2GNQA

Structure of wdr5
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
324
structure length
316
Chain Sequence
EAARAQPTKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
publication title Structural basis for molecular recognition and presentation of histone H3 By WDR5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 105
structure length 316
sequence length 324
ec nomenclature
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2gnqA00
2YBAA 2J56H 1B9YA 2Q7QA 4ESGA 3DM0A 2I3SA 2I0RA 4J0XA 3UKRC 1N6FA 5C2WB 4L9OA 2PM9A 3V5WB 2IWFA 5HYNB 4A11A 3SBPA 3FM0A 1OMWB 5EARA 3J80g 3RFGA 2XU7A 3ORVD 3V9FA 3HFQA 2IUVA 5AMSA 3ODTA 4QL1A 2IWKA 3AL8B 4K3ID 4FA9D 3MKQA 4U7AA 1PEVA 4O9DA 3MXXA 4GGCA 4CY5A 2AH1A 1QNIA 4D0KA 3OL2A 3N0DA 4E5ZA 5FXYA 2YNNA 1MG3A 4X60B 2I3TA 2H68A 3SHFA 4J8BA 5I5MA 3I7PA 1SQJA 2IURA 3VGZA 3IIWA 4A08A 2HJ4A 2Z2NA 3IJ1A 3SFZA 4CZVA 4Z8LA 5FKTA 3F3PA 4Y5RD 1MDAH 4O3UB 5A2Qg 3UVNA 2IAAA 3RN1D 3ZWLB 5H14A 3EI2B 4UI9R 2HYEA 4OZUA 3SXTD 5CXCA 3C75H 4J84A 3PXSD 2AGWA 2OJYA 5TDHB 4L3GD 4PC0A 3EI3A 1SHYB 3I8CA 2BBKH 3N0EA 5CYKB 3B7FA 3UVLA 3E0CA 4CZXA 4EWRA 2I0SA 1R5MA 3EI1A 3IJCA 3I89A 3I7NA 4J77A 5H1MA 3PVUB 5EM2A 5CXBA 4LGNA 2OK4A 2H14A 4PBZA 2H6NA 3AFCA 4N14A 4A09A 4CI1A 3PVWB 4ES0A 1N6EA 3FRXA 3OKYB 2H13A 4L1QD 3AH8B 3I7HA 2B4EA 3C99A 1XHMA 4BH6A 2YB8B 1JMZB 4JXMA 2P9NC 4JSNC 3I8EA 3PSLA 4JSXC 4GGAA 5EMMB 4FA5D 5GXIA 2H6KA 2XL3A 1JOFA 2BCJB 4GM9A 2H3XA 1GOTB 1TYQC 2CO0C 2UZXB 1PBYB 2W18A 4GQ2P 4J8GA 1K8KC 5HE0B 3I2NA 4O3TB 4AEZA 5FLXg 3SLED 3MMYA 2CNXA 1TBGA 2OIZA 4JD2C 5FQDA 4ERZA 4CI8A 1Q47A 3SBRA 3SN6B 4A0AA 2B5MA 2PM7B 4CC9A 2P9SC 3MZLA 4O45A 2TRCB 4J78A 2Z2OA 2HESX 4Y7RA 4K3JB 4JT5C 4BUJC 4HDJA 2IUQA 3I7OA 4GQ1A 5EAMA 5FKSA 4FAVD 1XKSA 5HE2B 5I5IA 3GREA 3JB9L 4GZ8A 2QXVA 4U1EI 2P9LC 2XYIA 3DSMA 4XYHA 4E54A 4I79A 4FAND 3L4OD 3VH0A 3AL9A 3K26A 4JSPC 4MK0B 2PM6B 3RFHA 3EI4A 2YNPA 4NSXA 4A0BA 4FB1D 1SQ9A 2OVRB 5JWZA 1XIPA 1JJUB 4FHLA 2I0TA 3KRWB 2P9UC 4ZOXA 5IC7A 5B4WA 2PM9B 3JROA 3RN0D 2P9PC 3J81g 4A11B 5H17A 3PXTD 1GP2B 4J73A 4PNKB 4J0WA 4J87A 4A7JA 4ZOYA 2PBIB 3W15A 4X63B 3P4FA 4A2MA 1S4UX 4QRJA 3JRPA 2H9NA 3VA6A 3SVWD 3JAMg 4QT8A 4J82A 2J55H 3C9CA 2J57G 2UZYB 3AL8A 3OL2B 2B5NA 4BL0A 4CY3A 3UVMA 4E5ZB 1YFQA 2AGZA 3BG0A 3F3FA 4JSVC 4YVDA 3IJ0A 3PXWD 1MG2A 3I7KA 4A08B 2HKMA 4GMBA 2CE8A 3A0FA 5EAPA 4OWRA 4H5IA 5HQGA 3FGBA 4GM3A 3SCYA 3OKTA 3PSCB 2Z2PA 3CFSB 4PXWA 1B9XA 2HJBA 4L3HD 1PI6A 5AFU3 2AQ5A 3RSEC 3JZGA 2OK6A 5CXCB 4ERYA 5HE3B 3EI2A 2H9PA 5EALA 2CE9A 3EI3B 2H6QA 4XYIA 5TEEA 5TEFA 2G9AA 4FWWA 3EI1B 4ZOZA 3JZHA 4CI3A 2MTAH 2HKRA 2HXCA 1L0QA 5CXBB 5EM2B 3EWEA 2AH0A 5CYKA 1P22A 4ZOVA 3CFVA 5I5JA 5TF2A 4A09B 3V7DB 3L4MD 5GXHA 3MZKA 3DXMC 3SMRA 3F3GA 3JZNA 4PBYA 4CY2A 4J81A 3EG6A 3OKYA 1GXRA 3NVXA 2AGLA 3OW8A 4GQBB 1RI6A 2CN2A 5FA5B 4ERQA 1VYHC 4G56B 4XEIC 5IJ7E 3I7LA 5EMLB 5K19A 3UKUC 4CZYA 4IMMA 3RLMD 4A2LA 5C2VB 5IJ8E 4X3EA 1GG2B 4FA4D 5C9ZB 5IT9g 4ZN4A 2G99A 3UR4A 1ERJA 5GMKn 5IGOA 5HE1B 1K32A 3K27A 2YNOA 4H5JA 3MKSB 3NVQA 5AJAA 4GM8A 2XL2A 3IKOA 5FKRA 2YMUA 4AOWA 2IUPA 4KFMB 3PE7A 4TZ4A 5THAA 2GNQA 1A0RB 5IGQA 3RMZD 2O9KA 3NVNA 2H47A 2OVQB 3U4YA 4A0AB 2AGXA 4LG8A 4FA1D 4PSXB 3OTTA 1U2VC 3SJLD 4JT6C 4O1QD 2B5LA 5EMJB 2CN3A 5SXMA 5GSAA 4PSWB 5KDOB 5K1CC 1N6DA 3JPXA 3CIKB 3DXKC 2P9IC 2GC4A 3RRMC 3ULEC 2H9LA 4GGDA 1PGUA 1OLZA 4E54B 3KRXB 3SWSD 4QQEA 2H9MA 2OVPB 3EMHA 1FWXA 3IIYA 5EMKB 4IA9A 1JMXB 3UVOA 4LG9A 3UVKA 4D6VA 5FKQA 1NR0A 3OKWA 3SBQA 3EI4B 1NEXB 4A0BB 4J86A 2EBSA 2AGYA 2P9KC 3DWLC 2GC7A 3GFCA 3EU7A 2QC5A 4J79A 4X61B 4CY1A 3BWSA 4R7AB 3BG1A 2CO0A 4CI2A 3C5MA 1U4CA
