 5HCBA 4CDQB 4Z07A 4N43A 1MEC3 1U5XA 1X36A 1MR5A 4K7JA 2GC3A 1HV1A 4R4XA 2E53A 1PO21 4YNIA 4LR4A 2GNMA 4OI4A 1CVNA 4TWTA 2WNVA 1DIWA 4JGYA 3HQXA 4XF0A 1RVF3 2Y26A 3RYPA 1W6PB 4AVAA 1UIJA 1DGRN 1RUD3 2A6WA 1JUHA 3N7KA 3WDWA 1RUF1 1M4WA 1WMFA 1CAVA 2XHKA 3WR0A 3EJKA 4G3YC 3QH6A 1BXHA 4OVEA 5A3LA 1RUJ1 4O9GA 1WLTA 3A0KA 1WCDJ 1AL21 4OI1A 2YGLA 3ST7A 2DCJA 3AYCA 1DQ1A 3LAGA 2JG9A 1FNYA 4AW7A 2XJRA 4CDXA 1AR81 2JE7A 2IXHA 4FQZA 4RQPA 4TZDA 1RMU3 3AB0A 2ZX2A 1FPN3 3FJSA 3ZFGC 2OVUA 3WQ0A 2PA7A 4PLNA 1ULEA 2UY9A 1R091 3ZXDA 1ND2B 2ZHNA 4M01A 3BOWA 4JTOA 4C1XA 3FBYA 1G9DA 1GSLA 2X5IA 1N3OA 4META 3VBFC 1CAXA 1ZVFA 1PZ8A 1O7FA 2P37A 5K0UA 4WVMA 1U0AA 2YGMA 3X29B 3M3EA 4XETA 1VAMA 4H55A 3JU9A 4PIXA 2WC2A 1VBC3 3AP7A 1FI2A 3M4FA 4RS5B 4Q4V2 1APNA 2HWF1 1UPIA 3RQ0A 3VBSC 4HT1T 3I59A 1PVC3 1V70A 4EN8B 2JXAA 4RR3C 2H6BA 4Q4X2 2TEPA 2D6PA 4NWVA 3OD4A 2MEV2 5EXOA 4FVVA 3WG4A 1DG6A 3AX4A 3G6JB 4QQHA 3UJOA 3VKOA 4R9BA 2FMYA 5SV8A 4EROA 1V9U2 3HMYA 2RS52 2BNNA 2WA4A 1YFUA 2LUWA 3UK9A 2EXHA 2VU9A 2XBO3 1QXJA 3THTA 1BEV2 1HW5A 1GNHA 1OKQA 2ZA9A 3PVEA 1EAH1 1AUYA 1Z7S2 3VZOA 2R49A 4B4RA 5DDJ1 2PHDA 4FAHA 5JDBA 3D0SA 2F6BA 5J37A 1LESA 1SBFA 3NWKA 4ASMB 4LT5A 1TNFA 1YJKA 3DL3A 3M3QA 1QF3A 4AI1A 3VUOA 1MVEA 4YARA 4CZSA 4K21A 3MGUA 3S30A 1UZZA 1CAWA 2R6QA 4KL1A 1RUI2 3WW2A 4Q2FA 4QPGC 1PGW2 1TME3 5FBZA 2ARXA 1KXGA 4RGAA 1S0FA 1VJ2A 5J7MA 3TBDA 2XWJB 1X82A 3TB0A 2JENA 4MXWB 5LEJA 3E6BA 1R1A1 1C8M1 1W6QB 4HLTA 1KRIA 5JIUA 1J3QA 1NE6A 4DQAA 3AP5A 1RUOA 2D3RA 2B9UA 4CDUA 2HWC2 3WY6A 2WJSA 1NCQC 4LHLA 3PJYA 1DQ2A 3LSDA 1QWRA 2IXCA 3SH3A 4AWDA 1N3PA 1QJZA 5GLTA 1FOD2 4FXGB 1IS5A 2MHFA 5E16A 4IQPA 4YW4A 4QXKA 1GR3A 1GYKA 1MS0A 4L11A 1REEA 4F83A 1W0PA 5L19A 3O0XA 2WS91 1VBB1 3I2DA 1OA4A 1VP6A 3T2TA 3J8F1 2QJVA 2BEOA 3NVCA 4NVPA 4C1WA 5I8YA 2XPJA 3IN9A 