2GNQA

Structure of wdr5
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
324
structure length
316
Chain Sequence
EAARAQPTKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
publication title Structural basis for molecular recognition and presentation of histone H3 By WDR5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 105
structure length 316
sequence length 324
ec nomenclature
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2gnqA00
5CXBA 1P22A 4OZUA 2YNOA 2B5NA 3B7FA 4FA9D 3JZGA 4E54A 1U4CA 1XIPA 3C9CA 4L9OA 4IMMA 3SBPA 2IURA 4XYHA 3I7OA 4JXMA 4K3JB 4ESGA 2AGYA 3SBQA 3V9FA 2W18A 5EMMB 1N6EA 3OL2A 2YNNA 3CFSB 2YNPA 4J79A 2CO0C 5H17A 4FA1D 4PSWB 1Q47A 2IWKA 5FA5B 4G56B 5TEEA 5EALA 4JSVC 3ODTA 2PM9B 5EM2A 3ULEC 4FB1D 2AQ5A 2IUQA 4CY5A 4JT5C 4EWRA 3RN0D 2P9IC 2J56H 2PM7B 3SCYA 1VYHC 4ES0A 5TEFA 5CXBB 3UKRC 2HKMA 2H3XA 4BL0A 4E54B 4A0AA 3PXTD 2XL3A 3L4MD 2TRCB 3J81g 2CN2A 5IJ7E 4FAND 3DM0A 2H6KA 3OL2B 3I7LA 2CE8A 4U7AA 3MZLA 3N0DA 5K1CC 4CZYA 5FKTA 5GXHA 1SQJA 3SFZA 2O9KA 3MKQA 5EM2B 2I0TA 1SQ9A 3E0CA 4JT6C 2IWFA 2OJYA 3K27A 5FKRA 1NR0A 2H9NA 3I8CA 4QQEA 5FQDA 4J77A 3JRPA 3NVNA 4J87A 1OLZA 5HE3B 4ZOYA 3RN1D 2H68A 3I7NA 1PI6A 3PXWD 4O9DA 2P9PC 4PC0A 2HESX 2B5LA 1TYQC 2AH1A 1RI6A 4A0AB 4FWWA 3UVNA 4ZOXA 4ERQA 3EMHA 3UVMA 1U2VC 2MTAH 4J78A 5GMKn 1XKSA 3PVUB 5IC7A 5C2WB 4PSXB 4J84A 1GP2B 2Z2PA 3BWSA 4O45A 4FAVD 5TDHB 4X63B 2AGZA 4L3HD 1QNIA 4A09A 2IAAA 3BG1A 2CE9A 3SBRA 2OVPB 2B4EA 2AGLA 3UKUC 3GREA 4ZN4A 3JB9L 5SXMA 2OVQB 3RLMD 4UI9R 2AH0A 2H6NA 2UZYB 2H14A 4J0XA 2CO0A 3CFVA 2HJBA 4LG9A 4A0BA 4X60B 3DSMA 4PBZA 4A11A 4J81A 5CYKA 3IIWA 4O3TB 3C75H 1MG3A 2YBAA 1GG2B 3EI2A 2H9LA 4O1QD 3UVOA 2J55H 3UVKA 5I5JA 4L3GD 4A08A 4NSXA 4J8BA 4FA5D 4A09B 3P4FA 5IGOA 1PBYB 4GGDA 3OW8A 2QXVA 2H9MA 3I89A 3JROA 4U1EI 3SMRA 3EI3B 3FM0A 5GSAA 4E5ZA 4ZOZA 5H1MA 5I5IA 4A2LA 3PE7A 3PSCB 4GGAA 3DXKC 2XU7A 4Y7RA 3JPXA 1JMXB 3AL8A 4I79A 3RFGA 4OWRA 1FWXA 2I0RA 3UVLA 5CYKB 2P9LC 3A0FA 4Z8LA 5AJAA 2HXCA 3RFHA 5H14A 2IUPA 1B9XA 3EI2B 3I2NA 1TBGA 5EARA 5C9ZB 4GQBB 4CI3A 2G99A 3OKTA 5FXYA 4JD2C 2OK4A 3N0EA 4ERZA 2HYEA 3GFCA 3RMZD 5FKQA 3V5WB 3SJLD 3ZWLB 3J80g 1JMZB 5IJ8E 5KDOB 1XHMA 3IJ1A 4E5ZB 2EBSA 3OKYA 2GNQA 2J57G 1S4UX 4PXWA 3JAMg 3AL8B 2OK6A 3FGBA 5AFU3 3PXSD 1K32A 1GOTB 4J0WA 3EI4A 4KFMB 4IA9A 2H13A 5A2Qg 5GXIA 1A0RB 4BH6A 3C5MA 4JSPC 4O3UB 4L1QD 5EAPA 4X61B 3SXTD 3IJCA 2B5MA 1ERJA 2HKRA 4X3EA 4CY1A 4ZOVA 4N14A 2Q7QA 3DXMC 3NVXA 5I5MA 4GQ2P 2AGWA 2Z2NA 4HDJA 4AOWA 3PVWB 3EWEA 3U4YA 3KRXB 4TZ4A 3HFQA 3IJ0A 2I3TA 3EG6A 5CXCA 3SWSD 3C99A 1R5MA 4J73A 2YMUA 2QC5A 1MG2A 3KRWB 2I0SA 3RRMC 5EMLB 1JOFA 4CI1A 3EI4B 3W15A 4QRJA 3MZKA 3SVWD 3NVQA 4QT8A 3JZHA 4JSXC 1GXRA 3IKOA 3MKSB 3SLED 3V7DB 5EMKB 5AMSA 3ORVD 2P9UC 5C2VB 3VA6A 4CI2A 1PEVA 5HYNB 2GC7A 4J86A 3OKWA 2OIZA 1K8KC 3F3FA 3PSLA 3K26A 2P9NC 2XYIA 4CI8A 3DWLC 2XL2A 2H6QA 3I7PA 4GGCA 4LGNA 4A0BB 1L0QA 3I7KA 2HJ4A 4K3ID 2AGXA 5CXCB 2P9SC 4A11B 2CNXA 4PBYA 3AFCA 4XYIA 5IT9g 2Z2OA 4QL1A 3EI1A 4YVDA 3AH8B 2PM6B 3I7HA 2BBKH 3SHFA 3IIYA 1OMWB 3F3PA 4A08B 2YB8B 5HE0B 5FLXg 1N6DA 3VGZA 3RSEC 3SN6B 5TF2A 1YFQA 2CN3A 4GMBA 4PNKB 3FRXA 5FKSA 4D0KA 4A7JA 2P9KC 4CC9A 4Y5RD 2G9AA 5EMJB 3BG0A 3EU7A 2PBIB 5EAMA 4LG8A 4D6VA 2H47A 4GZ8A 1SHYB 4CZVA 5B4WA 4FHLA 1JJUB 1B9YA 3UR4A 2I3SA 4R7AB 4CY3A 4H5IA 3EI1B 4FA4D 4GM9A 5HE2B 1MDAH 4H5JA 1NEXB 4MK0B 5JWZA 3CIKB 5THAA 4CZXA 2GC4A 2H9PA 1PGUA 2UZXB 5HE1B 3F3GA 4A2MA 3I8EA 4GM8A 4AEZA 4BUJC 3MMYA 4GQ1A 4GM3A 5HQGA 5K19A 2BCJB 2PM9A 3VH0A 2OVRB 3JZNA 3AL9A 4J82A 3OTTA 4JSNC 3L4OD 3OKYB 4ERYA 2IUVA 4J8GA 4XEIC 1N6FA 4CY2A 5IGQA 3MXXA 3EI3A
