2GNQA

Structure of wdr5
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
324
structure length
316
Chain Sequence
b'EAARAQPTKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
molecule tags Transcription
source organism Homo sapiens
publication title Structural basis for molecular recognition and presentation of histone H3 By WDR5.
pubmed doi rcsb
total genus 105
structure length 316
sequence length 324
ec nomenclature
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2gnqA00
5JWZA 2IUPA 2I0SA 4J82A 4CZXA 4GM3A 2I0TA 4CZVA 2PBIB 2OVQB 3EI4A 4O45A 3L4OD 5AMSA 5GMKn 1MG3A 3N0DA 3SWSD 3RMZD 3SLED 1B9XA 4ZN4A 2AH1A 3EI3A 3I7NA 4O3UB 3IIWA 3UVMA 5EAPA 3VH0A 4J84A 3SMRA 1SHYB 4GM9A 5IT9g 4K3ID 1R5MA 4GQBB 4GM8A 2AGZA 5HE3B 2Z2NA 2QXVA 4GGCA 2UZXB 5GSAA 5GXIA 3PVWB 5TEFA 5TDHB 4CI1A 4JD2C 3RLMD 1GP2B 2H13A 3I7OA 1XHMA 2B5NA 4D6VA 2J55H 3P4FA 3RN0D 3UVNA 1A0RB 1TBGA 2OK6A 4J81A 3NVNA 3F3GA 4ES0A 2XL3A 2YMUA 4ZOYA 5I5MA 2PM9B 2IURA 4JSXC 4UI9R 5FKTA 4LG8A 5EMMB 5THAA 3KRXB 2Z2PA 2B5LA 4JT5C 5EMKB 1OLZA 3ULEC 2BBKH 5A2Qg 2H9NA 4OWRA 2H9MA 2IAAA 3EI1B 3KRWB 2XL2A 5CYKB 4FAND 2H14A 4CY5A 5FQDA 2GC4A 2Q7QA 1U2VC 3DSMA 4G56B 4GQ2P 5EM2B 2GC7A 1N6FA 3IJ1A 3JAMg 2P9LC 3OKYB 2I3TA 2H6NA 4A0AB 1JJUB 5TF2A 3UKUC 4FAVD 5B4WA 4J77A 1MDAH 4J78A 3MXXA 4QT8A 5FKQA 2AH0A 4Y5RD 2AGYA 1JMZB 4PNKB 2CN3A 3UVKA 3I7PA 3MKQA 4O3TB 1TYQC 3PVUB 2P9SC 3CIKB 4Z8LA 5GXHA 2QC5A 4NSXA 4O1QD 2H9LA 5H1MA 3SBQA 3UVOA 3GREA 4A09B 1K32A 2CO0A 3SVWD 5FXYA 4HDJA 1GOTB 3OL2A 4ESGA 3JPXA 1P22A 4A08B 1JOFA 3SBPA 3HFQA 4E5ZB 3SN6B 4X63B 3AL8A 4AEZA 4FWWA 3BG1A 3EG6A 2P9NC 3SHFA 3C75H 2EBSA 5K1CC 4A11A 2YB8B 4E54A 1S4UX 3C9CA 3F3FA 3RSEC 4PXWA 1ERJA 1RI6A 2PM7B 4BUJC 3JROA 2H68A 4XYHA 5H17A 4GZ8A 5EARA 2H9PA 3FRXA 4A0AA 5IJ8E 2Z2OA 5C2WB 2AGWA 3OKYA 3OL2B 3OTTA 5HE0B 3FGBA 4CY1A 3GFCA 3PE7A 4PBYA 3U4YA 2TRCB 5EMJB 4JXMA 4H5IA 3NVQA 3MZLA 2XYIA 2OVRB 4J8BA 4J0WA 2I0RA 2MTAH 1SQ9A 2G9AA 4L1QD 2AQ5A 3BWSA 2O9KA 3I7KA 4XYIA 3W15A 4U1EI 4J73A 3FM0A 4GMBA 1N6EA 4A08A 4PSWB 4ERQA 1K8KC 3I2NA 2YNPA 4A7JA 4D0KA 4PSXB 3UVLA 4BH6A 4MK0B 3N0EA 3VA6A 2YBAA 3EI2B 2IUQA 3C5MA 4FB1D 2P9KC 2GNQA 2YNOA 4FHLA 4X60B 3SCYA 4CI2A 5FA5B 4I79A 3OKTA 2CO0C 5AJAA 4BL0A 3MZKA 4X3EA 3I89A 4LG9A 3AFCA 3MMYA 3CFSB 2OK4A 3JRPA 5IGQA 5FKSA 4A2LA 5HYNB 4GGAA 1JMXB 5C2VB 4K3JB 3NVXA 4J0XA 4YVDA 4L3HD 4N14A 5I5IA 5CXCA 3RFGA 2CN2A 3I7HA 4GQ1A 4FA5D 5IGOA 3I8CA 5HE2B 1QNIA 5EM2A 4JSNC 2HKRA 1U4CA 3SXTD 3RRMC 3V9FA 2AGLA 2H47A 5AFU3 3BG0A 1NR0A 1PGUA 5CXBA 2J57G 3DXKC 4CI3A 3UR4A 4IMMA 3EWEA 4PBZA 4L9OA 4JT6C 5C9ZB 2HKMA 2W18A 3OKWA 4CC9A 4ZOXA 1SQJA 2H6KA 3CFVA 1N6DA 3B7FA 1YFQA 3F3PA 2OVPB 2CE8A 2OJYA 3ZWLB 5SXMA 1PEVA 3SBRA 2I3SA 3EI3B 3UKRC 2PM9A 3A0FA 1L0QA 4L3GD 1PBYB 2HJBA 4A11B 3PSCB 5EALA 4LGNA 4CZYA 3J81g 1MG2A 5CXCB 2HXCA 2AGXA 3EI4B 3JB9L 4J79A 2B4EA 4J87A 4JSVC 4H5JA 3ORVD 1GXRA 2YNNA 1VYHC 1FWXA 