chains in the Genus database with same CATH superfamily
2YBAA 2J56H 1B9YA 2Q7QA 4ESGA 1JTDB 3DM0A 2I3SA 2I0RA 4J0XA 4L1MA 1N6FA 3UKRC 5C2WB 4L9OA 2PM9A 3GD1I 3V5WB 2IWFA 4BP9A 5HYNB 4A11A 3SBPA 3FM0A 1OMWB 5EARA 3J80g 3RFGA 2XU7A 3GC3B 3ORVD 4NC4A 3V9FA 3HFQA 2IUVA 5AMSA 3ODTA 4QL1A 2QR5A 2IWKA 3AL8B 4MMYA 4K3ID 4FA9D 3MKQA 4JHPC 4U7AA 1PEVA 4O9DA 3MXXA 4GGCA 4CY5A 2AH1A 1QNIA 4D0KA 3OL2A 3N0DA 4E5ZA 5FXYA 2YNNA 2HU8A 1MG3A 4X60B 2I3TA 4BP8A 2H68A 1U8CA 3SHFA 4J8BA 5I5MA 3I7PA 3ZE0A 1SQJA 2IURA 3VGZA 3IIWA 2EICA 4A08A 3VI3A 4Z7OA 2HJ4A 2Z2NA 3IJ1A 3SFZA 4CZVA 4Z8LA 1A12A 5FKTA 3F3PA 4DNWA 3KCIA 4Y5RD 1MDAH 4O3UB 5C92A 5A2Qg 3UVNA 2IAAA 3RN1D 3ZWLB 3ZDZA 3IURA 5H14A 1QFSA 1L5GA 3EI2B 4UI9R 2HYEA 1VZ3A 2XE4A 3VI4A 4OZUA 3SXTD 5CXCA 3C75H 4J84A 3O4JA 2AGWA 2OJYA 3PXSD 5TDHB 4L3GD 4PC0A 3EI3A 1SHYB 3DDUA 3I8CA 4AMYA 2BBKH 3N0EA 5CYKB 3B7FA 5M5RA 3UVLA 3E0CA 4CZXA 4EWRA 2I0SA 1GOFA 1R5MA 3IJCA 3EI1A 3I89A 3I7NA 4J77A 5H1MA 3PVUB 5EM2A 5CXBA 4LGNA 1O6GA 4BCDA 2OK4A 2JKXA 2H14A 4PBZA 2H6NA 1H2YA 3AFCA 4N14A 4A09A 4CI1A 3PVWB 4ES0A 1N6EA 3FRXA 4G55A 3OKYB 2H13A 4L1QD 2VDPA 1UOOA 5FFOA 3AH8B 3I7HA 2B4EA 3C99A 1XHMA 2VC2A 4BH6A 2YB8B 1JMZB 4JXMA 2P9NC 4JSNC 1H2WA 3ZE2A 3I8EA 4DNVA 3PSLA 2EIDA 4JSXC 4GGAA 5EMMB 3FCSA 4FA5D 5GXIA 2H6KA 3IVMA 2XL3A 1JOFA 2BCJB 3EQ9A 4GM9A 1C9LA 2H3XA 4RE5A 1GOTB 1TYQC 2CO0C 3K6SA 4WK2A 2UZXB 1PBYB 1UTCA 2W18A 4GQ2P 4J8GA 3V4VA 1K8KC 5HE0B 3I2NA 3NIGA 4O3TB 4AEZA 3V4PA 3SLED 5FLXg 3MMYA 2CNXA 1TBGA 2OIZA 4JD2C 5FQDA 5HDBA 4ERZA 4CI8A 5M5TA 4O2WA 1Q47A 2VDKA 3SBRA 3IULA 3SN6B 4A0AA 2B5MA 2PM7B 3IUJA 4CC9A 2EIEA 2P9SC 1C9IA 3MZLA 1VE6A 4O45A 2TRCB 4MMZA 4J78A 4G1MA 2Z2OA 2HESX 2VDMA 4Y7RA 4K3JB 3ZDXA 4JT5C 4BUJC 4HDJA 3NIFA 2IUQA 4WK4A 3I7OA 4GQ1A 5EAMA 5FKSA 4FAVD 1XKSA 5HE2B 5I5IA 3GREA 3JB9L 4GZ8A 2QXVA 1UOPA 4U1EI 2P9LC 2XYIA 5FFGA 4D9SA 3DSMA 4XYHA 4E54A 4I79A 5E6RA 4FAND 5M5UA 3L4OD 3VH0A 3AL9A 3EQ7A 3K26A 4JSPC 4MK0B 2PM6B 2VDOA 5E6UA 3RFHA 3EI4A 2YNPA 4NSXA 4A0BA 1UOQA 4FB1D 1E8MA 1SQ9A 2OVRB 5JWZA 1XIPA 1JJUB 4FHLA 2I0TA 3KRWB 2P9UC 4BCCA 4ZOXA 5IC7A 5B4WA 2PM9B 3JROA 3RN0D 2P9PC 3J81g 4A11B 5H17A 3PXTD 1GP2B 4J73A 4PNKB 1QFMA 4J0WA 4J87A 3OF7A 4A7JA 4ZOYA 2PBIB 3W15A 4X63B 3P4FA 4A2MA 1S4UX 4QRJA 3K72A 3JRPA 2H9NA 3VA6A 3SVWD 3JAMg 4QT8A 4J82A 2J55H 2VDLA 3C9CA 3IUMA 2J57G 2UZYB 3AL8A 3OL2B 2B5NA 4BL0A 1GOHA 3UVMA 4CY3A 4E5ZB 1YFQA 3ZE1A 3K71A 2AGZA 3BG0A 4G1EA 3F3FA 4JSVC 4YVDA 3IJ0A 3PXWD 3O4GA 1MG2A 3I7KA 3T3MA 4A08B 2HKMA 4GMBA 2CE8A 3A0FA 5EAPA 3FCUA 4OWRA 4H5IA 5HQGA 3FGBA 4GM3A 3SCYA 2EIBA 3OKTA 3PSCB 2Z2PA 3CFSB 4MMXA 4QAMA 4PXWA 1BPOA 1B9XA 2VDRA 2HJBA 5M61A 4L3HD 1PI6A 5AFU3 2AQ5A 3RSEC 3JZGA 2OK6A 4UM9A 3O4HA 3IJEA 5CXCB 4ERYA 2VDNA 5M5SA 5HE3B 3EI2A 2H9PA 5EALA 2CE9A 3EI3B 2H6QA 4XYIA 5TEEA 5TEFA 1TYEA 2G9AA 4FWWA 2VZ3A 3EI1B 5C86A 4ZOZA 3JZHA 4CI3A 2MTAH 1YR2A 2HKRA 1L0QA 2HXCA 5CXBB 3EWEA 5EM2B 2AH0A 5CYKA 1P22A 1VZ2A 4NENA 4ZOVA 3CFVA 5I5JA 5TF2A 4A09B 3V7DB 3L4MD 4BCBA 5GXHA 5E6SA 3MZKA 3DXMC 4IRZA 3SMRA 1JV2A 3F3GA 3IUNA 3JZNA 4PBYA 4CY2A 4J81A 3EG6A 4WK0A 3OKYA 3IUQA 1GXRA 3NVXA 