2GNBA 3URFA 4I02A 3PJQA 1I1EA 3WINE 4F3JA 3D82A 1OQ1A 3GALA 4IV1A 4L2NA 3VBHB 1WMDA 4GALA 2RMU2 5BNOA 4QX5A 3GNEA 1GQGA 1OLQA 3D5OA 3ZSJA 4B4QA 4CDQA 5FLIA 3SITA 3DGTA 1RHI1 1AJKA 4GH4B 3S0MA 4A7ZA 2P3KA 2D43A 1TQ5A 3H1MA 4LLFA 3O0WA 1I3HA 3VBRB 3G7DA 2EVXA 3RJRA 3NAPB 1C3HA 4QPYA 2IWGB 1D4VB 1W6PA 4Y1UA 4HVRA 1OA2A 3ZN6B 1QOSA 2A71A 2ERFA 3O14A 2ZZJA 3KCXA 4EN0A 1DF0A 1D4M3 1HV0A 2VVEA 5K9YA 1RJ7A 3I54A 3A0NA 4LBQB 2WFF2 3WQ1A 3W58A 2NN8A 5KXEA 2HYKA 2CAVA 1S1AA 3W9AA 1UW8A 5GZEA 1CPNA 5CADA 3H8UA 5ABJC 1YCIA 3AXDA 4M3CB 4M00A 2HWB1 5T5OA 4YW3A 1IOAA 1V6IA 2WQZC 1U5ZA 1Q5OA 4K40A 1Q3EA 1COV1 2Q1ZB 2C9AA 2QDRA 4XF1A 3KD4A 1UN1A 3SCFA 1ND2A 5HBAA 1H1AA 3K51A 2YZ4A 4WM7C 2I2SA 4W6WA 2R0HA 3GBWA 3T1LA 1H9WA 2FBEA 3TNQA 3FUOA 4MGKE 4LE3A 5I0UA 4PIZA 3WDXA 4MGYE 3ZIWA 1K5MA 3CJIC 3ALQA 5AC92 1GANA 1JYIA 4GIQA 3ZXFA 3LZZA 5GLVA 3JBG2 4Y1VA 1ZZ8A 3INAA 5JAXA 5JOYA 1JOJA 4AI2A 1N3QA 4F8AA 2FZ1A 2VVDA 4RS5A 1ZBA2 1IKQA 1S0IA 2R072 2RM22 3ILRA 3KCYA 2CGPA 3PVNA 1HQWA 2YMZA 4KU8A 2WZR3 2E6VA 1XU1A 4JDMA 1QXRA 3BTAA 1MEC2 1O4ZA 4ZKTB 3BODA 5DZEA 4C91A 4OHWA 2UWBA 2RR11 3IBMA 4HKOA 5JMCA 1OQDA 1OQEA 2ZTNA 1GV9A 5K8SA 1BZWA 1WCSA 2RS31 3BOPA 1R081 2X29A 3E5UA 4G9SB 4Y5Z0 1NXD1 1RJ8A 3BALA 4WZFA 4UXAA 3S7EA 1LTEA 3ZYPA 1WD4A 3AJZA 4IL7A 4S2HA 2AH2A 4W6YA 2ZGKA 1RUD2 3EBRA 4YGDA 4Q0PA 1DZQA 1PNGA 1SDWA 2PLV2 1PO23 3E5XA 2NMOA 3RMXA 2BPA2 3RI9A 2VW0A 4ISRA 1NA1B 3MLJA 5T5PA 4XTPA 3ZYGA 2YY1A 4P9LA 4Y20B 5FLHA 4CEWC 3C2UA 1HLCA 2PAMA 4JAAA 2XJSA 4AVSA 2V5YA 1FT9A 1S0GA 2WZPP 1XU2A 1LHOA 1UKRA 1MZEA 3EQEA 4DY5A 1ZZ7A 1RMU2 1WGPA 3WP6A 1FPN2 2Q5TA 1RUF3 5KXDA 4YGEA 4LTAA 3JUUA 3WUCA 2WT2A 5CG8A 2GALA 3WP4A 2PAEA 3B69A 1AL23 2AENA 4S2GA 1WLCA 4N53C 1SBEA 1MVQA 3ZXEA 1ULDA 4Q4X3 1V6OA 4MXWA 1AYM1 4DPNA 2UYBA 4XPVA 1ZRRA 1IPKA 1WCKA 1W6QA 