1XKSA 3PXTD 5I5JA 4QQEA 4A0BB 4CY3A 4ZOVA 4FA4D 4XEIC 3DM0A 2J56H 4TZ4A 3L4MD 3SFZA 3JZNA 3OW8A 4J8GA 4Y7RA 3RN1D 4CY2A 3VGZA 4A09A 4CI8A 4QL1A 3EU7A 5HQGA 4QRJA 4ERYA 4FA9D 4E54B 3DXMC 2P9IC 4J86A 4A0BA 5FLXg 4JSPC 2HYEA 2IUVA 4X61B 5EMLB 2UZYB 2IWFA 2BCJB 3RFHA 5IJ7E 1NEXB 3SJLD 2XU7A 2B5MA 3V5WB 3PSLA 5CXBB 4E5ZA 2HESX 3JZHA 3K26A 2G99A 3C99A 2OIZA 4OZUA 3E0CA 5IC7A 5H14A 5TEEA 3K27A 5KDOB 3AL9A 4PC0A 3IIYA 5K19A 4ZOZA 5FKRA 3MKSB 5HE1B 3ODTA 3EMHA 5CYKA 2P9UC 4O9DA 1Q47A 3IJ0A 4ERZA 1GG2B 3V7DB 2H3XA 4A2MA 4U7AA 3I8EA 2HJ4A 1B9YA 4AOWA 3JZGA 4EWRA 1PI6A 3PXWD 2IWKA 2CE9A 2P9PC 3EI2A 3I7LA 3IJCA 4IA9A 2PM6B 4FA1D 1XIPA 3IKOA 3EI1A 2CNXA 2H6QA 4KFMB 3DWLC 4R7AB 5EAMA 3AH8B 1OMWB 3PXSD 3AL8B 3J80g 4GGDA
chains in the Genus database with same CATH superfamily
4NENA 5JWZA 2IUPA 2I0SA 4J82A 3IJEA 4CZXA 4Z7NA 2HU7A 2I0TA 4GM3A 4CZVA 2PBIB 2OVQB 3EI4A 4O45A 4WJKA 3L4OD 5AMSA 5GMKn 4AX4A 1MG3A 3FCSA 3N0DA 3SWSD 5FFGA 4O02A 3RMZD 3SLED 1B9XA 4ZN4A 2AH1A 3EI3A 4BP9A 1VZ2A 3I7NA 4O3UB 3IIWA 3UVMA 5EAPA 3VH0A 4J84A 3SMRA 1SHYB 4GM9A 4JHPC 5IT9g 3DDUA 4K3ID 1R5MA 4GQBB 4GM8A 1GOHA 2AGZA 5HE3B 2Z2NA 4NC4A 3OF7A 2QXVA 4GGCA 2UZXB 5GSAA 4UM8A 5M61A 5GXIA 3PVWB 5TEFA 4AMZA 5TDHB 4CI1A 4JD2C 3NIDA 2EICA 3RLMD 1GP2B 1K3IA 2H13A 3I7OA 1XHMA 2B5NA 4D6VA 2J55H 3P4FA 3RN0D 3UVNA 1A0RB 1TBGA 2EIEA 2OK6A 4J81A 3NVNA 3F3GA 4ES0A 2XL3A 2YMUA 4ZOYA 5I5MA 2PM9B 1GOGA 2IURA 4RE6A 4JSXC 4Z7OA 4UI9R 5FKTA 4LG8A 5EMMB 2EIDA 3ZE2A 5THAA 3KRXB 1TYEA 2Z2PA 2B5LA 4JT5C 5EMKB 1OLZA 3ULEC 2BBKH 5A2Qg 2H9NA 4OWRA 2H9MA 1T2XA 1A12A 2IAAA 3IUQA 3EI1B 5M5UA 3KRWB 2XL2A 5CYKB 4FAND 2H14A 5HDBA 4CY5A 5FQDA 2GC4A 2Q7QA 1U2VC 3DSMA 1QFSA 2HU5A 4G56B 4GQ2P 5EM2B 2GC7A 1N6FA 3IJ1A 3JAMg 2P9LC 3OKYB 2I3TA 4UM9A 2H6NA 4A0AB 1JJUB 5TF2A 3UKUC 4FAVD 3EQ9A 3K71A 1E8MA 5B4WA 1H2XA 4J77A 1MDAH 3KCIA 4J78A 3MXXA 4QT8A 5FKQA 4DNVA 2AH0A 4MMZA 2AGYA 4Y5RD 1JMZB 4PNKB 2CN3A 3UVKA 3I7PA 3MKQA 4O3TB 1TYQC 3PVUB 2P9SC 3CIKB 4Z8LA 5GXHA 2QC5A 1JV2A 4NSXA 4O1QD 2H9LA 5H1MA 3SBQA 3UVOA 3GREA 4A09B 2VC2A 1K32A 2VDRA 1E8NA 2CO0A 2VDLA 5FXYA 3SVWD 4HDJA 5M5VA 1GOTB 3OL2A 4ESGA 3JPXA 1P22A 4BP8A 2QZPA 4A08B 1JOFA 3SBPA 4G1EA 3HFQA 5C92A 3MVDK 4E5ZB 3SN6B 1UOQA 4X63B 3AL8A 4MMXA 4AEZA 4FWWA 3BG1A 5E6SA 4NAAA 3K6SA 3EG6A 2P9NC 3SHFA 3C75H 4WK0A 2EBSA 5K1CC 4A11A 2YB8B 4E54A 4MMYA 2WQ8A 3ZDYA 5E6UA 1S4UX 3C9CA 3F3FA 3O4JA 3RSEC 4PXWA 3T3MA 1ERJA 1RI6A 2PM7B 2VDQA 3JROA 4BUJC 2H68A 4XYHA 5H17A 4L1MA 4GZ8A 1U8CA 5C86A 5EARA 2H9PA 3FRXA 3NIGA 4AMYA 4A0AA 5IJ8E 2Z2OA 5C2WB 2AGWA 3OKYA 3OL2B 3OTTA 5HE0B 3FGBA 4CY1A 3GFCA 3PE7A 5E6RA 4PBYA 3U4YA 2TRCB 5EMJB 4JXMA 4H5IA 3NVQA 3MZLA 3IUMA 2XYIA 2OVRB 4J8BA 4J0WA 2I0RA 2MTAH 2EIBA 2XZGA 3GC3B 1SQ9A 2G9AA 4L1QD 2AQ5A 3BWSA 2O9KA 3I7KA 4XYIA 3W15A 4U1EI 1E5TA 1M1XA 2VDMA 4J73A 5M5TA 3FM0A 4GMBA 1H2WA 1N6EA 4A08A 4PSWB 4ERQA 5FFOA 3T3PA 1K8KC 3I2NA 2YNPA 3IUNA 