2AGLA 3O4IA 3OW8A 4GQBB 1RI6A 2CN2A 5FA5B 4ERQA 4RE6A 1E8NA 1VYHC 1O6FA 2VZ1A 3QHYB 4G56B 4XEIC 4DNUA 5IJ7E 3I7LA 5EMLB 5K19A 3MUNA 3UKUC 4CZYA 4IMMA 3RLMD 4A2LA 5C2VB 5IJ8E 4X3EA 1H2ZA 1GG2B 4FA4D 5C9ZB 5IT9g 4ZN4A 2G99A 3UR4A 1ERJA 5GMKn 5IGOA 5HE1B 1VE7A 1K32A 3K27A 2YNOA 4H5JA 3MKSB 3NVQA 5AJAA 4GM8A 2XL2A 3IKOA 5FKRA 2YMUA 4AOWA 2IUPA 4KFMB 3PE7A 4TZ4A 4WJKA 1T2XA 5THAA 2GNQA 1A0RB 5IGQA 3RMZD 2VDQA 4AN1A 2O9KA 3NVNA 2H47A 2OVQB 3U4YA 4A0AB 4UM8A 2AGXA 1K3IA 4LG8A 4FA1D 4PSXB 3OTTA 1U2VC 3SJLD 4JT6C 4O1QD 2B5LA 5EMJB 2CN3A 5SXMA 5GSAA 2BKLA 4PSWB 4O02A 2XZGA 5KDOB 4Z7NA 5K1CC 1N6DA 3JPXA 3CIKB 1H2XA 2P9IC 3DXKC 2WQ8A 3MUOA 2GC4A 4JHNA 3RRMC 3ULEC 2H9LA 4GGDA 1GOGA 4Z7QA 1PGUA 4AN0A 5M5VA 3MVDK 1M1XA 4NAAA 1OLZA 4NBMA 4E54B 3QI0A 1I2MB 4AMZA 3EQ8A 3KRXB 3SWSD 4QQEA 2H9MA 2OVPB 3EMHA 3NIDA 1FWXA 3IIYA 5EMKB 4IA9A 1JMXB 2HU5A 3UVOA 4LG9A 3UVKA 1E5TA 4D6VA 5FKQA 1NR0A 3OKWA 3SBQA 3EI4B 1NEXB 4A0BB 4J86A 2EBSA 2AGYA 2P9KC 3T3PA 3DWLC 2XDWA 4AX4A 2GC7A 2HU7A 3GFCA 3EU7A 2QC5A 4J79A 4X61B 4CY1A 3BWSA 4R7AB 3BG1A 2QZPA 2CO0A 4CI2A 3ZDYA 3C5MA 1U4CA
chains in the Genus database with same CATH topology
2YBAA 2J56H 1B9YA 2Q7QA 4ESGA 3DM0A 2I3SA 2I0RA 4J0XA 3UKRC 1N6FA 5C2WB 4L9OA 2PM9A 3V5WB 2IWFA 5HYNB 4A11A 3SBPA 3FM0A 1OMWB 5EARA 3J80g 3RFGA 2XU7A 3ORVD 3V9FA 3HFQA 2IUVA 5AMSA 3ODTA 4QL1A 2IWKA 3AL8B 4K3ID 4FA9D 3MKQA 4U7AA 1PEVA 4O9DA 3MXXA 4GGCA 4CY5A 2AH1A 1QNIA 4D0KA 3OL2A 3N0DA 4E5ZA 5FXYA 2YNNA 1MG3A 4X60B 2I3TA 2H68A 3SHFA 4J8BA 5I5MA 3I7PA 1SQJA 2IURA 3VGZA 3IIWA 4A08A 2HJ4A 2Z2NA 3IJ1A 3SFZA 4CZVA 4Z8LA 5FKTA 3F3PA 4Y5RD 1MDAH 4O3UB 5A2Qg 3UVNA 2IAAA 3RN1D 3ZWLB 5H14A 3EI2B 4UI9R 2HYEA 4OZUA 3SXTD 5CXCA 3C75H 4J84A 3PXSD 2AGWA 2OJYA 5TDHB 4L3GD 4PC0A 3EI3A 1SHYB 3I8CA 2BBKH 3N0EA 5CYKB 3B7FA 3UVLA 3E0CA 4CZXA 4EWRA 2I0SA 1R5MA 3EI1A 3IJCA 3I89A 3I7NA 4J77A 5H1MA 3PVUB 5EM2A 5CXBA 4LGNA 2OK4A 2H14A 4PBZA 2H6NA 3AFCA 4N14A 4A09A 4CI1A 3PVWB 4ES0A 1N6EA 3FRXA 3OKYB 2H13A 4L1QD 3AH8B 3I7HA 2B4EA 3C99A 1XHMA 4BH6A 2YB8B 1JMZB 4JXMA 2P9NC 4JSNC 3I8EA 3PSLA 4JSXC 4GGAA 5EMMB 4FA5D 5GXIA 2H6KA 2XL3A 1JOFA 2BCJB 4GM9A 2H3XA 1GOTB 1TYQC 2CO0C 2UZXB 1PBYB 2W18A 4GQ2P 4J8GA 1K8KC 5HE0B 3I2NA 4O3TB 4AEZA 5FLXg 3SLED 3MMYA 2CNXA 1TBGA 2OIZA 4JD2C 5FQDA 4ERZA 4CI8A 1Q47A 3SBRA 3SN6B 4A0AA 2B5MA 2PM7B 4CC9A 2P9SC 3MZLA 4O45A 2TRCB 4J78A 2Z2OA 2HESX 4Y7RA 4K3JB 4JT5C 4BUJC 4HDJA 2IUQA 3I7OA 4GQ1A 5EAMA 5FKSA 4FAVD 1XKSA 5HE2B 5I5IA 3GREA 3JB9L 4GZ8A 2QXVA 4U1EI 2P9LC 2XYIA 3DSMA 4XYHA 4E54A 4I79A 4FAND 3L4OD 3VH0A 3AL9A 3K26A 4JSPC 4MK0B 2PM6B 3RFHA 3EI4A 2YNPA 4NSXA 4A0BA 4FB1D 1SQ9A 2OVRB 5JWZA 1XIPA 1JJUB 4FHLA 2I0TA 3KRWB 2P9UC 4ZOXA 5IC7A 5B4WA 2PM9B 3JROA 3RN0D 2P9PC 3J81g 4A11B 5H17A 3PXTD 1GP2B 4J73A 4PNKB 4J0WA 4J87A 4A7JA 4ZOYA 2PBIB 3W15A 4X63B 3P4FA 4A2MA 1S4UX 4QRJA 3JRPA 2H9NA 3VA6A 3SVWD 3JAMg 4QT8A 4J82A 2J55H 3C9CA 2J57G 2UZYB 3AL8A 3OL2B 2B5NA 4BL0A 4CY3A 3UVMA 4E5ZB 1YFQA 2AGZA 3BG0A 3F3FA 4JSVC 4YVDA 3IJ0A 3PXWD 1MG2A 3I7KA 4A08B 2HKMA 4GMBA 2CE8A 3A0FA 5EAPA 4OWRA 4H5IA 5HQGA 3FGBA 4GM3A 3SCYA 3OKTA 3PSCB 2Z2PA 3CFSB 4PXWA 1B9XA 2HJBA 4L3HD 1PI6A 5AFU3 2AQ5A 3RSEC 3JZGA 2OK6A 5CXCB 4ERYA 5HE3B 3EI2A 2H9PA 5EALA 2CE9A 3EI3B 2H6QA 4XYIA 5TEEA 5TEFA 2G9AA 4FWWA 3EI1B 4ZOZA 3JZHA 4CI3A 2MTAH 2HKRA 2HXCA 1L0QA 5CXBB 5EM2B 3EWEA 2AH0A 5CYKA 1P22A 4ZOVA 3CFVA 