4DY3A 2B7YA 3GZTB 1KD7A 3TYJA 3N35A 1VBC2 1H8TC 4L99A 5JPNB 1R093 2WKKA 1RUE1 3I4IA 1V9U3 2B42B 1OMIA 3KT1A 1PVC2 5EYYA 2XL7A 1PZ9A 4QM8A 4KBBA 3ZPYA 4ZU7A 2WWSA 1ZM1A 3PVBB 3CL1A 2DU1A 4FPLA 1QJU1 4HK8A 3N3HA 2XLGA 4EWAA 3CEWA 3ETQA 2IXKA 4XZPA 2QZ3A 3V0BB 1Z78A 2DWRA 4BCUA 2JICA 1V6JA 2ZHKA 3HT2A 2XBO2 3ZFEC 2CV6A 1C1FA 4AG4A 3J4UH 3CO2A 2XB6C 4AFDA 2JE9A 3VBHA 4EN7B 5J09A 3WP3A 2BYVE 4BMBA 2WNUB 2D6MA 2VUAA 1X7NA 2D6NA 2RE9A 4ES8A 5L36A 1E57A 1RITA 3NV3A 4U36A 4XFHA 1RTVA 1V6KA 4GH4A 1J3PA 4LLOA 5C6CA 1X8EA 3FUQA 3RI8A 1XNCA 2ZGUA 5BYNA 1SMVA 1VBA1 1W39A 4WVMB 3ZXAC 4DNYA 1H8VA 3NV1A 3VBRA 5TSWA 2VG9A 1EAH3 5J36A 4YFZA 3AZYA 4E2SA 2D5FA 4FAGA 4HVQA 5JZGC 3USSA 5DDJ3 1TME2 3APBA 3NAPA 4WM8C 2DCYA 1IS4A 2VQAA 1LOFC 1YRZA 3GYDA 4FT8A 3ZN6A 2P3JA 5GZGA 4COWA 3QD6A 2XJUA 1Y7BA 3ZO0B 5FO9B 4Q0QA 2G9FA 3LGRA 2NP0A 3AP9A 3QH7A 4YZ2A 5GALA 4GXLA 4LBQA 1GLHA 2ZKNA 4KG8A 4RL7A 2YUEA 3E6CC 4CRQA 1AJOA 4AGGA 1B35B 3O5SA 3WVJA 3RZZA 1WLWA 1UF2C 1XYOA 3VDDC 1H0BA 1PO12 1NCQA 4AFAA 1OHFA 3ZN5A 4AHZA 4M3CA 4XHXA 3NW4A 5BY5A 4ITCA 4Q1RA 1BK1A 3PLQA 4XQWA 1QQP1 2DFCA 5DUUA 5C8CB 4PIYA 1R1A3 1C8M3 5DUVA 2Y38A 2B45X 3V65A 4XBNA 4EV0A 5C9AB 3ZIXA 1F5JA 4HL0A 1L3JA 4I0WB 1LHVA 3MICA 5JI7A 4BHPA 1BCXA 4AI0A 5KWRA 1CQ9A 1FMD1 2A75A 1HIXA 3WDVA 4J1XA 2K0GA 4GA9A 2VULA 4XBQA 1XNDA 4LA2A 3B5LB 2VW1A 3KZ4C 5GZCA 3SLIA 4BE3A 4Y1YA 3O12A 1VBB3 1HQNA 3FWEA 4KNCA 3MF9A 3VBUC 4IEWA 5J96B 1VR3A 4FBFA 3J8F3 4YVSB 5IK7A 1BMV2 4QGLA 5EJ3A 5D8AC 1DGWA 4YVWC 3ZX7A 2OUJA 3KM5A 2CY6A 3JCIA 1ZBE3 2B46X 2WFF3 3ZXGA 4X8NA 1TE1B 1POV0 1H30A 1UU5A 1A78A 1HRI1 5CFDC 1RB8G 1TEIA 1KS4A 5FCCA 3GBFA 2XUMA 3ZXJA 1LOGA 1VRH1 3VKFC 5FDBA 3NSTA 1RHI3 4MZUA 4RHV1 5IUQA 4N9HA 1IS3A 4JGZC 4XBLA 5FOBB 4QT6A 3UJQA 1IGOA 4P9IA 4MYEA 5JOZA 2P17A 1NA1A 2JDZA 4EJRA 1QMJA 2DURA