4A7JA 4D0KA 2BKLA 4PSXB 3UVLA 4MK0B 4BH6A 2VDOA 3N0EA 3VA6A 2YBAA 3EI2B 2IUQA 3C5MA 4FB1D 2P9KC 2GNQA 2YNOA 3IURA 4FHLA 4X60B 3SCYA 4CI2A 5FA5B 4I79A 3QI0A 1C9LA 4JHNA 3OKTA 2CO0C 5AJAA 4BL0A 3IULA 3MZKA 4X3EA 3I89A 4LG9A 3O4IA 3AFCA 1H2ZA 1BPOA 3MMYA 3CFSB 2OK4A 3JRPA 5IGQA 5FKSA 4A2LA 5HYNB 4GGAA 3V4PA 3ZDZA 4D9SA 1JMXB 5C2VB 4K3JB 3NVXA 4J0XA 1O6FA 2QR5A 4YVDA 4L3HD 4N14A 5I5IA 4IRZA 1C9IA 5CXCA 3RFGA 2CN2A 3I7HA 4GQ1A 4FA5D 5IGOA 3I8CA 5HE2B 1QNIA 5EM2A 4JSNC 2HKRA 1U4CA 3SXTD 3RRMC 3V9FA 2AGLA 2H47A 5AFU3 3BG0A 3EQ7A 4Z7QA 2HU8A 3NIFA 1NR0A 1QFMA 1PGUA 5CXBA 2J57G 3DXKC 1L5GA 3IUJA 3UR4A 4IMMA 4CI3A 3EWEA 4PBZA 4L9OA 4JT6C 5C9ZB 2HKMA 3GD1I 2W18A 3OKWA 4CC9A 4ZOXA 3ZDXA 1SQJA 2H6KA 3CFVA 1N6DA 3B7FA 1YFQA 1JTDB 3F3PA 2OVPB 2CE8A 1VE7A 2OJYA 3ZWLB 5SXMA 1PEVA 3SBRA 1VE6A 2I3SA 3EI3B 3UKRC 2PM9A 4G55A 3A0FA 3IVMA 1L0QA 4L3GD 1UOOA 4BCDA 1PBYB 2HJBA 4A11B 3PSCB 5EALA 4LGNA 4CZYA 3J81g 1MG2A 5CXCB 1O6GA 2HXCA 2VDNA 1GOFA 2AGXA 3EI4B 3JB9L 4J79A 2B4EA 4J87A 4H5JA 4JSVC 3ORVD 1GXRA 2YNNA 5M5RA 1VYHC 1FWXA 1XKSA 3PXTD 5I5JA 4QQEA 3O4GA 4BCBA 4CY3A 4A0BB 4ZOVA 4FA4D 4XEIC 3DM0A 3MUNA 1H2YA 1UTCA 2J56H 4TZ4A 3L4MD 3SFZA 3JZNA 3OW8A 4J8GA 1I2MB 4Y7RA 3RN1D 4CY2A 3VGZA 4A09A 4CI8A 4QL1A 3EU7A 5HQGA 3V4VA 2VZ3A 4QRJA 4ERYA 4FA9D 4E54B 2VZ1A 3DXMC 2VDPA 2P9IC 4J86A 4A0BA 5FLXg 2XDWA 4JSPC 3VI4A 2HYEA 2IUVA 1VZ3A 4X61B 5EMLB 2UZYB 2IWFA 2BCJB 3RFHA 5IJ7E 1NEXB 4WK2A 3SJLD 2XU7A 2B5MA 3V5WB 5M5SA 3PSLA 5CXBB 3VI3A 4E5ZA 2HESX 3JZHA 3K26A 2G99A 3QHYB 3C99A 2OIZA 4OZUA 4AN0A 3E0CA 5IC7A 5H14A 5TEEA 3K27A 5KDOB 3AL9A 3MUOA 4PC0A 3IIYA 5K19A 4ZOZA 4WK4A 1UOPA 5FKRA 3MKSB 5HE1B 4BCCA 3ODTA 3EMHA 5CYKA 2P9UC 2XE4A 4O9DA 1Q47A 3IJ0A 3K72A 4ERZA 1GG2B 3V7DB 2H3XA 4A2MA 4QAMA 4NBMA 4U7AA 3I8EA 2HJ4A 4RE5A 1B9YA 4AOWA 3O4HA 3JZGA 4DNWA 4EWRA 1PI6A 1YR2A 3PXWD 2IWKA 3FCUA 2CE9A 2P9PC 3EI2A 3I7LA 3IJCA 4IA9A 2PM6B 4G1MA 4AN1A 4FA1D 3EQ8A 1XIPA 3IKOA 3EI1A 2JKXA 2CNXA 2H6QA 4KFMB 4O2WA 3DWLC 4R7AB 5EAMA 3AH8B 4DNUA 1OMWB 3ZE0A 3PXSD 2VDKA 3ZE1A 3AL8B 3J80g 4GGDA
chains in the Genus database with same CATH topology
5JWZA 2IUPA 2I0SA 4J82A 4CZXA 4GM3A 2I0TA 4CZVA 2PBIB 2OVQB 3EI4A 4O45A 3L4OD 5AMSA 5GMKn 1MG3A 3N0DA 3SWSD 3RMZD 3SLED 1B9XA 4ZN4A 2AH1A 3EI3A 3I7NA 4O3UB 3IIWA 3UVMA 5EAPA 3VH0A 4J84A 3SMRA 1SHYB 4GM9A 5IT9g 4K3ID 1R5MA 4GQBB 4GM8A 2AGZA 5HE3B 2Z2NA 2QXVA 4GGCA 2UZXB 5GSAA 5GXIA 3PVWB 5TEFA 5TDHB 4CI1A 4JD2C 3RLMD 1GP2B 2H13A 3I7OA 1XHMA 2B5NA 4D6VA 2J55H 3P4FA 3RN0D 3UVNA 1A0RB 1TBGA 2OK6A 4J81A 3NVNA 3F3GA 4ES0A 2XL3A 2YMUA 4ZOYA 5I5MA 2PM9B 2IURA 4JSXC 4UI9R 5FKTA 4LG8A 5EMMB 5THAA 3KRXB 2Z2PA 2B5LA 4JT5C 5EMKB 1OLZA 3ULEC 2BBKH 5A2Qg 2H9NA 4OWRA 2H9MA 2IAAA 3EI1B 3KRWB 2XL2A 5CYKB 4FAND 2H14A 4CY5A 5FQDA 2GC4A 2Q7QA 1U2VC 3DSMA 4G56B 4GQ2P 5EM2B 2GC7A 1N6FA 3IJ1A 3JAMg 2P9LC 3OKYB 2I3TA 2H6NA 4A0AB 1JJUB 5TF2A 3UKUC 4FAVD 5B4WA 4J77A 1MDAH 