5I5JA 5TF2A 4A09B 3V7DB 3L4MD 5GXHA 3MZKA 3DXMC 3SMRA 3F3GA 3JZNA 4PBYA 4CY2A 4J81A 3EG6A 3OKYA 1GXRA 3NVXA 2AGLA 3OW8A 4GQBB 1RI6A 2CN2A 5FA5B 4ERQA 1VYHC 4G56B 4XEIC 5IJ7E 3I7LA 5EMLB 5K19A 3UKUC 4CZYA 4IMMA 3RLMD 4A2LA 5C2VB 5IJ8E 4X3EA 1GG2B 4FA4D 5C9ZB 5IT9g 4ZN4A 2G99A 3UR4A 1ERJA 5GMKn 5IGOA 5HE1B 1K32A 3K27A 2YNOA 4H5JA 3MKSB 3NVQA 5AJAA 4GM8A 2XL2A 3IKOA 5FKRA 2YMUA 4AOWA 2IUPA 4KFMB 3PE7A 4TZ4A 5THAA 2GNQA 1A0RB 5IGQA 3RMZD 2O9KA 3NVNA 2H47A 2OVQB 3U4YA 4A0AB 2AGXA 4LG8A 4FA1D 4PSXB 3OTTA 1U2VC 3SJLD 4JT6C 4O1QD 2B5LA 5EMJB 2CN3A 5SXMA 5GSAA 4PSWB 5KDOB 5K1CC 1N6DA 3JPXA 3CIKB 3DXKC 2P9IC 2GC4A 3RRMC 3ULEC 2H9LA 4GGDA 1PGUA 1OLZA 4E54B 3KRXB 3SWSD 4QQEA 2H9MA 2OVPB 3EMHA 1FWXA 3IIYA 5EMKB 4IA9A 1JMXB 3UVOA 4LG9A 3UVKA 4D6VA 5FKQA 1NR0A 3OKWA 3SBQA 3EI4B 1NEXB 4A0BB 4J86A 2EBSA 2AGYA 2P9KC 3DWLC 2GC7A 3GFCA 3EU7A 2QC5A 4J79A 4X61B 4CY1A 3BWSA 4R7AB 3BG1A 2CO0A 4CI2A 3C5MA 1U4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YBA A;  2J56 H;  1B9Y A;  2Q7Q A;  4ESG A;  3DM0 A;  2I3S A;  2I0R A;  4J0X A;  3UKR C;  1N6F A;  5C2W B;  4L9O A;  2PM9 A;  3V5W B;  2IWF A;  5HYN B;  4A11 A;  3SBP A;  3FM0 A;  1OMW B;  5EAR A;  3J80 g;  3RFG A;  2XU7 A;  3ORV D;  3V9F A;  3HFQ A;  2IUV A;  5AMS A;  3ODT A;  4QL1 A;  2IWK A;  3AL8 B;  4K3I D;  4FA9 D;  3MKQ A;  4U7A A;  1PEV A;  4O9D A;  3MXX A;  4GGC A;  4CY5 A;  2AH1 A;  1QNI A;  4D0K A;  3OL2 A;  3N0D A;  4E5Z A;  5FXY A;  2YNN A;  1MG3 A;  4X60 B;  2I3T A;  2H68 A;  3SHF A;  4J8B A;  5I5M A;  3I7P A;  1SQJ A;  2IUR A;  3VGZ A;  3IIW A;  4A08 A;  2HJ4 A;  2Z2N A;  3IJ1 A;  3SFZ A;  4CZV A;  4Z8L A;  5FKT A;  3F3P A;  4Y5R D;  1MDA H;  4O3U B;  5A2Q g;  3UVN A;  2IAA A;  3RN1 D;  3ZWL B;  5H14 A;  3EI2 B;  4UI9 R;  2HYE A;  4OZU A;  3SXT D;  5CXC A;  3C75 H;  4J84 A;  3PXS D;  2AGW A;  2OJY A;  5TDH B;  4L3G D;  4PC0 A;  3EI3 A;  1SHY B;  3I8C A;  2BBK H;  3N0E A;  5CYK B;  3B7F A;  3UVL A;  3E0C A;  4CZX A;  4EWR A;  2I0S A;  1R5M A;  3EI1 A;  3IJC A;  3I89 A;  3I7N A;  4J77 A;  5H1M A;  3PVU B;  5EM2 A;  5CXB A;  4LGN A;  2OK4 A;  2H14 A;  4PBZ A;  2H6N A;  3AFC A;  4N14 A;  4A09 A;  4CI1 A;  3PVW B;  4ES0 A;  1N6E A;  3FRX A;  3OKY B;  2H13 A;  4L1Q D;  3AH8 B;  3I7H A;  2B4E A;  3C99 A;  1XHM A;  4BH6 A;  2YB8 B;  1JMZ B;  4JXM A;  2P9N C;  4JSN C;  3I8E A;  3PSL A;  4JSX C;  4GGA A;  5EMM B;  4FA5 D;  5GXI A;  2H6K A;  2XL3 A;  1JOF A;  2BCJ B;  4GM9 A;  2H3X A;  1GOT B;  1TYQ C;  2CO0 C;  2UZX B;  1PBY B;  2W18 A;  4GQ2 P;  4J8G A;  1K8K C;  5HE0 B;  3I2N A;  4O3T B;  4AEZ A;  5FLX g;  3SLE D;  3MMY A;  2CNX A;  1TBG A;  2OIZ A;  4JD2 C;  5FQD A;  4ERZ A;  4CI8 A;  1Q47 A;  3SBR A;  3SN6 B;  4A0A A;  2B5M A;  2PM7 B;  4CC9 A;  2P9S C;  3MZL A;  4O45 A;  2TRC B;  4J78 A;  2Z2O A;  2HES X;  4Y7R A;  4K3J B;  4JT5 C;  4BUJ C;  4HDJ A;  2IUQ A;  3I7O A;  4GQ1 A;  5EAM A;  5FKS A;  4FAV D;  1XKS A;  5HE2 B;  5I5I A;  3GRE A;  3JB9 L;  4GZ8 A;  2QXV A;  4U1E I;  2P9L C;  2XYI A;  3DSM A;  4XYH A;  4E54 A;  4I79 A;  4FAN D;  3L4O D;  3VH0 A;  3AL9 A;  3K26 A;  4JSP C;  4MK0 B;  2PM6 B;  3RFH A;  3EI4 A;  2YNP A;  4NSX A;  4A0B A;  4FB1 D;  1SQ9 A;  2OVR B;  5JWZ A;  1XIP A;  1JJU B;  4FHL A;  2I0T A;  3KRW B;  2P9U C;  4ZOX A;  5IC7 A;  5B4W A;  2PM9 B;  3JRO A;  3RN0 D;  2P9P C;  3J81 g;  4A11 B;  5H17 A;  3PXT