chains in the Genus database with same CATH superfamily
5CXBA 1P22A 3NIGA 2YNOA 4OZUA 3ZE1A 2B5NA 3B7FA 4FA9D 3JZGA 4E54A 3QHYB 1U4CA 4UM9A 1XIPA 3C9CA 4L9OA 4IMMA 2VC2A 2BKLA 4AX4A 3SBPA 2IURA 4XYHA 1E8MA 3I7OA 4JXMA 3ZE0A 4K3JB 1UOQA 4ESGA 2AGYA 4WK0A 3SBQA 2VDRA 3V9FA 2W18A 4L1MA 5EMMB 1N6EA 3EQ7A 3OL2A 2YNNA 3CFSB 2YNPA 4J79A 2CO0C 5H17A 4FA1D 4PSWB 4BCDA 1Q47A 2IWKA 5FA5B 4G56B 5TEEA 5EALA 4JSVC 3ODTA 2PM9B 5EM2A 3ULEC 4FB1D 2AQ5A 2IUQA 4CY5A 4JT5C 4EWRA 1U8CA 3RN0D 3V4VA 2P9IC 2J56H 2PM7B 3EQ9A 3SCYA 1VYHC 4ES0A 5TEFA 3V4PA 2VZ1A 5CXBB 3UKRC 2HKMA 2H3XA 5FFOA 4BL0A 4E54B 4A0AA 3PXTD 2XL3A 3L4MD 2TRCB 3IJEA 5M5VA 3J81g 2CN2A 2QR5A 2XZGA 5IJ7E 5E6UA 3MUOA 4FAND 3DM0A 4Z7NA 2H6KA 5C86A 3OL2B 3I7LA 2CE8A 4U7AA 3MZLA 3N0DA 5K1CC 4CZYA 5FKTA 5GXHA 1SQJA 3SFZA 2O9KA 4NAAA 3MKQA 5EM2B 1BPOA 4IRZA 2I0TA 1SQ9A 3E0CA 4JT6C 4NENA 2IWFA 2OJYA 3K27A 5FKRA 1NR0A 2H9NA 3I8CA 4QQEA 5FQDA 4J77A 3JRPA 3NVNA 4J87A 1OLZA 5HE3B 4ZOYA 3RN1D 2H68A 3I7NA 1PI6A 3PXWD 4O9DA 3IURA 2P9PC 4AMZA 4PC0A 2HESX 3QI0A 1O6GA 2B5LA 1TYQC 2AH1A 1RI6A 3IUNA 4A0AB 1TYEA 4UM8A 4FWWA 3UVNA 1QFSA 4ZOXA 4ERQA 3EMHA 3UVMA 1U2VC 2MTAH 4J78A 5GMKn 1XKSA 3PVUB 5IC7A 5C2WB 1C9IA 4PSXB 1VE6A 4J84A 2VDOA 1GP2B 2Z2PA 3BWSA 4O45A 4FAVD 5TDHB 4X63B 2AGZA 4L3HD 1QNIA 4A09A 4MMYA 2IAAA 3BG1A 2CE9A 3SBRA 2OVPB 2B4EA 2AGLA 4BCCA 3UKUC 3GREA 4ZN4A 3JB9L 5SXMA 4NC4A 2OVQB 3RLMD 4UI9R 2EIBA 2AH0A 2H6NA 3NIFA 2UZYB 2H14A 4J0XA 2CO0A 3CFVA 2HJBA 4LG9A 4A0BA 1C9LA 1GOFA 4X60B 1K3IA 3DSMA 4PBZA 4WK4A 4A11A 4DNVA 4J81A 1A12A 5CYKA 3IIWA 3GC3B 4O3TB 3C75H 4JHPC 1MG3A 2YBAA 1GG2B 3EI2A 2XE4A 2H9LA 2EIEA 3O4IA 4O1QD 3UVOA 2J55H 1VE7A 3UVKA 5M5RA 5I5JA 4L3GD 4A08A 4NSXA 2XDWA 4J8BA 4FA5D 4A09B 1H2ZA 3P4FA 5IGOA 1PBYB 4GGDA 3OW8A 2QXVA 2H9MA 3I89A 3JROA 2VDMA 3K72A 4U1EI 3SMRA 3EI3B 3FM0A 2VDNA 5GSAA 4E5ZA 4ZOZA 5H1MA 5I5IA 4A2LA 3PE7A 3PSCB 4GGAA 3DXKC 2XU7A 4O02A 4Y7RA 2VDPA 3JPXA 1JMXB 3AL8A 4I79A 5E6SA 3RFGA 4OWRA 1FWXA 2I0RA 3UVLA 5CYKB 2P9LC 3A0FA 4Z8LA 5AJAA 2HXCA 3RFHA 5H14A 2IUPA 4DNUA 1B9XA 3EI2B 3I2NA 1TBGA 5EARA 2VZ3A 1UTCA 5C9ZB 4GQBB 4CI3A 4WJKA 3O4HA 4G55A 2G99A 3OKTA 4Z7QA 5FXYA 4JD2C 2OK4A 3N0EA 4AN0A 1O6FA 4ERZA 2HYEA 3GFCA 5M5UA 1YR2A 3ZE2A 3RMZD 3GD1I 5FKQA 2HU8A 3SJLD 3V5WB 3ZWLB 3J80g 4MMXA 1JMZB 2HU5A 5IJ8E 5KDOB 1XHMA 3IJ1A 4E5ZB 3MUNA 3T3MA 2EBSA 3OKYA 2GNQA 2J57G 1S4UX 4PXWA 3JAMg 3AL8B 2OK6A 3FGBA 5AFU3 3PXSD 1K32A 1GOTB 4J0WA 3EI4A 4KFMB 4IA9A 2H13A 5A2Qg 5GXIA 1A0RB 4BH6A 3C5MA 4JSPC 1E8NA 4O3UB 4L1QD 1VZ3A 2WQ8A 5EAPA 4X61B 3SXTD 3IJCA 2B5MA 4BCBA 3VI4A 1ERJA 3K6SA 2HKRA 5FFGA 2VDQA 4X3EA 5C92A 4CY1A 4ZOVA 1UOOA 4N14A 2Q7QA 3DXMC 1JV2A 3NVXA 5I5MA 4GQ2P 2AGWA 2Z2NA 3DDUA 4HDJA 4AOWA 3PVWB 3EWEA 3VI3A 3U4YA 3KRXB 4TZ4A 3HFQA 3IJ0A 4G1EA 2I3TA 3EG6A 5CXCA 3IVMA 3SWSD 3C99A 1R5MA 4J73A 2YMUA 2QC5A 1MG2A 3KRWB 2I0SA 3RRMC 5EMLB 2VDLA 1JOFA 5M61A 1H2XA 4CI1A 3EI4B 3W15A 4QRJA 3MZKA 3FCSA 4D9SA 3SVWD 3NVQA 4QT8A 3JZHA 4JSXC 4AMYA 1GXRA 3IKOA 3MKSB 5E6RA 3SLED 3V7DB 5EMKB 5AMSA 3ORVD 4Z7OA 3ZDYA 2P9UC 5C2VB 1H2YA 3VA6A 1H2WA 5M5TA 4CI2A 4BP8A 1PEVA 3EQ8A 5HYNB 2GC7A 