4J78A 3MXXA 4QT8A 5FKQA 2AH0A 4Y5RD 2AGYA 1JMZB 4PNKB 2CN3A 3UVKA 3I7PA 3MKQA 4O3TB 1TYQC 3PVUB 2P9SC 3CIKB 4Z8LA 5GXHA 2QC5A 4NSXA 4O1QD 2H9LA 5H1MA 3SBQA 3UVOA 3GREA 4A09B 1K32A 2CO0A 3SVWD 5FXYA 4HDJA 1GOTB 3OL2A 4ESGA 3JPXA 1P22A 4A08B 1JOFA 3SBPA 3HFQA 4E5ZB 3SN6B 4X63B 3AL8A 4AEZA 4FWWA 3BG1A 3EG6A 2P9NC 3SHFA 3C75H 2EBSA 5K1CC 4A11A 2YB8B 4E54A 1S4UX 3C9CA 3F3FA 3RSEC 4PXWA 1ERJA 1RI6A 2PM7B 4BUJC 3JROA 2H68A 4XYHA 5H17A 4GZ8A 5EARA 2H9PA 3FRXA 4A0AA 5IJ8E 2Z2OA 5C2WB 2AGWA 3OKYA 3OL2B 3OTTA 5HE0B 3FGBA 4CY1A 3GFCA 3PE7A 4PBYA 3U4YA 2TRCB 5EMJB 4JXMA 4H5IA 3NVQA 3MZLA 2XYIA 2OVRB 4J8BA 4J0WA 2I0RA 2MTAH 1SQ9A 2G9AA 4L1QD 2AQ5A 3BWSA 2O9KA 3I7KA 4XYIA 3W15A 4U1EI 4J73A 3FM0A 4GMBA 1N6EA 4A08A 4PSWB 4ERQA 1K8KC 3I2NA 2YNPA 4A7JA 4D0KA 4PSXB 3UVLA 4BH6A 4MK0B 3N0EA 3VA6A 2YBAA 3EI2B 2IUQA 3C5MA 4FB1D 2P9KC 2GNQA 2YNOA 4FHLA 4X60B 3SCYA 4CI2A 5FA5B 4I79A 3OKTA 2CO0C 5AJAA 4BL0A 3MZKA 4X3EA 3I89A 4LG9A 3AFCA 3MMYA 3CFSB 2OK4A 3JRPA 5IGQA 5FKSA 4A2LA 5HYNB 4GGAA 1JMXB 5C2VB 4K3JB 3NVXA 4J0XA 4YVDA 4L3HD 4N14A 5I5IA 5CXCA 3RFGA 2CN2A 3I7HA 4GQ1A 4FA5D 5IGOA 3I8CA 5HE2B 1QNIA 5EM2A 4JSNC 2HKRA 1U4CA 3SXTD 3RRMC 3V9FA 2AGLA 2H47A 5AFU3 3BG0A 1NR0A 1PGUA 5CXBA 2J57G 3DXKC 4CI3A 3UR4A 4IMMA 3EWEA 4PBZA 4L9OA 4JT6C 5C9ZB 2HKMA 2W18A 3OKWA 4CC9A 4ZOXA 1SQJA 2H6KA 3CFVA 1N6DA 3B7FA 1YFQA 3F3PA 2OVPB 2CE8A 2OJYA 3ZWLB 5SXMA 1PEVA 3SBRA 2I3SA 3EI3B 3UKRC 2PM9A 3A0FA 1L0QA 4L3GD 1PBYB 2HJBA 4A11B 3PSCB 5EALA 4LGNA 4CZYA 3J81g 1MG2A 5CXCB 2HXCA 2AGXA 3EI4B 3JB9L 4J79A 2B4EA 4J87A 4JSVC 4H5JA 3ORVD 1GXRA 2YNNA 1VYHC 1FWXA 1XKSA 3PXTD 5I5JA 4QQEA 4A0BB 4CY3A 4ZOVA 4FA4D 4XEIC 3DM0A 2J56H 4TZ4A 3L4MD 3SFZA 3JZNA 3OW8A 4J8GA 4Y7RA 3RN1D 4CY2A 3VGZA 4A09A 4CI8A 4QL1A 3EU7A 5HQGA 4QRJA 4ERYA 4FA9D 4E54B 3DXMC 2P9IC 4J86A 4A0BA 5FLXg 4JSPC 2HYEA 2IUVA 4X61B 5EMLB 2UZYB 2IWFA 2BCJB 3RFHA 5IJ7E 1NEXB 3SJLD 2XU7A 2B5MA 3V5WB 3PSLA 5CXBB 4E5ZA 2HESX 3JZHA 3K26A 2G99A 3C99A 2OIZA 4OZUA 3E0CA 5IC7A 5H14A 5TEEA 3K27A 5KDOB 3AL9A 4PC0A 3IIYA 5K19A 4ZOZA 5FKRA 3MKSB 5HE1B 3ODTA 3EMHA 5CYKA 2P9UC 4O9DA 1Q47A 3IJ0A 4ERZA 1GG2B 3V7DB 2H3XA 4A2MA 4U7AA 3I8EA 2HJ4A 1B9YA 4AOWA 3JZGA 4EWRA 1PI6A 3PXWD 2IWKA 2CE9A 2P9PC 3EI2A 3I7LA 3IJCA 4IA9A 2PM6B 4FA1D 1XIPA 3IKOA 3EI1A 2CNXA 2H6QA 4KFMB 3DWLC 4R7AB 5EAMA 3AH8B 1OMWB 3PXSD 3AL8B 3J80g 4GGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JWZ A;  2IUP A;  2I0S A;  4J82 A;  4CZX A;  4GM3 A;  2I0T A;  4CZV A;  2PBI B;  2OVQ B;  3EI4 A;  4O45 A;  3L4O D;  5AMS A;  5GMK n;  1MG3 A;  3N0D A;  3SWS D;  3RMZ D;  3SLE D;  1B9X A;  4ZN4 A;  2AH1 A;  3EI3 A;  3I7N A;  4O3U B;  3IIW A;  3UVM A;  5EAP A;  3VH0 A;  4J84 A;  3SMR A;  1SHY B;  4GM9 A;  5IT9 g;  4K3I D;  1R5M A;  4GQB B;  4GM8 A;  2AGZ A;  5HE3 B;  2Z2N A;  2QXV A;  4GGC A;  2UZX B;  5GSA A;  5GXI A;  3PVW B;  5TEF A;  5TDH B;  4CI1 A;  4JD2 C;  3RLM D;  1GP2 