D;  1GP2 B;  4J73 A;  4PNK B;  4J0W A;  4J87 A;  4A7J A;  4ZOY A;  2PBI B;  3W15 A;  4X63 B;  3P4F A;  4A2M A;  1S4U X;  4QRJ A;  3JRP A;  2H9N A;  3VA6 A;  3SVW D;  3JAM g;  4QT8 A;  4J82 A;  2J55 H;  3C9C A;  2J57 G;  2UZY B;  3AL8 A;  3OL2 B;  2B5N A;  4BL0 A;  4CY3 A;  3UVM A;  4E5Z B;  1YFQ A;  2AGZ A;  3BG0 A;  3F3F A;  4JSV C;  4YVD A;  3IJ0 A;  3PXW D;  1MG2 A;  3I7K A;  4A08 B;  2HKM A;  4GMB A;  2CE8 A;  3A0F A;  5EAP A;  4OWR A;  4H5I A;  5HQG A;  3FGB A;  4GM3 A;  3SCY A;  3OKT A;  3PSC B;  2Z2P A;  3CFS B;  4PXW A;  1B9X A;  2HJB A;  4L3H D;  1PI6 A;  5AFU 3;  2AQ5 A;  3RSE C;  3JZG A;  2OK6 A;  5CXC B;  4ERY A;  5HE3 B;  3EI2 A;  2H9P A;  5EAL A;  2CE9 A;  3EI3 B;  2H6Q A;  4XYI A;  5TEE A;  5TEF A;  2G9A A;  4FWW A;  3EI1 B;  4ZOZ A;  3JZH A;  4CI3 A;  2MTA H;  2HKR A;  2HXC A;  1L0Q A;  5CXB B;  5EM2 B;  3EWE A;  2AH0 A;  5CYK A;  1P22 A;  4ZOV A;  3CFV A;  5I5J A;  5TF2 A;  4A09 B;  3V7D B;  3L4M D;  5GXH A;  3MZK A;  3DXM C;  3SMR A;  3F3G A;  3JZN A;  4PBY A;  4CY2 A;  4J81 A;  3EG6 A;  3OKY A;  1GXR A;  3NVX A;  2AGL A;  3OW8 A;  4GQB B;  1RI6 A;  2CN2 A;  5FA5 B;  4ERQ A;  1VYH C;  4G56 B;  4XEI C;  5IJ7 E;  3I7L A;  5EML B;  5K19 A;  3UKU C;  4CZY A;  4IMM A;  3RLM D;  4A2L A;  5C2V B;  5IJ8 E;  4X3E A;  1GG2 B;  4FA4 D;  5C9Z B;  5IT9 g;  4ZN4 A;  2G99 A;  3UR4 A;  1ERJ A;  5GMK n;  5IGO A;  5HE1 B;  1K32 A;  3K27 A;  2YNO A;  4H5J A;  3MKS B;  3NVQ A;  5AJA A;  4GM8 A;  2XL2 A;  3IKO A;  5FKR A;  2YMU A;  4AOW A;  2IUP A;  4KFM B;  3PE7 A;  4TZ4 A;  5THA A;  2GNQ A;  1A0R B;  5IGQ A;  3RMZ D;  2O9K A;  3NVN A;  2H47 A;  2OVQ B;  3U4Y A;  4A0A B;  2AGX A;  4LG8 A;  4FA1 D;  4PSX B;  3OTT A;  1U2V C;  3SJL D;  4JT6 C;  4O1Q D;  2B5L A;  5EMJ B;  2CN3 A;  5SXM A;  5GSA A;  4PSW B;  5KDO B;  5K1C C;  1N6D A;  3JPX A;  3CIK B;  3DXK C;  2P9I C;  2GC4 A;  3RRM C;  3ULE C;  2H9L A;  4GGD A;  1PGU A;  1OLZ A;  4E54 B;  3KRX B;  3SWS D;  4QQE A;  2H9M A;  2OVP B;  3EMH A;  1FWX A;  3IIY A;  5EMK B;  4IA9 A;  1JMX B;  3UVO A;  4LG9 A;  3UVK A;  4D6V A;  5FKQ A;  1NR0 A;  3OKW A;  3SBQ A;  3EI4 B;  1NEX B;  4A0B B;  4J86 A;  2EBS A;  2AGY A;  2P9K C;  3DWL C;  2GC7 A;  3GFC A;  3EU7 A;  2QC5 A;  4J79 A;  4X61 B;  4CY1 A;  3BWS A;  4R7A B;  3BG1 A;  2CO0 A;  4CI2 A;  3C5M A;  1U4C A; 
#chains in the Genus database with same CATH topology
 2YBA A;  2J56 H;  1B9Y A;  2Q7Q A;  4ESG A;  1JTD B;  3DM0 A;  2I3S A;  2I0R A;  4J0X A;  4L1M A;  1N6F A;  3UKR C;  5C2W B;  4L9O A;  2PM9 A;  3GD1 I;  3V5W B;  2IWF A;  4BP9 A;  5HYN B;  4A11 A;  3SBP A;  3FM0 A;  1OMW B;  5EAR A;  3J80 g;  3RFG A;  2XU7 A;  3GC3 B;  3ORV D;  4NC4 A;  3V9F A;  3HFQ A;  2IUV A;  5AMS A;  3ODT A;  4QL1 A;  2QR5 A;  2IWK A;  3AL8 B;  4MMY A;  4K3I D;  4FA9 D;  3MKQ A;  4JHP C;  4U7A A;  1PEV A;  4O9D A;  3MXX A;  4GGC A;  4CY5 A;  2AH1 A;  1QNI A;  4D0K A;  3OL2 A;  3N0D A;  4E5Z A;  5FXY A;  2YNN A;  2HU8 A;  1MG3 A;  4X60 B;  2I3T A;  4BP8 A;  2H68 A;  1U8C A;  3SHF A;  4J8B A;  5I5M A;  3I7P A;  3ZE0 A;  1SQJ A;  2IUR A;  3VGZ A;  3IIW A;  2EIC A;  4A08 A;  3VI3 A;  4Z7O A;  2HJ4 A;  2Z2N A;  3IJ1 A;  3SFZ A;  4CZV A;  4Z8L A;  1A12 A;  5FKT A;  3F3P A;  4DNW A;  3KCI A;  4Y5R D;  1MDA H;  4O3U B;  5C92 A;  5A2Q g;  3UVN A;  2IAA A;  3RN1 D;  3ZWL B;  3ZDZ A;  3IUR A;  5H14 A;  