4J86A 3OKWA 2EICA 2OIZA 1K8KC 3F3FA 1QFMA 3PSLA 3K26A 2P9NC 3MVDK 2XYIA 3FCUA 3DWLC 4CI8A 2XL2A 2JKXA 2H6QA 3I7PA 4GGCA 4LGNA 4A0BB 1L0QA 3I7KA 2HJ4A 3IUMA 4K3ID 2AGXA 4AN1A 5CXCB 2P9SC 4A11B 2CNXA 4PBYA 3AFCA 3IULA 4XYIA 5IT9g 2Z2OA 2VDKA 4QL1A 3EI1A 4YVDA 3AH8B 2PM6B 3I7HA 4NBMA 2QZPA 2BBKH 3SHFA 3IIYA 1OMWB 1UOPA 3F3PA 4O2WA 4A08B 2YB8B 4WK2A 5HE0B 5FLXg 1N6DA 3VGZA 3RSEC 3SN6B 5TF2A 1YFQA 2CN3A 4GMBA 4PNKB 1GOGA 3FRXA 5FKSA 4D0KA 4A7JA 1I2MB 2P9KC 4CC9A 4Y5RD 1VZ2A 2G9AA 5EMJB 3IUJA 3BG0A 4G1MA 3EU7A 2PBIB 5EAMA 5M5SA 4LG8A 5HDBA 4D6VA 2H47A 4GZ8A 1SHYB 4JHNA 1M1XA 4CZVA 5B4WA 3IUQA 4FHLA 1JJUB 1B9YA 1JTDB 3UR4A 2I3SA 3O4JA 4R7AB 4CY3A 1L5GA 1GOHA 3T3PA 4H5IA 3EI1B 2HU7A 3KCIA 4FA4D 4GM9A 5HE2B 1MDAH 4H5JA 1NEXB 4MK0B 3ZDXA 5JWZA 4BP9A 4RE6A 3K71A 3CIKB 4DNWA 1T2XA 5THAA 4CZXA 2GC4A 2H9PA 1PGUA 2UZXB 3O4GA 5HE1B 3F3GA 4A2MA 3I8EA 4GM8A 4AEZA 4BUJC 2EIDA 3MMYA 4GQ1A 4RE5A 4GM3A 5HQGA 5K19A 2BCJB 2PM9A 3VH0A 2OVRB 3JZNA 3AL9A 4J82A 3OTTA 3L4OD 3OF7A 4JSNC 4QAMA 3ZDZA 3NIDA 3OKYB 4ERYA 2IUVA 4J8GA 4XEIC 1E5TA 1N6FA 4CY2A 4MMZA 5IGQA 3MXXA 3EI3A
chains in the Genus database with same CATH topology
5CXBA 1P22A 4OZUA 2YNOA 2B5NA 3B7FA 4FA9D 3JZGA 4E54A 1U4CA 1XIPA 3C9CA 4L9OA 4IMMA 3SBPA 2IURA 4XYHA 3I7OA 4JXMA 4K3JB 4ESGA 2AGYA 3SBQA 3V9FA 2W18A 5EMMB 1N6EA 3OL2A 2YNNA 3CFSB 2YNPA 4J79A 2CO0C 5H17A 4FA1D 4PSWB 1Q47A 2IWKA 5FA5B 4G56B 5TEEA 5EALA 4JSVC 3ODTA 2PM9B 5EM2A 3ULEC 4FB1D 2AQ5A 2IUQA 4CY5A 4JT5C 4EWRA 3RN0D 2P9IC 2J56H 2PM7B 3SCYA 1VYHC 4ES0A 5TEFA 5CXBB 3UKRC 2HKMA 2H3XA 4BL0A 4E54B 4A0AA 3PXTD 2XL3A 3L4MD 2TRCB 3J81g 2CN2A 5IJ7E 4FAND 3DM0A 2H6KA 3OL2B 3I7LA 2CE8A 4U7AA 3MZLA 3N0DA 5K1CC 4CZYA 5FKTA 5GXHA 1SQJA 3SFZA 2O9KA 3MKQA 5EM2B 2I0TA 1SQ9A 3E0CA 4JT6C 2IWFA 2OJYA 3K27A 5FKRA 1NR0A 2H9NA 3I8CA 4QQEA 5FQDA 4J77A 3JRPA 3NVNA 4J87A 1OLZA 5HE3B 4ZOYA 3RN1D 2H68A 3I7NA 1PI6A 3PXWD 4O9DA 2P9PC 4PC0A 2HESX 2B5LA 1TYQC 2AH1A 1RI6A 4A0AB 4FWWA 3UVNA 4ZOXA 4ERQA 3EMHA 3UVMA 1U2VC 2MTAH 4J78A 5GMKn 1XKSA 3PVUB 5IC7A 5C2WB 4PSXB 4J84A 1GP2B 2Z2PA 3BWSA 4O45A 4FAVD 5TDHB 4X63B 2AGZA 4L3HD 1QNIA 4A09A 2IAAA 3BG1A 2CE9A 3SBRA 2OVPB 2B4EA 2AGLA 3UKUC 3GREA 4ZN4A 3JB9L 5SXMA 2OVQB 3RLMD 4UI9R 2AH0A 2H6NA 2UZYB 2H14A 4J0XA 2CO0A 3CFVA 2HJBA 4LG9A 4A0BA 4X60B 3DSMA 4PBZA 4A11A 4J81A 5CYKA 3IIWA 4O3TB 3C75H 1MG3A 2YBAA 1GG2B 3EI2A 2H9LA 4O1QD 3UVOA 2J55H 3UVKA 5I5JA 4L3GD 4A08A 4NSXA 4J8BA 4FA5D 4A09B 3P4FA 5IGOA 1PBYB 4GGDA 3OW8A 2QXVA 2H9MA 3I89A 3JROA 4U1EI 3SMRA 3EI3B 3FM0A 5GSAA 4E5ZA 4ZOZA 5H1MA 5I5IA 4A2LA 3PE7A 3PSCB 4GGAA 3DXKC 2XU7A 4Y7RA 3JPXA 1JMXB 3AL8A 4I79A 3RFGA 4OWRA 1FWXA 2I0RA 3UVLA 5CYKB 2P9LC 3A0FA 4Z8LA 5AJAA 2HXCA 3RFHA 5H14A 2IUPA 1B9XA 3EI2B 3I2NA 1TBGA 5EARA 5C9ZB 4GQBB 4CI3A 2G99A 3OKTA 5FXYA 4JD2C 2OK4A 3N0EA 4ERZA 2HYEA 3GFCA 3RMZD 5FKQA 3V5WB 3SJLD 3ZWLB 3J80g 1JMZB 5IJ8E 5KDOB 1XHMA 3IJ1A 4E5ZB 2EBSA 3OKYA 2GNQA 2J57G 1S4UX 4PXWA 3JAMg 3AL8B 2OK6A 3FGBA 5AFU3 3PXSD 1K32A 1GOTB 4J0WA 3EI4A 4KFMB 4IA9A 2H13A 5A2Qg 5GXIA 1A0RB 4BH6A 3C5MA 4JSPC 4O3UB 4L1QD 5EAPA 4X61B 3SXTD 3IJCA 2B5MA 1ERJA 2HKRA 4X3EA 4CY1A 4ZOVA 4N14A 2Q7QA 3DXMC 3NVXA 5I5MA 4GQ2P 2AGWA 2Z2NA 4HDJA 4AOWA 3PVWB 3EWEA 3U4YA 3KRXB 4TZ4A 3HFQA 3IJ0A 2I3TA 3EG6A 5CXCA 3SWSD 3C99A 1R5MA 4J73A 2YMUA 2QC5A 1MG2A 3KRWB 2I0SA 3RRMC 5EMLB 1JOFA 4CI1A 3EI4B 3W15A 4QRJA 3MZKA 3SVWD 