B;  2H13 A;  3I7O A;  1XHM A;  2B5N A;  4D6V A;  2J55 H;  3P4F A;  3RN0 D;  3UVN A;  1A0R B;  1TBG A;  2OK6 A;  4J81 A;  3NVN A;  3F3G A;  4ES0 A;  2XL3 A;  2YMU A;  4ZOY A;  5I5M A;  2PM9 B;  2IUR A;  4JSX C;  4UI9 R;  5FKT A;  4LG8 A;  5EMM B;  5THA A;  3KRX B;  2Z2P A;  2B5L A;  4JT5 C;  5EMK B;  1OLZ A;  3ULE C;  2BBK H;  5A2Q g;  2H9N A;  4OWR A;  2H9M A;  2IAA A;  3EI1 B;  3KRW B;  2XL2 A;  5CYK B;  4FAN D;  2H14 A;  4CY5 A;  5FQD A;  2GC4 A;  2Q7Q A;  1U2V C;  3DSM A;  4G56 B;  4GQ2 P;  5EM2 B;  2GC7 A;  1N6F A;  3IJ1 A;  3JAM g;  2P9L C;  3OKY B;  2I3T A;  2H6N A;  4A0A B;  1JJU B;  5TF2 A;  3UKU C;  4FAV D;  5B4W A;  4J77 A;  1MDA H;  4J78 A;  3MXX A;  4QT8 A;  5FKQ A;  2AH0 A;  4Y5R D;  2AGY A;  1JMZ B;  4PNK B;  2CN3 A;  3UVK A;  3I7P A;  3MKQ A;  4O3T B;  1TYQ C;  3PVU B;  2P9S C;  3CIK B;  4Z8L A;  5GXH A;  2QC5 A;  4NSX A;  4O1Q D;  2H9L A;  5H1M A;  3SBQ A;  3UVO A;  3GRE A;  4A09 B;  1K32 A;  2CO0 A;  3SVW D;  5FXY A;  4HDJ A;  1GOT B;  3OL2 A;  4ESG A;  3JPX A;  1P22 A;  4A08 B;  1JOF A;  3SBP A;  3HFQ A;  4E5Z B;  3SN6 B;  4X63 B;  3AL8 A;  4AEZ A;  4FWW A;  3BG1 A;  3EG6 A;  2P9N C;  3SHF A;  3C75 H;  2EBS A;  5K1C C;  4A11 A;  2YB8 B;  4E54 A;  1S4U X;  3C9C A;  3F3F A;  3RSE C;  4PXW A;  1ERJ A;  1RI6 A;  2PM7 B;  4BUJ C;  3JRO A;  2H68 A;  4XYH A;  5H17 A;  4GZ8 A;  5EAR A;  2H9P A;  3FRX A;  4A0A A;  5IJ8 E;  2Z2O A;  5C2W B;  2AGW A;  3OKY A;  3OL2 B;  3OTT A;  5HE0 B;  3FGB A;  4CY1 A;  3GFC A;  3PE7 A;  4PBY A;  3U4Y A;  2TRC B;  5EMJ B;  4JXM A;  4H5I A;  3NVQ A;  3MZL A;  2XYI A;  2OVR B;  4J8B A;  4J0W A;  2I0R A;  2MTA H;  1SQ9 A;  2G9A A;  4L1Q D;  2AQ5 A;  3BWS A;  2O9K A;  3I7K A;  4XYI A;  3W15 A;  4U1E I;  4J73 A;  3FM0 A;  4GMB A;  1N6E A;  4A08 A;  4PSW B;  4ERQ A;  1K8K C;  3I2N A;  2YNP A;  4A7J A;  4D0K A;  4PSX B;  3UVL A;  4BH6 A;  4MK0 B;  3N0E A;  3VA6 A;  2YBA A;  3EI2 B;  2IUQ A;  3C5M A;  4FB1 D;  2P9K C;  2GNQ A;  2YNO A;  4FHL A;  4X60 B;  3SCY A;  4CI2 A;  5FA5 B;  4I79 A;  3OKT A;  2CO0 C;  5AJA A;  4BL0 A;  3MZK A;  4X3E A;  3I89 A;  4LG9 A;  3AFC A;  3MMY A;  3CFS B;  2OK4 A;  3JRP A;  5IGQ A;  5FKS A;  4A2L A;  5HYN B;  4GGA A;  1JMX B;  5C2V B;  4K3J B;  3NVX A;  4J0X A;  4YVD A;  4L3H D;  4N14 A;  5I5I A;  5CXC A;  3RFG A;  2CN2 A;  3I7H A;  4GQ1 A;  4FA5 D;  5IGO A;  3I8C A;  5HE2 B;  1QNI A;  5EM2 A;  4JSN C;  2HKR A;  1U4C A;  3SXT D;  3RRM C;  3V9F A;  2AGL A;  2H47 A;  5AFU 3;  3BG0 A;  1NR0 A;  1PGU A;  5CXB A;  2J57 G;  3DXK C;  4CI3 A;  3UR4 A;  4IMM A;  3EWE A;  4PBZ A;  4L9O A;  4JT6 C;  5C9Z B;  2HKM A;  2W18 A;  3OKW A;  4CC9 A;  4ZOX A;  1SQJ A;  2H6K A;  3CFV A;  1N6D A;  3B7F A;  1YFQ A;  3F3P A;  2OVP B;  2CE8 A;  2OJY A;  3ZWL B;  5SXM A;  1PEV A;  3SBR A;  2I3S A;  3EI3 B;  3UKR C;  2PM9 A;  3A0F A;  1L0Q A;  4L3G D;  1PBY B;  2HJB A;  4A11 B;  3PSC B;  5EAL A;  