1QFS A;  1L5G A;  3EI2 B;  4UI9 R;  2HYE A;  1VZ3 A;  2XE4 A;  3VI4 A;  4OZU A;  3SXT D;  5CXC A;  3C75 H;  4J84 A;  3O4J A;  2AGW A;  2OJY A;  3PXS D;  5TDH B;  4L3G D;  4PC0 A;  3EI3 A;  1SHY B;  3DDU A;  3I8C A;  4AMY A;  2BBK H;  3N0E A;  5CYK B;  3B7F A;  5M5R A;  3UVL A;  3E0C A;  4CZX A;  4EWR A;  2I0S A;  1GOF A;  1R5M A;  3IJC A;  3EI1 A;  3I89 A;  3I7N A;  4J77 A;  5H1M A;  3PVU B;  5EM2 A;  5CXB A;  4LGN A;  1O6G A;  4BCD A;  2OK4 A;  2JKX A;  2H14 A;  4PBZ A;  2H6N A;  1H2Y A;  3AFC A;  4N14 A;  4A09 A;  4CI1 A;  3PVW B;  4ES0 A;  1N6E A;  3FRX A;  4G55 A;  3OKY B;  2H13 A;  4L1Q D;  2VDP A;  1UOO A;  5FFO A;  3AH8 B;  3I7H A;  2B4E A;  3C99 A;  1XHM A;  2VC2 A;  4BH6 A;  2YB8 B;  1JMZ B;  4JXM A;  2P9N C;  4JSN C;  1H2W A;  3ZE2 A;  3I8E A;  4DNV A;  3PSL A;  2EID A;  4JSX C;  4GGA A;  5EMM B;  3FCS A;  4FA5 D;  5GXI A;  2H6K A;  3IVM A;  2XL3 A;  1JOF A;  2BCJ B;  3EQ9 A;  4GM9 A;  1C9L A;  2H3X A;  4RE5 A;  1GOT B;  1TYQ C;  2CO0 C;  3K6S A;  4WK2 A;  2UZX B;  1PBY B;  1UTC A;  2W18 A;  4GQ2 P;  4J8G A;  3V4V A;  1K8K C;  5HE0 B;  3I2N A;  3NIG A;  4O3T B;  4AEZ A;  3V4P A;  3SLE D;  5FLX g;  3MMY A;  2CNX A;  1TBG A;  2OIZ A;  4JD2 C;  5FQD A;  5HDB A;  4ERZ A;  4CI8 A;  5M5T A;  4O2W A;  1Q47 A;  2VDK A;  3SBR A;  3IUL A;  3SN6 B;  4A0A A;  2B5M A;  2PM7 B;  3IUJ A;  4CC9 A;  2EIE A;  2P9S C;  1C9I A;  3MZL A;  1VE6 A;  4O45 A;  2TRC B;  4MMZ A;  4J78 A;  4G1M A;  2Z2O A;  2HES X;  2VDM A;  4Y7R A;  4K3J B;  3ZDX A;  4JT5 C;  4BUJ C;  4HDJ A;  3NIF A;  2IUQ A;  4WK4 A;  3I7O A;  4GQ1 A;  5EAM A;  5FKS A;  4FAV D;  1XKS A;  5HE2 B;  5I5I A;  3GRE A;  3JB9 L;  4GZ8 A;  2QXV A;  1UOP A;  4U1E I;  2P9L C;  2XYI A;  5FFG A;  4D9S A;  3DSM A;  4XYH A;  4E54 A;  4I79 A;  5E6R A;  4FAN D;  5M5U A;  3L4O D;  3VH0 A;  3AL9 A;  3EQ7 A;  3K26 A;  4JSP C;  4MK0 B;  2PM6 B;  2VDO A;  5E6U A;  3RFH A;  3EI4 A;  2YNP A;  4NSX A;  4A0B A;  1UOQ A;  4FB1 D;  1E8M A;  1SQ9 A;  2OVR B;  5JWZ A;  1XIP A;  1JJU B;  4FHL A;  2I0T A;  3KRW B;  2P9U C;  4BCC A;  4ZOX A;  5IC7 A;  5B4W A;  2PM9 B;  3JRO A;  3RN0 D;  2P9P C;  3J81 g;  4A11 B;  5H17 A;  3PXT D;  1GP2 B;  4J73 A;  4PNK B;  1QFM A;  4J0W A;  4J87 A;  3OF7 A;  4A7J A;  4ZOY A;  2PBI B;  3W15 A;  4X63 B;  3P4F A;  4A2M A;  1S4U X;  4QRJ A;  3K72 A;  3JRP A;  2H9N A;  3VA6 A;  3SVW D;  3JAM g;  4QT8 A;  4J82 A;  2J55 H;  2VDL A;  3C9C A;  3IUM A;  2J57 G;  2UZY B;  3AL8 A;  3OL2 B;  2B5N A;  4BL0 A;  1GOH A;  3UVM A;  4CY3 A;  4E5Z B;  1YFQ A;  3ZE1 A;  3K71 A;  2AGZ A;  3BG0 A;  4G1E A;  3F3F A;  4JSV C;  4YVD A;  3IJ0 A;  3PXW D;  3O4G A;  1MG2 A;  3I7K A;  3T3M A;  4A08 B;  2HKM A;  4GMB A;  2CE8 A;  3A0F A;  5EAP A;  3FCU A;  4OWR A;  4H5I A;  5HQG A;  3FGB A;  4GM3 A;  3SCY A;  2EIB A;  3OKT A;  3PSC B;  2Z2P A;  3CFS B;  4MMX A;  4QAM A;  4PXW A;  1BPO A;  1B9X A;  2VDR A;  2HJB A;  5M61 A;  4L3H D;  1PI6 A;  5AFU 3;  2AQ5 A;  3RSE C;  3JZG A;  2OK6 A;  4UM9 A;  3O4H A;  3IJE A;  5CXC B;  4ERY A;  2VDN A;  5M5S A;  5HE3 B;  3EI2 A;  2H9P A;  5EAL A;  2CE9 A;  3EI3 B;  2H6Q A;  4XYI A;  5TEE A;  5TEF A;  1TYE A;  2G9A A;  4FWW A;  2VZ3 A;  3EI1 B;  5C86 A;  4ZOZ A;  3JZH A;  4CI3 A;  2MTA H;  1YR2 A;  2HKR A;  1L0Q A;  2HXC A;  5CXB B;  3EWE A;  5EM2 B;  2AH0 A;  5CYK A;  1P22 A;  1VZ2 A;  4NEN A;  4ZOV A;  