3NVQA 4QT8A 3JZHA 4JSXC 1GXRA 3IKOA 3MKSB 3SLED 3V7DB 5EMKB 5AMSA 3ORVD 2P9UC 5C2VB 3VA6A 4CI2A 1PEVA 5HYNB 2GC7A 4J86A 3OKWA 2OIZA 1K8KC 3F3FA 3PSLA 3K26A 2P9NC 2XYIA 4CI8A 3DWLC 2XL2A 2H6QA 3I7PA 4GGCA 4LGNA 4A0BB 1L0QA 3I7KA 2HJ4A 4K3ID 2AGXA 5CXCB 2P9SC 4A11B 2CNXA 4PBYA 3AFCA 4XYIA 5IT9g 2Z2OA 4QL1A 3EI1A 4YVDA 3AH8B 2PM6B 3I7HA 2BBKH 3SHFA 3IIYA 1OMWB 3F3PA 4A08B 2YB8B 5HE0B 5FLXg 1N6DA 3VGZA 3RSEC 3SN6B 5TF2A 1YFQA 2CN3A 4GMBA 4PNKB 3FRXA 5FKSA 4D0KA 4A7JA 2P9KC 4CC9A 4Y5RD 2G9AA 5EMJB 3BG0A 3EU7A 2PBIB 5EAMA 4LG8A 4D6VA 2H47A 4GZ8A 1SHYB 4CZVA 5B4WA 4FHLA 1JJUB 1B9YA 3UR4A 2I3SA 4R7AB 4CY3A 4H5IA 3EI1B 4FA4D 4GM9A 5HE2B 1MDAH 4H5JA 1NEXB 4MK0B 5JWZA 3CIKB 5THAA 4CZXA 2GC4A 2H9PA 1PGUA 2UZXB 5HE1B 3F3GA 4A2MA 3I8EA 4GM8A 4AEZA 4BUJC 3MMYA 4GQ1A 4GM3A 5HQGA 5K19A 2BCJB 2PM9A 3VH0A 2OVRB 3JZNA 3AL9A 4J82A 3OTTA 4JSNC 3L4OD 3OKYB 4ERYA 2IUVA 4J8GA 4XEIC 1N6FA 4CY2A 5IGQA 3MXXA 3EI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CXB A;  1P22 A;  4OZU A;  2YNO A;  2B5N A;  3B7F A;  4FA9 D;  3JZG A;  4E54 A;  1U4C A;  1XIP A;  3C9C A;  4L9O A;  4IMM A;  3SBP A;  2IUR A;  4XYH A;  3I7O A;  4JXM A;  4K3J B;  4ESG A;  2AGY A;  3SBQ A;  3V9F A;  2W18 A;  5EMM B;  1N6E A;  3OL2 A;  2YNN A;  3CFS B;  2YNP A;  4J79 A;  2CO0 C;  5H17 A;  4FA1 D;  4PSW B;  1Q47 A;  2IWK A;  5FA5 B;  4G56 B;  5TEE A;  5EAL A;  4JSV C;  3ODT A;  2PM9 B;  5EM2 A;  3ULE C;  4FB1 D;  2AQ5 A;  2IUQ A;  4CY5 A;  4JT5 C;  4EWR A;  3RN0 D;  2P9I C;  2J56 H;  2PM7 B;  3SCY A;  1VYH C;  4ES0 A;  5TEF A;  5CXB B;  3UKR C;  2HKM A;  2H3X A;  4BL0 A;  4E54 B;  4A0A A;  3PXT D;  2XL3 A;  3L4M D;  2TRC B;  3J81 g;  2CN2 A;  5IJ7 E;  4FAN D;  3DM0 A;  2H6K A;  3OL2 B;  3I7L A;  2CE8 A;  4U7A A;  3MZL A;  3N0D A;  5K1C C;  4CZY A;  5FKT A;  5GXH A;  1SQJ A;  3SFZ A;  2O9K A;  3MKQ A;  5EM2 B;  2I0T A;  1SQ9 A;  3E0C A;  4JT6 C;  2IWF A;  2OJY A;  3K27 A;  5FKR A;  1NR0 A;  2H9N A;  3I8C A;  4QQE A;  5FQD A;  4J77 A;  3JRP A;  3NVN A;  4J87 A;  1OLZ A;  5HE3 B;  4ZOY A;  3RN1 D;  2H68 A;  3I7N A;  1PI6 A;  3PXW D;  4O9D A;  2P9P C;  4PC0 A;  2HES X;  2B5L A;  1TYQ C;  2AH1 A;  1RI6 A;  4A0A B;  4FWW A;  3UVN A;  4ZOX A;  4ERQ A;  3EMH A;  3UVM A;  1U2V C;  2MTA H;  4J78 A;  5GMK n;  1XKS A;  3PVU B;  5IC7 A;  5C2W B;  4PSX B;  4J84 A;  1GP2 B;  2Z2P A;  3BWS A;  4O45 A;  4FAV D;  5TDH B;  4X63 B;  2AGZ A;  4L3H D;  1QNI A;  4A09 A;  2IAA A;  3BG1 A;  2CE9 A;  3SBR A;  2OVP B;  2B4E A;  2AGL A;  3UKU C;  3GRE A;  4ZN4 A;  3JB9 L;  5SXM A;  2OVQ B;  3RLM D;  4UI9 R;  2AH0 A;  2H6N A;  2UZY B;  2H14 A;  4J0X A;  2CO0 A;  3CFV A;  2HJB A;  4LG9 A;  4A0B A;  4X60 B;  3DSM A;  4PBZ A;  4A11 A;  4J81 A;  5CYK A;  3IIW A;  4O3T B;  3C75 H;  1MG3 A;  2YBA A;  1GG2 B;  3EI2 A;  2H9L A;  4O1Q D;  3UVO A;  2J55 H;  3UVK A;  5I5J A;  4L3G D;  4A08 A;  4NSX A;  4J8B A;  4FA5 D;  4A09 B;  3P4F A;  5IGO A;  1PBY B;  4GGD A;  3OW8 A;  2QXV A;  2H9M A;  3I89 A;  3JRO A;  4U1E I;  3SMR A;  3EI3 B;  3FM0 A;  5GSA A;  4E5Z A;  4ZOZ A;  5H1M A;  5I5I A;  4A2L A;  3PE7 A;  3PSC B;  4GGA A;  3DXK C;  2XU7 A;  4Y7R A;  3JPX A;  1JMX B;  3AL8 A;  4I79 A;  3RFG A;  4OWR A;  1FWX A;  2I0R A;  3UVL A;  5CYK B;  2P9L C;  3A0F A;  4Z8L A;  5AJA A;  2HXC A;  3RFH A;  5H14 A;  2IUP A;  1B9X A;  3EI2 B;  3I2N A;  1TBG A;  5EAR A;  5C9Z