4LGN A;  4CZY A;  3J81 g;  1MG2 A;  5CXC B;  2HXC A;  2AGX A;  3EI4 B;  3JB9 L;  4J79 A;  2B4E A;  4J87 A;  4JSV C;  4H5J A;  3ORV D;  1GXR A;  2YNN A;  1VYH C;  1FWX A;  1XKS A;  3PXT D;  5I5J A;  4QQE A;  4A0B B;  4CY3 A;  4ZOV A;  4FA4 D;  4XEI C;  3DM0 A;  2J56 H;  4TZ4 A;  3L4M D;  3SFZ A;  3JZN A;  3OW8 A;  4J8G A;  4Y7R A;  3RN1 D;  4CY2 A;  3VGZ A;  4A09 A;  4CI8 A;  4QL1 A;  3EU7 A;  5HQG A;  4QRJ A;  4ERY A;  4FA9 D;  4E54 B;  3DXM C;  2P9I C;  4J86 A;  4A0B A;  5FLX g;  4JSP C;  2HYE A;  2IUV A;  4X61 B;  5EML B;  2UZY B;  2IWF A;  2BCJ B;  3RFH A;  5IJ7 E;  1NEX B;  3SJL D;  2XU7 A;  2B5M A;  3V5W B;  3PSL A;  5CXB B;  4E5Z A;  2HES X;  3JZH A;  3K26 A;  2G99 A;  3C99 A;  2OIZ A;  4OZU A;  3E0C A;  5IC7 A;  5H14 A;  5TEE A;  3K27 A;  5KDO B;  3AL9 A;  4PC0 A;  3IIY A;  5K19 A;  4ZOZ A;  5FKR A;  3MKS B;  5HE1 B;  3ODT A;  3EMH A;  5CYK A;  2P9U C;  4O9D A;  1Q47 A;  3IJ0 A;  4ERZ A;  1GG2 B;  3V7D B;  2H3X A;  4A2M A;  4U7A A;  3I8E A;  2HJ4 A;  1B9Y A;  4AOW A;  3JZG A;  4EWR A;  1PI6 A;  3PXW D;  2IWK A;  2CE9 A;  2P9P C;  3EI2 A;  3I7L A;  3IJC A;  4IA9 A;  2PM6 B;  4FA1 D;  1XIP A;  3IKO A;  3EI1 A;  2CNX A;  2H6Q A;  4KFM B;  3DWL C;  4R7A B;  5EAM A;  3AH8 B;  1OMW B;  3PXS D;  3AL8 B;  3J80 g;  4GGD A; 
#chains in the Genus database with same CATH topology
 4NEN A;  5JWZ A;  2IUP A;  2I0S A;  4J82 A;  3IJE A;  4CZX A;  4Z7N A;  2HU7 A;  2I0T A;  4GM3 A;  4CZV A;  2PBI B;  2OVQ B;  3EI4 A;  4O45 A;  4WJK A;  3L4O D;  5AMS A;  5GMK n;  4AX4 A;  1MG3 A;  3FCS A;  3N0D A;  3SWS D;  5FFG A;  4O02 A;  3RMZ D;  3SLE D;  1B9X A;  4ZN4 A;  2AH1 A;  3EI3 A;  4BP9 A;  1VZ2 A;  3I7N A;  4O3U B;  3IIW A;  3UVM A;  5EAP A;  3VH0 A;  4J84 A;  3SMR A;  1SHY B;  4GM9 A;  4JHP C;  5IT9 g;  3DDU A;  4K3I D;  1R5M A;  4GQB B;  4GM8 A;  1GOH A;  2AGZ A;  5HE3 B;  2Z2N A;  4NC4 A;  3OF7 A;  2QXV A;  4GGC A;  2UZX B;  5GSA A;  4UM8 A;  5M61 A;  5GXI A;  3PVW B;  5TEF A;  4AMZ A;  5TDH B;  4CI1 A;  4JD2 C;  3NID A;  2EIC A;  3RLM D;  1GP2 B;  1K3I A;  2H13 A;  3I7O A;  1XHM A;  2B5N A;  4D6V A;  2J55 H;  3P4F A;  3RN0 D;  3UVN A;  1A0R B;  1TBG A;  2EIE A;  2OK6 A;  4J81 A;  3NVN A;  3F3G A;  4ES0 A;  2XL3 A;  2YMU A;  4ZOY A;  5I5M A;  2PM9 B;  1GOG A;  2IUR A;  4RE6 A;  4JSX C;  4Z7O A;  4UI9 R;  5FKT A;  4LG8 A;  5EMM B;  2EID A;  3ZE2 A;  5THA A;  3KRX B;  1TYE A;  2Z2P A;  2B5L A;  4JT5 C;  5EMK B;  1OLZ A;  3ULE C;  2BBK H;  5A2Q g;  2H9N A;  4OWR A;  2H9M A;  1T2X A;  1A12 A;  2IAA A;  3IUQ A;  3EI1 B;  5M5U A;  3KRW B;  2XL2 A;  5CYK B;  4FAN D;  2H14 A;  5HDB A;  4CY5 A;  5FQD A;  2GC4 A;  2Q7Q A;  1U2V C;  3DSM A;  1QFS A;  2HU5 A;  4G56 B;  4GQ2 P;  5EM2 B;  2GC7 A;  1N6F A;  3IJ1 A;  3JAM g;  2P9L C;  3OKY B;  2I3T A;  4UM9 A;  2H6N A;  4A0A B;  1JJU B;  5TF2 A;  3UKU C;  4FAV D;  3EQ9 A;  3K71 A;  1E8M A;  5B4W A;  1H2X A;  