3CFV A;  5I5J A;  5TF2 A;  4A09 B;  3V7D B;  3L4M D;  4BCB A;  5GXH A;  5E6S A;  3MZK A;  3DXM C;  4IRZ A;  3SMR A;  1JV2 A;  3F3G A;  3IUN A;  3JZN A;  4PBY A;  4CY2 A;  4J81 A;  3EG6 A;  4WK0 A;  3OKY A;  3IUQ A;  1GXR A;  3NVX A;  2AGL A;  3O4I A;  3OW8 A;  4GQB B;  1RI6 A;  2CN2 A;  5FA5 B;  4ERQ A;  4RE6 A;  1E8N A;  1VYH C;  1O6F A;  2VZ1 A;  3QHY B;  4G56 B;  4XEI C;  4DNU A;  5IJ7 E;  3I7L A;  5EML B;  5K19 A;  3MUN A;  3UKU C;  4CZY A;  4IMM A;  3RLM D;  4A2L A;  5C2V B;  5IJ8 E;  4X3E A;  1H2Z A;  1GG2 B;  4FA4 D;  5C9Z B;  5IT9 g;  4ZN4 A;  2G99 A;  3UR4 A;  1ERJ A;  5GMK n;  5IGO A;  5HE1 B;  1VE7 A;  1K32 A;  3K27 A;  2YNO A;  4H5J A;  3MKS B;  3NVQ A;  5AJA A;  4GM8 A;  2XL2 A;  3IKO A;  5FKR A;  2YMU A;  4AOW A;  2IUP A;  4KFM B;  3PE7 A;  4TZ4 A;  4WJK A;  1T2X A;  5THA A;  2GNQ A;  1A0R B;  5IGQ A;  3RMZ D;  2VDQ A;  4AN1 A;  2O9K A;  3NVN A;  2H47 A;  2OVQ B;  3U4Y A;  4A0A B;  4UM8 A;  2AGX A;  1K3I A;  4LG8 A;  4FA1 D;  4PSX B;  3OTT A;  1U2V C;  3SJL D;  4JT6 C;  4O1Q D;  2B5L A;  5EMJ B;  2CN3 A;  5SXM A;  5GSA A;  2BKL A;  4PSW B;  4O02 A;  2XZG A;  5KDO B;  4Z7N A;  5K1C C;  1N6D A;  3JPX A;  3CIK B;  1H2X A;  2P9I C;  3DXK C;  2WQ8 A;  3MUO A;  2GC4 A;  4JHN A;  3RRM C;  3ULE C;  2H9L A;  4GGD A;  1GOG A;  4Z7Q A;  1PGU A;  4AN0 A;  5M5V A;  3MVD K;  1M1X A;  4NAA A;  1OLZ A;  4NBM A;  4E54 B;  3QI0 A;  1I2M B;  4AMZ A;  3EQ8 A;  3KRX B;  3SWS D;  4QQE A;  2H9M A;  2OVP B;  3EMH A;  3NID A;  1FWX A;  3IIY A;  5EMK B;  4IA9 A;  1JMX B;  2HU5 A;  3UVO A;  4LG9 A;  3UVK A;  1E5T A;  4D6V A;  5FKQ A;  1NR0 A;  3OKW A;  3SBQ A;  3EI4 B;  1NEX B;  4A0B B;  4J86 A;  2EBS A;  2AGY A;  2P9K C;  3T3P A;  3DWL C;  2XDW A;  4AX4 A;  2GC7 A;  2HU7 A;  3GFC A;  3EU7 A;  2QC5 A;  4J79 A;  4X61 B;  4CY1 A;  3BWS A;  4R7A B;  3BG1 A;  2QZP A;  2CO0 A;  4CI2 A;  3ZDY A;  3C5M A;  1U4C A; 
#chains in the Genus database with same CATH homology
 2YBA A;  2J56 H;  1B9Y A;  2Q7Q A;  4ESG A;  3DM0 A;  2I3S A;  2I0R A;  4J0X A;  3UKR C;  1N6F A;  5C2W B;  4L9O A;  2PM9 A;  3V5W B;  2IWF A;  5HYN B;  4A11 A;  3SBP A;  3FM0 A;  1OMW B;  5EAR A;  3J80 g;  3RFG A;  2XU7 A;  3ORV D;  3V9F A;  3HFQ A;  2IUV A;  5AMS A;  3ODT A;  4QL1 A;  2IWK A;  3AL8 B;  4K3I D;  4FA9 D;  3MKQ A;  4U7A A;  1PEV A;  4O9D A;  3MXX A;  4GGC A;  4CY5 A;  2AH1 A;  1QNI A;  4D0K A;  3OL2 A;  3N0D A;  4E5Z A;  5FXY A;  2YNN A;  1MG3 A;  4X60 B;  2I3T A;  2H68 A;  3SHF A;  4J8B A;  5I5M A;  3I7P A;  1SQJ A;  2IUR A;  3VGZ A;  3IIW A;  4A08 A;  2HJ4 A;  2Z2N A;  3IJ1 A;  3SFZ A;  4CZV A;  4Z8L A;  5FKT A;  3F3P A;  4Y5R D;  1MDA H;  4O3U B;  5A2Q g;  3UVN A;  2IAA A;  3RN1 D;  3ZWL B;  5H14 A;  3EI2 B;  4UI9 R;  2HYE A;  4OZU A;  3SXT D;  5CXC A;  3C75 H;  4J84 A;  3PXS D;  2AGW A;  2OJY A;  5TDH B;  4L3G D;  4PC0 A;  3EI3 A;  1SHY B;  3I8C A;  2BBK H;  3N0E A;  5CYK B;  3B7F A;  3UVL A;  3E0C A;  4CZX A;  4EWR A;  2I0S A;  1R5M A;  3EI1 A;  3IJC A;  3I89 A;  3I7N A;  4J77 A;  5H1M A;  3PVU B;  5EM2 A;  5CXB A;  4LGN A;  2OK4 A;  2H14 A;  4PBZ A;  2H6N A;  3AFC A;  4N14 A;  4A09 A;  4CI1 A;  3PVW B;  4ES0 A;  1N6E A;  3FRX A;  3OKY B;  2H13 A;  4L1Q D;  3AH8 B;  3I7H A;  2B4E A;  3C99 A;  1XHM A;  4BH6 A;  2YB8 B;  1JMZ B;  4JXM A;  2P9N C;  4JSN C;  3I8E A;  3PSL A;  4JSX C;  4GGA A;  5EMM