B;  4GQB B;  4CI3 A;  2G99 A;  3OKT A;  5FXY A;  4JD2 C;  2OK4 A;  3N0E A;  4ERZ A;  2HYE A;  3GFC A;  3RMZ D;  5FKQ A;  3V5W B;  3SJL D;  3ZWL B;  3J80 g;  1JMZ B;  5IJ8 E;  5KDO B;  1XHM A;  3IJ1 A;  4E5Z B;  2EBS A;  3OKY A;  2GNQ A;  2J57 G;  1S4U X;  4PXW A;  3JAM g;  3AL8 B;  2OK6 A;  3FGB A;  5AFU 3;  3PXS D;  1K32 A;  1GOT B;  4J0W A;  3EI4 A;  4KFM B;  4IA9 A;  2H13 A;  5A2Q g;  5GXI A;  1A0R B;  4BH6 A;  3C5M A;  4JSP C;  4O3U B;  4L1Q D;  5EAP A;  4X61 B;  3SXT D;  3IJC A;  2B5M A;  1ERJ A;  2HKR A;  4X3E A;  4CY1 A;  4ZOV A;  4N14 A;  2Q7Q A;  3DXM C;  3NVX A;  5I5M A;  4GQ2 P;  2AGW A;  2Z2N A;  4HDJ A;  4AOW A;  3PVW B;  3EWE A;  3U4Y A;  3KRX B;  4TZ4 A;  3HFQ A;  3IJ0 A;  2I3T A;  3EG6 A;  5CXC A;  3SWS D;  3C99 A;  1R5M A;  4J73 A;  2YMU A;  2QC5 A;  1MG2 A;  3KRW B;  2I0S A;  3RRM C;  5EML B;  1JOF A;  4CI1 A;  3EI4 B;  3W15 A;  4QRJ A;  3MZK A;  3SVW D;  3NVQ A;  4QT8 A;  3JZH A;  4JSX C;  1GXR A;  3IKO A;  3MKS B;  3SLE D;  3V7D B;  5EMK B;  5AMS A;  3ORV D;  2P9U C;  5C2V B;  3VA6 A;  4CI2 A;  1PEV A;  5HYN B;  2GC7 A;  4J86 A;  3OKW A;  2OIZ A;  1K8K C;  3F3F A;  3PSL A;  3K26 A;  2P9N C;  2XYI A;  4CI8 A;  3DWL C;  2XL2 A;  2H6Q A;  3I7P A;  4GGC A;  4LGN A;  4A0B B;  1L0Q A;  3I7K A;  2HJ4 A;  4K3I D;  2AGX A;  5CXC B;  2P9S C;  4A11 B;  2CNX A;  4PBY A;  3AFC A;  4XYI A;  5IT9 g;  2Z2O A;  4QL1 A;  3EI1 A;  4YVD A;  3AH8 B;  2PM6 B;  3I7H A;  2BBK H;  3SHF A;  3IIY A;  1OMW B;  3F3P A;  4A08 B;  2YB8 B;  5HE0 B;  5FLX g;  1N6D A;  3VGZ A;  3RSE C;  3SN6 B;  5TF2 A;  1YFQ A;  2CN3 A;  4GMB A;  4PNK B;  3FRX A;  5FKS A;  4D0K A;  4A7J A;  2P9K C;  4CC9 A;  4Y5R D;  2G9A A;  5EMJ B;  3BG0 A;  3EU7 A;  2PBI B;  5EAM A;  4LG8 A;  4D6V A;  2H47 A;  4GZ8 A;  1SHY B;  4CZV A;  5B4W A;  4FHL A;  1JJU B;  1B9Y A;  3UR4 A;  2I3S A;  4R7A B;  4CY3 A;  4H5I A;  3EI1 B;  4FA4 D;  4GM9 A;  5HE2 B;  1MDA H;  4H5J A;  1NEX B;  4MK0 B;  5JWZ A;  3CIK B;  5THA A;  4CZX A;  2GC4 A;  2H9P A;  1PGU A;  2UZX B;  5HE1 B;  3F3G A;  4A2M A;  3I8E A;  4GM8 A;  4AEZ A;  4BUJ C;  3MMY A;  4GQ1 A;  4GM3 A;  5HQG A;  5K19 A;  2BCJ B;  2PM9 A;  3VH0 A;  2OVR B;  3JZN A;  3AL9 A;  4J82 A;  3OTT A;  4JSN C;  3L4O D;  3OKY B;  4ERY A;  2IUV A;  4J8G A;  4XEI C;  1N6F A;  4CY2 A;  5IGQ A;  3MXX A;  3EI3 A; 
#chains in the Genus database with same CATH topology
 5CXB A;  1P22 A;  3NIG A;  2YNO A;  4OZU A;  3ZE1 A;  2B5N A;  3B7F A;  4FA9 D;  3JZG A;  4E54 A;  3QHY B;  1U4C A;  4UM9 A;  1XIP A;  3C9C A;  4L9O A;  4IMM A;  2VC2 A;  2BKL A;  4AX4 A;  3SBP A;  2IUR A;  4XYH A;  1E8M A;  3I7O A;  4JXM A;  3ZE0 A;  4K3J B;  1UOQ A;  4ESG A;  2AGY A;  4WK0 A;  3SBQ A;  2VDR A;  3V9F A;  2W18 A;  4L1M A;  5EMM B;  1N6E A;  3EQ7 A;  3OL2 A;  2YNN A;  3CFS B;  2YNP A;  4J79 A;  2CO0 C;  5H17 A;  4FA1 D;  4PSW B;  4BCD A;  1Q47 A;  2IWK A;  5FA5 B;  4G56 B;  5TEE A;  5EAL A;  4JSV C;  3ODT A;  2PM9 B;  5EM2 A;  3ULE C;  4FB1 D;  2AQ5 A;  2IUQ A;  4CY5 A;  4JT5 C;  4EWR A;  1U8C A;  3RN0 D;  3V4V A;  2P9I C;  2J56 H;  2PM7 B;  3EQ9 A;  3SCY A;  1VYH C;  4ES0 A;  5TEF A;  3V4P A;  2VZ1 A;  5CXB B;  3UKR C;  2HKM A;  2H3X A;  5FFO A;  4BL0 A;  4E54 B;  4A0A A;  3PXT D;  2XL3 A;  3L4M D;  2TRC B;  3IJE A;  5M5V A;  3J81 g;  2CN2 A;  2QR5 A;  2XZG A;  5IJ7 E;  5E6U A;  3MUO A;  4FAN D;  