4J77 A;  1MDA H;  3KCI A;  4J78 A;  3MXX A;  4QT8 A;  5FKQ A;  4DNV A;  2AH0 A;  4MMZ A;  2AGY A;  4Y5R D;  1JMZ B;  4PNK B;  2CN3 A;  3UVK A;  3I7P A;  3MKQ A;  4O3T B;  1TYQ C;  3PVU B;  2P9S C;  3CIK B;  4Z8L A;  5GXH A;  2QC5 A;  1JV2 A;  4NSX A;  4O1Q D;  2H9L A;  5H1M A;  3SBQ A;  3UVO A;  3GRE A;  4A09 B;  2VC2 A;  1K32 A;  2VDR A;  1E8N A;  2CO0 A;  2VDL A;  5FXY A;  3SVW D;  4HDJ A;  5M5V A;  1GOT B;  3OL2 A;  4ESG A;  3JPX A;  1P22 A;  4BP8 A;  2QZP A;  4A08 B;  1JOF A;  3SBP A;  4G1E A;  3HFQ A;  5C92 A;  3MVD K;  4E5Z B;  3SN6 B;  1UOQ A;  4X63 B;  3AL8 A;  4MMX A;  4AEZ A;  4FWW A;  3BG1 A;  5E6S A;  4NAA A;  3K6S A;  3EG6 A;  2P9N C;  3SHF A;  3C75 H;  4WK0 A;  2EBS A;  5K1C C;  4A11 A;  2YB8 B;  4E54 A;  4MMY A;  2WQ8 A;  3ZDY A;  5E6U A;  1S4U X;  3C9C A;  3F3F A;  3O4J A;  3RSE C;  4PXW A;  3T3M A;  1ERJ A;  1RI6 A;  2PM7 B;  2VDQ A;  3JRO A;  4BUJ C;  2H68 A;  4XYH A;  5H17 A;  4L1M A;  4GZ8 A;  1U8C A;  5C86 A;  5EAR A;  2H9P A;  3FRX A;  3NIG A;  4AMY A;  4A0A A;  5IJ8 E;  2Z2O A;  5C2W B;  2AGW A;  3OKY A;  3OL2 B;  3OTT A;  5HE0 B;  3FGB A;  4CY1 A;  3GFC A;  3PE7 A;  5E6R A;  4PBY A;  3U4Y A;  2TRC B;  5EMJ B;  4JXM A;  4H5I A;  3NVQ A;  3MZL A;  3IUM A;  2XYI A;  2OVR B;  4J8B A;  4J0W A;  2I0R A;  2MTA H;  2EIB A;  2XZG A;  3GC3 B;  1SQ9 A;  2G9A A;  4L1Q D;  2AQ5 A;  3BWS A;  2O9K A;  3I7K A;  4XYI A;  3W15 A;  4U1E I;  1E5T A;  1M1X A;  2VDM A;  4J73 A;  5M5T A;  3FM0 A;  4GMB A;  1H2W A;  1N6E A;  4A08 A;  4PSW B;  4ERQ A;  5FFO A;  3T3P A;  1K8K C;  3I2N A;  2YNP A;  3IUN A;  4A7J A;  4D0K A;  2BKL A;  4PSX B;  3UVL A;  4MK0 B;  4BH6 A;  2VDO A;  3N0E A;  3VA6 A;  2YBA A;  3EI2 B;  2IUQ A;  3C5M A;  4FB1 D;  2P9K C;  2GNQ A;  2YNO A;  3IUR A;  4FHL A;  4X60 B;  3SCY A;  4CI2 A;  5FA5 B;  4I79 A;  3QI0 A;  1C9L A;  4JHN A;  3OKT A;  2CO0 C;  5AJA A;  4BL0 A;  3IUL A;  3MZK A;  4X3E A;  3I89 A;  4LG9 A;  3O4I A;  3AFC A;  1H2Z A;  1BPO A;  3MMY A;  3CFS B;  2OK4 A;  3JRP A;  5IGQ A;  5FKS A;  4A2L A;  5HYN B;  4GGA A;  3V4P A;  3ZDZ A;  4D9S A;  1JMX B;  5C2V B;  4K3J B;  3NVX A;  4J0X A;  1O6F A;  2QR5 A;  4YVD A;  4L3H D;  4N14 A;  5I5I A;  4IRZ A;  1C9I A;  5CXC A;  3RFG A;  2CN2 A;  3I7H A;  4GQ1 A;  4FA5 D;  5IGO A;  3I8C A;  5HE2 B;  1QNI A;  5EM2 A;  4JSN C;  2HKR A;  1U4C A;  3SXT D;  3RRM C;  3V9F A;  2AGL A;  2H47 A;  5AFU 3;  3BG0 A;  3EQ7 A;  4Z7Q A;  2HU8 A;  3NIF A;  1NR0 A;  1QFM A;  1PGU A;  5CXB A;  2J57 G;  3DXK C;  1L5G A;  3IUJ A;  3UR4 A;  4IMM A;  4CI3 A;  3EWE A;  4PBZ A;  4L9O A;  4JT6 C;  5C9Z B;  2HKM A;  3GD1 I;  2W18 A;  3OKW A;  4CC9 A;  4ZOX A;  3ZDX A;  1SQJ A;  2H6K A;  3CFV A;  1N6D A;  3B7F A;  1YFQ A;  1JTD B;  3F3P A;  2OVP B;  2CE8 A;  1VE7 A;  2OJY A;  3ZWL B;  5SXM A;  1PEV A;  3SBR A;  1VE6 A;  2I3S A;  3EI3 B;  3UKR C;  2PM9 A;  4G55 A;  3A0F A;  3IVM A;  1L0Q A;  