B;  4FA5 D;  5GXI A;  2H6K A;  2XL3 A;  1JOF A;  2BCJ B;  4GM9 A;  2H3X A;  1GOT B;  1TYQ C;  2CO0 C;  2UZX B;  1PBY B;  2W18 A;  4GQ2 P;  4J8G A;  1K8K C;  5HE0 B;  3I2N A;  4O3T B;  4AEZ A;  5FLX g;  3SLE D;  3MMY A;  2CNX A;  1TBG A;  2OIZ A;  4JD2 C;  5FQD A;  4ERZ A;  4CI8 A;  1Q47 A;  3SBR A;  3SN6 B;  4A0A A;  2B5M A;  2PM7 B;  4CC9 A;  2P9S C;  3MZL A;  4O45 A;  2TRC B;  4J78 A;  2Z2O A;  2HES X;  4Y7R A;  4K3J B;  4JT5 C;  4BUJ C;  4HDJ A;  2IUQ A;  3I7O A;  4GQ1 A;  5EAM A;  5FKS A;  4FAV D;  1XKS A;  5HE2 B;  5I5I A;  3GRE A;  3JB9 L;  4GZ8 A;  2QXV A;  4U1E I;  2P9L C;  2XYI A;  3DSM A;  4XYH A;  4E54 A;  4I79 A;  4FAN D;  3L4O D;  3VH0 A;  3AL9 A;  3K26 A;  4JSP C;  4MK0 B;  2PM6 B;  3RFH A;  3EI4 A;  2YNP A;  4NSX A;  4A0B A;  4FB1 D;  1SQ9 A;  2OVR B;  5JWZ A;  1XIP A;  1JJU B;  4FHL A;  2I0T A;  3KRW B;  2P9U C;  4ZOX A;  5IC7 A;  5B4W A;  2PM9 B;  3JRO A;  3RN0 D;  2P9P C;  3J81 g;  4A11 B;  5H17 A;  3PXT D;  1GP2 B;  4J73 A;  4PNK B;  4J0W A;  4J87 A;  4A7J A;  4ZOY A;  2PBI B;  3W15 A;  4X63 B;  3P4F A;  4A2M A;  1S4U X;  4QRJ A;  3JRP A;  2H9N A;  3VA6 A;  3SVW D;  3JAM g;  4QT8 A;  4J82 A;  2J55 H;  3C9C A;  2J57 G;  2UZY B;  3AL8 A;  3OL2 B;  2B5N A;  4BL0 A;  4CY3 A;  3UVM A;  4E5Z B;  1YFQ A;  2AGZ A;  3BG0 A;  3F3F A;  4JSV C;  4YVD A;  3IJ0 A;  3PXW D;  1MG2 A;  3I7K A;  4A08 B;  2HKM A;  4GMB A;  2CE8 A;  3A0F A;  5EAP A;  4OWR A;  4H5I A;  5HQG A;  3FGB A;  4GM3 A;  3SCY A;  3OKT A;  3PSC B;  2Z2P A;  3CFS B;  4PXW A;  1B9X A;  2HJB A;  4L3H D;  1PI6 A;  5AFU 3;  2AQ5 A;  3RSE C;  3JZG A;  2OK6 A;  5CXC B;  4ERY A;  5HE3 B;  3EI2 A;  2H9P A;  5EAL A;  2CE9 A;  3EI3 B;  2H6Q A;  4XYI A;  5TEE A;  5TEF A;  2G9A A;  4FWW A;  3EI1 B;  4ZOZ A;  3JZH A;  4CI3 A;  2MTA H;  2HKR A;  2HXC A;  1L0Q A;  5CXB B;  5EM2 B;  3EWE A;  2AH0 A;  5CYK A;  1P22 A;  4ZOV A;  3CFV A;  5I5J A;  5TF2 A;  4A09 B;  3V7D B;  3L4M D;  5GXH A;  3MZK A;  3DXM C;  3SMR A;  3F3G A;  3JZN A;  4PBY A;  4CY2 A;  4J81 A;  3EG6 A;  3OKY A;  1GXR A;  3NVX A;  2AGL A;  3OW8 A;  4GQB B;  1RI6 A;  2CN2 A;  5FA5 B;  4ERQ A;  1VYH C;  4G56 B;  4XEI C;  5IJ7 E;  3I7L A;  5EML B;  5K19 A;  3UKU C;  4CZY A;  4IMM A;  3RLM D;  4A2L A;  5C2V B;  5IJ8 E;  4X3E A;  1GG2 B;  4FA4 D;  5C9Z B;  5IT9 g;  4ZN4 A;  2G99 A;  3UR4 A;  1ERJ A;  5GMK n;  5IGO A;  5HE1 B;  1K32 A;  3K27 A;  2YNO A;  4H5J A;  3MKS B;  3NVQ A;  5AJA A;  4GM8 A;  2XL2 A;  3IKO A;  5FKR A;  2YMU A;  4AOW A;  2IUP A;  4KFM B;  3PE7 A;  4TZ4 A;  5THA A;  2GNQ A;  1A0R B;  5IGQ A;  3RMZ D;  2O9K A;  3NVN A;  2H47 A;  2OVQ B;  3U4Y A;  4A0A B;  2AGX A;  4LG8 A;  4FA1 D;  4PSX B;  3OTT A;  1U2V C;  3SJL D;  4JT6 C;  4O1Q D;  2B5L A;  5EMJ B;  2CN3 A;  5SXM A;  5GSA A;  4PSW B;  5KDO B;  5K1C C;  1N6D A;  3JPX A;  3CIK B;  3DXK C;  2P9I C;  2GC4 A;  3RRM C;  3ULE C;  2H9L A;  4GGD A;  1PGU A;  1OLZ A;  4E54 B;  3KRX B;  3SWS D;  4QQE A;  2H9M A;  2OVP B;  3EMH A;  1FWX A;  3IIY A;  5EMK B;  4IA9 A;  1JMX B;  3UVO A;  4LG9 A;  3UVK A;  4D6V A;  5FKQ A;  1NR0 A;  3OKW A;  3SBQ A;  3EI4 B;  1NEX B;  4A0B B;  4J86 A;  2EBS A;  2AGY A;  2P9K C;  3DWL C;  2GC7 A;  3GFC A;  3EU7 A;  2QC5 A;  4J79 A;  4X61 B;  4CY1 A;  3BWS A;  4R7A B;  3BG1 A;  2CO0 A;  4CI2 A;  3C5M A;  1U4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...