3DM0 A;  4Z7N A;  2H6K A;  5C86 A;  3OL2 B;  3I7L A;  2CE8 A;  4U7A A;  3MZL A;  3N0D A;  5K1C C;  4CZY A;  5FKT A;  5GXH A;  1SQJ A;  3SFZ A;  2O9K A;  4NAA A;  3MKQ A;  5EM2 B;  1BPO A;  4IRZ A;  2I0T A;  1SQ9 A;  3E0C A;  4JT6 C;  4NEN A;  2IWF A;  2OJY A;  3K27 A;  5FKR A;  1NR0 A;  2H9N A;  3I8C A;  4QQE A;  5FQD A;  4J77 A;  3JRP A;  3NVN A;  4J87 A;  1OLZ A;  5HE3 B;  4ZOY A;  3RN1 D;  2H68 A;  3I7N A;  1PI6 A;  3PXW D;  4O9D A;  3IUR A;  2P9P C;  4AMZ A;  4PC0 A;  2HES X;  3QI0 A;  1O6G A;  2B5L A;  1TYQ C;  2AH1 A;  1RI6 A;  3IUN A;  4A0A B;  1TYE A;  4UM8 A;  4FWW A;  3UVN A;  1QFS A;  4ZOX A;  4ERQ A;  3EMH A;  3UVM A;  1U2V C;  2MTA H;  4J78 A;  5GMK n;  1XKS A;  3PVU B;  5IC7 A;  5C2W B;  1C9I A;  4PSX B;  1VE6 A;  4J84 A;  2VDO A;  1GP2 B;  2Z2P A;  3BWS A;  4O45 A;  4FAV D;  5TDH B;  4X63 B;  2AGZ A;  4L3H D;  1QNI A;  4A09 A;  4MMY A;  2IAA A;  3BG1 A;  2CE9 A;  3SBR A;  2OVP B;  2B4E A;  2AGL A;  4BCC A;  3UKU C;  3GRE A;  4ZN4 A;  3JB9 L;  5SXM A;  4NC4 A;  2OVQ B;  3RLM D;  4UI9 R;  2EIB A;  2AH0 A;  2H6N A;  3NIF A;  2UZY B;  2H14 A;  4J0X A;  2CO0 A;  3CFV A;  2HJB A;  4LG9 A;  4A0B A;  1C9L A;  1GOF A;  4X60 B;  1K3I A;  3DSM A;  4PBZ A;  4WK4 A;  4A11 A;  4DNV A;  4J81 A;  1A12 A;  5CYK A;  3IIW A;  3GC3 B;  4O3T B;  3C75 H;  4JHP C;  1MG3 A;  2YBA A;  1GG2 B;  3EI2 A;  2XE4 A;  2H9L A;  2EIE A;  3O4I A;  4O1Q D;  3UVO A;  2J55 H;  1VE7 A;  3UVK A;  5M5R A;  5I5J A;  4L3G D;  4A08 A;  4NSX A;  2XDW A;  4J8B A;  4FA5 D;  4A09 B;  1H2Z A;  3P4F A;  5IGO A;  1PBY B;  4GGD A;  3OW8 A;  2QXV A;  2H9M A;  3I89 A;  3JRO A;  2VDM A;  3K72 A;  4U1E I;  3SMR A;  3EI3 B;  3FM0 A;  2VDN A;  5GSA A;  4E5Z A;  4ZOZ A;  5H1M A;  5I5I A;  4A2L A;  3PE7 A;  3PSC B;  4GGA A;  3DXK C;  2XU7 A;  4O02 A;  4Y7R A;  2VDP A;  3JPX A;  1JMX B;  3AL8 A;  4I79 A;  5E6S A;  3RFG A;  4OWR A;  1FWX A;  2I0R A;  3UVL A;  5CYK B;  2P9L C;  3A0F A;  4Z8L A;  5AJA A;  2HXC A;  3RFH A;  5H14 A;  2IUP A;  4DNU A;  1B9X A;  3EI2 B;  3I2N A;  1TBG A;  5EAR A;  2VZ3 A;  1UTC A;  5C9Z B;  4GQB B;  4CI3 A;  4WJK A;  3O4H A;  4G55 A;  2G99 A;  3OKT A;  4Z7Q A;  5FXY A;  4JD2 C;  2OK4 A;  3N0E A;  4AN0 A;  1O6F A;  4ERZ A;  2HYE A;  3GFC A;  5M5U A;  1YR2 A;  3ZE2 A;  3RMZ D;  3GD1 I;  5FKQ A;  2HU8 A;  3SJL D;  3V5W B;  3ZWL B;  3J80 g;  4MMX A;  1JMZ B;  2HU5 A;  5IJ8 E;  5KDO B;  1XHM A;  3IJ1 A;  4E5Z B;  3MUN A;  3T3M A;  2EBS A;  3OKY A;  2GNQ A;  2J57 G;  1S4U X;  4PXW A;  3JAM g;  3AL8 B;  2OK6 A;  3FGB A;  5AFU 3;  3PXS D;  1K32 A;  1GOT B;  4J0W A;  3EI4 A;  4KFM B;  4IA9 A;  2H13 A;  5A2Q g;  5GXI A;  1A0R B;  4BH6 A;  3C5M A;  4JSP C;  1E8N A;  4O3U B;  4L1Q D;  1VZ3 A;  2WQ8 A;  5EAP A;  4X61 B;  3SXT D;  3IJC A;  2B5M A;  4BCB A;  3VI4 A;  1ERJ A;  3K6S A;  2HKR A;  5FFG A;  2VDQ A;  4X3E A;  5C92 A;  4CY1 A;  4ZOV A;  1UOO A;  4N14 A;  2Q7Q A;  3DXM C;  1JV2 A;  3NVX A;  5I5M A;  4GQ2 P;  2AGW A;  2Z2N A;  3DDU A;  4HDJ A;  4AOW A;  3PVW B;  3EWE A;  3VI3 A;  3U4Y A;  3KRX B;  4TZ4 A;  3HFQ A;  3IJ0 A;  4G1E A;  2I3T A;  3EG6 A;  5CXC A;  3IVM A;  3SWS D;  3C99 A;  1R5M A;  4J73 A;  2YMU A;  2QC5 A;  1MG2 A;  3KRW B;  2I0S A;  3RRM C;  5EML B;  2VDL A;  1JOF A;  5M61 A;  1H2X A;  4CI1 A;  3EI4 B;  3W15 A;  4QRJ A;  3MZK A;  3FCS A;  4D9S A;  3SVW D;  3NVQ A;  4QT8 A;  3JZH A;  4JSX C;  4AMY A;  1GXR A;  3IKO A;  3MKS B;  5E6R A;  3SLE D;  3V7D B;  5EMK B;  5AMS A;  3ORV D;  4Z7O A;  3ZDY A;  2P9U C;  5C2V B;  1H2Y A;  3VA6 A;  1H2W A;  5M5T A;  4CI2 A;  4BP8 A;  1PEV A;  3EQ8 A;  5HYN B;  2GC7 A;  4J86 A;  3OKW A;  2EIC A;  2OIZ A;  1K8K C;  3F3F A;  1QFM A;  3PSL A;  3K26 A;  2P9N C;  3MVD K;  2XYI A;  3FCU A;  3DWL C;  4CI8 A;  2XL2 A;  2JKX A;  2H6Q A;  3I7P A;  4GGC A;  4LGN A;  4A0B B;  1L0Q A;  3I7K A;  2HJ4 A;  3IUM A;  4K3I D;  2AGX A;  4AN1 A;  5CXC B;  2P9S C;  4A11 B;  2CNX A;  4PBY A;  3AFC A;  3IUL A;  4XYI A;  5IT9 g;  2Z2O A;  2VDK A;  4QL1 A;  3EI1 A;  4YVD A;  3AH8 B;  2PM6 B;  3I7H A;  4NBM A;  2QZP A;  2BBK H;  3SHF A;  3IIY A;  1OMW B;  1UOP A;  3F3P A;  4O2W A;  4A08 B;  2YB8 B;  4WK2 A;  5HE0 B;  5FLX g;  1N6D A;  3VGZ A;  3RSE C;  3SN6 B;  5TF2 A;  1YFQ A;  2CN3 A;  4GMB A;  4PNK B;  1GOG A;  3FRX A;  5FKS A;  4D0K A;  4A7J A;  1I2M B;  2P9K C;  4CC9 A;  4Y5R D;  1VZ2 A;  2G9A A;  5EMJ B;  3IUJ A;  3BG0 A;  4G1M A;  3EU7 A;  2PBI B;  5EAM A;  5M5S A;  4LG8 A;  5HDB A;  4D6V A;  2H47 A;  4GZ8 A;  1SHY B;  4JHN A;  1M1X A;  4CZV A;  5B4W A;  3IUQ A;  4FHL A;  1JJU B;  1B9Y A;  1JTD B;  3UR4 A;  2I3S A;  3O4J A;  4R7A B;  4CY3 A;  1L5G A;  1GOH A;  3T3P A;  4H5I A;  3EI1 B;  2HU7 A;  3KCI A;  4FA4 D;  4GM9 A;  5HE2 B;  1MDA H;  4H5J A;  1NEX B;  4MK0 B;  3ZDX A;  5JWZ A;  4BP9 A;  4RE6 A;  3K71 A;  3CIK B;  4DNW A;  1T2X A;  5THA A;  4CZX A;  2GC4 A;  2H9P A;  1PGU A;  2UZX B;  3O4G A;  5HE1 B;  3F3G A;  4A2M A;  3I8E A;  4GM8 A;  4AEZ A;  4BUJ C;  2EID A;  3MMY A;  4GQ1 A;  4RE5 A;  4GM3 A;  5HQG A;  5K19 A;  2BCJ B;  2PM9 A;  3VH0 A;  2OVR B;  3JZN A;  3AL9 A;  4J82 A;  3OTT A;  3L4O D;  3OF7 A;  4JSN C;  4QAM A;  3ZDZ A;  3NID A;  3OKY B;  4ERY A;  2IUV A;  4J8G A;  4XEI C;  1E5T A;  1N6F A;  4CY2 A;  4MMZ A;  5IGQ A;  3MXX A;  3EI3 A; 
#chains in the Genus database with same CATH homology
 5CXB A;  1P22 A;  4OZU A;  2YNO A;  2B5N A;  3B7F A;  4FA9 D;  3JZG A;  4E54 A;  1U4C A;  1XIP A;  3C9C A;  4L9O A;  4IMM A;  3SBP A;  2IUR A;  4XYH A;  3I7O A;  4JXM A;  4K3J B;  4ESG A;  2AGY A;  3SBQ A;  3V9F A;  2W18 A;  5EMM B;  1N6E A;  3OL2 A;  2YNN A;  3CFS B;  2YNP A;  4J79 A;  2CO0 C;  5H17 A;  4FA1 D;  4PSW B;  1Q47 A;  2IWK A;  5FA5 B;  4G56 B;  5TEE A;  5EAL A;  4JSV C;  3ODT A;  2PM9 B;  5EM2 A;  3ULE C;  4FB1 D;  2AQ5 A;  2IUQ A;  4CY5 A;  4JT5 C;  4EWR A;  3RN0 D;  2P9I C;  2J56 H;  2PM7 B;  3SCY A;  1VYH C;  4ES0 A;  5TEF A;  5CXB B;  3UKR C;  2HKM A;  2H3X A;  4BL0 A;  4E54 B;  4A0A A;  3PXT D;  2XL3 A;  3L4M D;  2TRC B;  3J81 g;  2CN2 A;  5IJ7 E;  4FAN D;  3DM0 A;  2H6K A;  3OL2 B;  3I7L A;  2CE8 A;  4U7A A;  3MZL A;  3N0D A;  5K1C C;  4CZY A;  5FKT A;  5GXH A;  1SQJ A;  3SFZ A;  2O9K A;  3MKQ A;  5EM2 B;  2I0T A;  1SQ9 A;  3E0C A;  4JT6 C;  2IWF A;  2OJY A;  3K27 A;  5FKR A;  1NR0 A;  2H9N A;  3I8C A;  4QQE A;  5FQD A;  4J77 A;  3JRP A;  3NVN A;  4J87 A;  1OLZ A;  5HE3 B;  4ZOY A;  3RN1 D;  2H68 A;  3I7N A;  1PI6 A;  3PXW D;  4O9D A;  2P9P C;  4PC0 A;  2HES X;  2B5L A;  1TYQ C;  2AH1 A;  1RI6 A;  4A0A B;  4FWW A;  3UVN A;  4ZOX A;  4ERQ A;  3EMH A;  3UVM A;  1U2V C;  2MTA H;  4J78 A;  5GMK n;  1XKS A;  3PVU B;  5IC7 A;  5C2W B;  4PSX B;  4J84 A;  1GP2 B;  2Z2P A;  3BWS A;  4O45 A;  4FAV D;  5TDH B;  4X63 B;  2AGZ A;  4L3H D;  1QNI A;  4A09 A;  2IAA A;  3BG1 A;  2CE9 A;  3SBR A;  2OVP B;  2B4E A;  2AGL A;  3UKU C;  3GRE A;  4ZN4 A;  3JB9 L;  5SXM A;  2OVQ B;  3RLM D;  4UI9 R;  2AH0 A;  2H6N A;  2UZY B;  2H14 A;  4J0X A;  2CO0 A;  3CFV A;  2HJB A;  4LG9 A;  4A0B A;  4X60 B;  3DSM A;  4PBZ A;  4A11 A;  4J81 A;  5CYK A;  3IIW A;  4O3T B;  3C75 H;  1MG3 A;  2YBA A;  1GG2 B;  3EI2 A;  2H9L A;  4O1Q D;  3UVO A;  2J55 H;  3UVK A;  5I5J A;  4L3G D;  4A08 A;  4NSX A;  4J8B A;  4FA5 D;  4A09 B;  3P4F A;  5IGO A;  1PBY B;  4GGD A;  3OW8 A;  2QXV A;  2H9M A;  3I89 A;  3JRO A;  4U1E I;  3SMR A;  3EI3 B;  3FM0 A;  5GSA A;  4E5Z A;  4ZOZ A;  5H1M A;  5I5I A;  4A2L A;  3PE7 A;  3PSC B;  4GGA A;  3DXK C;  2XU7 A;  4Y7R A;  3JPX A;  1JMX B;  3AL8 A;  4I79 A;  3RFG A;  4OWR A;  1FWX A;  2I0R A;  3UVL A;  5CYK B;  2P9L C;  3A0F A;  4Z8L A;  5AJA A;  2HXC A;  3RFH A;  5H14 A;  2IUP A;  1B9X A;  3EI2 B;  3I2N A;  1TBG A;  5EAR A;  5C9Z B;  4GQB B;  4CI3 A;  2G99 A;  3OKT A;  5FXY A;  4JD2 C;  2OK4 A;  3N0E A;  4ERZ A;  2HYE A;  3GFC A;  3RMZ D;  5FKQ A;  3V5W B;  3SJL D;  3ZWL B;  3J80 g;  1JMZ B;  5IJ8 E;  5KDO B;  1XHM A;  3IJ1 A;  4E5Z B;  2EBS A;  3OKY A;  2GNQ A;  2J57 G;  1S4U X;  4PXW A;  3JAM g;  3AL8 B;  2OK6 A;  3FGB A;  5AFU 3;  3PXS D;  1K32 A;  1GOT B;  4J0W A;  3EI4 A;  4KFM B;  4IA9 A;  2H13 A;  5A2Q g;  5GXI A;  1A0R B;  4BH6 A;  3C5M A;  4JSP C;  4O3U B;  4L1Q D;  5EAP A;  4X61 B;  3SXT D;  3IJC A;  2B5M A;  1ERJ A;  2HKR A;  4X3E A;  4CY1 A;  4ZOV A;  4N14 A;  2Q7Q A;  3DXM C;  3NVX A;  5I5M A;  4GQ2 P;  2AGW A;  2Z2N A;  4HDJ A;  4AOW A;  3PVW B;  3EWE A;  3U4Y A;  3KRX B;  4TZ4 A;  3HFQ A;  3IJ0 A;  2I3T A;  3EG6 A;  5CXC A;  3SWS D;  3C99 A;  1R5M A;  4J73 A;  2YMU A;  2QC5 A;  1MG2 A;  3KRW B;  2I0S A;  3RRM C;  5EML B;  1JOF A;  4CI1 A;  3EI4 B;  3W15 A;  4QRJ A;  3MZK A;  3SVW D;  3NVQ A;  4QT8 A;  3JZH A;  4JSX C;  1GXR A;  3IKO A;  3MKS B;  3SLE D;  3V7D B;  5EMK B;  5AMS A;  3ORV D;  2P9U C;  5C2V B;  3VA6 A;  4CI2 A;  1PEV A;  5HYN B;  2GC7 A;  4J86 A;  3OKW A;  2OIZ A;  1K8K C;  3F3F A;  3PSL A;  3K26 A;  2P9N C;  2XYI A;  4CI8 A;  3DWL C;  2XL2 A;  2H6Q A;  3I7P A;  4GGC A;  4LGN A;  4A0B B;  1L0Q A;  3I7K A;  2HJ4 A;  4K3I D;  2AGX A;  5CXC B;  2P9S C;  4A11 B;  2CNX A;  4PBY A;  3AFC A;  4XYI A;  5IT9 g;  2Z2O A;  4QL1 A;  3EI1 A;  4YVD A;  3AH8 B;  2PM6 B;  3I7H A;  2BBK H;  3SHF A;  3IIY A;  1OMW B;  3F3P A;  4A08 B;  2YB8 B;  5HE0 B;  5FLX g;  1N6D A;  3VGZ A;  3RSE C;  3SN6 B;  5TF2 A;  1YFQ A;  2CN3 A;  4GMB A;  4PNK B;  3FRX A;  5FKS A;  4D0K A;  4A7J A;  2P9K C;  4CC9 A;  4Y5R D;  2G9A A;  5EMJ B;  3BG0 A;  3EU7 A;  2PBI B;  5EAM A;  4LG8 A;  4D6V A;  2H47 A;  4GZ8 A;  1SHY B;  4CZV A;  5B4W A;  4FHL A;  1JJU B;  1B9Y A;  3UR4 A;  2I3S A;  4R7A B;  4CY3 A;  4H5I A;  3EI1 B;  4FA4 D;  4GM9 A;  5HE2 B;  1MDA H;  4H5J A;  1NEX B;  4MK0 B;  5JWZ A;  3CIK B;  5THA A;  4CZX A;  2GC4 A;  2H9P A;  1PGU A;  2UZX B;  5HE1 B;  3F3G A;  4A2M A;  3I8E A;  4GM8 A;  4AEZ A;  4BUJ C;  3MMY A;  4GQ1 A;  4GM3 A;  5HQG A;  5K19 A;  2BCJ B;  2PM9 A;  3VH0 A;  2OVR B;  3JZN A;  3AL9 A;  4J82 A;  3OTT A;  4JSN C;  3L4O D;  3OKY B;  4ERY A;  2IUV A;  4J8G A;  4XEI C;  1N6F A;  4CY2 A;  5IGQ A;  3MXX A;  3EI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...