4L3G D;  1UOO A;  4BCD A;  1PBY B;  2HJB A;  4A11 B;  3PSC B;  5EAL A;  4LGN A;  4CZY A;  3J81 g;  1MG2 A;  5CXC B;  1O6G A;  2HXC A;  2VDN A;  1GOF A;  2AGX A;  3EI4 B;  3JB9 L;  4J79 A;  2B4E A;  4J87 A;  4H5J A;  4JSV C;  3ORV D;  1GXR A;  2YNN A;  5M5R A;  1VYH C;  1FWX A;  1XKS A;  3PXT D;  5I5J A;  4QQE A;  3O4G A;  4BCB A;  4CY3 A;  4A0B B;  4ZOV A;  4FA4 D;  4XEI C;  3DM0 A;  3MUN A;  1H2Y A;  1UTC A;  2J56 H;  4TZ4 A;  3L4M D;  3SFZ A;  3JZN A;  3OW8 A;  4J8G A;  1I2M B;  4Y7R A;  3RN1 D;  4CY2 A;  3VGZ A;  4A09 A;  4CI8 A;  4QL1 A;  3EU7 A;  5HQG A;  3V4V A;  2VZ3 A;  4QRJ A;  4ERY A;  4FA9 D;  4E54 B;  2VZ1 A;  3DXM C;  2VDP A;  2P9I C;  4J86 A;  4A0B A;  5FLX g;  2XDW A;  4JSP C;  3VI4 A;  2HYE A;  2IUV A;  1VZ3 A;  4X61 B;  5EML B;  2UZY B;  2IWF A;  2BCJ B;  3RFH A;  5IJ7 E;  1NEX B;  4WK2 A;  3SJL D;  2XU7 A;  2B5M A;  3V5W B;  5M5S A;  3PSL A;  5CXB B;  3VI3 A;  4E5Z A;  2HES X;  3JZH A;  3K26 A;  2G99 A;  3QHY B;  3C99 A;  2OIZ A;  4OZU A;  4AN0 A;  3E0C A;  5IC7 A;  5H14 A;  5TEE A;  3K27 A;  5KDO B;  3AL9 A;  3MUO A;  4PC0 A;  3IIY A;  5K19 A;  4ZOZ A;  4WK4 A;  1UOP A;  5FKR A;  3MKS B;  5HE1 B;  4BCC A;  3ODT A;  3EMH A;  5CYK A;  2P9U C;  2XE4 A;  4O9D A;  1Q47 A;  3IJ0 A;  3K72 A;  4ERZ A;  1GG2 B;  3V7D B;  2H3X A;  4A2M A;  4QAM A;  4NBM A;  4U7A A;  3I8E A;  2HJ4 A;  4RE5 A;  1B9Y A;  4AOW A;  3O4H A;  3JZG A;  4DNW A;  4EWR A;  1PI6 A;  1YR2 A;  3PXW D;  2IWK A;  3FCU A;  2CE9 A;  2P9P C;  3EI2 A;  3I7L A;  3IJC A;  4IA9 A;  2PM6 B;  4G1M A;  4AN1 A;  4FA1 D;  3EQ8 A;  1XIP A;  3IKO A;  3EI1 A;  2JKX A;  2CNX A;  2H6Q A;  4KFM B;  4O2W A;  3DWL C;  4R7A B;  5EAM A;  3AH8 B;  4DNU A;  1OMW B;  3ZE0 A;  3PXS D;  2VDK A;  3ZE1 A;  3AL8 B;  3J80 g;  4GGD A; 
#chains in the Genus database with same CATH homology
 5JWZ A;  2IUP A;  2I0S A;  4J82 A;  4CZX A;  4GM3 A;  2I0T A;  4CZV A;  2PBI B;  2OVQ B;  3EI4 A;  4O45 A;  3L4O D;  5AMS A;  5GMK n;  1MG3 A;  3N0D A;  3SWS D;  3RMZ D;  3SLE D;  1B9X A;  4ZN4 A;  2AH1 A;  3EI3 A;  3I7N A;  4O3U B;  3IIW A;  3UVM A;  5EAP A;  3VH0 A;  4J84 A;  3SMR A;  1SHY B;  4GM9 A;  5IT9 g;  4K3I D;  1R5M A;  4GQB B;  4GM8 A;  2AGZ A;  5HE3 B;  2Z2N A;  2QXV A;  4GGC A;  2UZX B;  5GSA A;  5GXI A;  3PVW B;  5TEF A;  5TDH B;  4CI1 A;  4JD2 C;  3RLM D;  1GP2 B;  2H13 A;  3I7O A;  1XHM A;  2B5N A;  4D6V A;  2J55 H;  3P4F A;  3RN0 D;  3UVN A;  1A0R B;  1TBG A;  2OK6 A;  4J81 A;  3NVN A;  3F3G A;  4ES0 A;  2XL3 A;  2YMU A;  4ZOY A;  5I5M A;  2PM9 B;  2IUR A;  4JSX C;  4UI9 R;  5FKT A;  4LG8 A;  5EMM B;  5THA A;  3KRX B;  2Z2P A;  2B5L A;  4JT5 C;  5EMK B;  1OLZ A;  3ULE C;  2BBK H;  5A2Q g;  2H9N A;  4OWR A;  2H9M A;  2IAA A;  3EI1 B;  3KRW B;  2XL2 A;  5CYK B;  4FAN D;  2H14 A;  4CY5 A;  5FQD A;  2GC4 A;  2Q7Q A;  1U2V C;  3DSM A;  4G56 B;  4GQ2 P;  5EM2 B;  2GC7 A;  1N6F A;  3IJ1 A;  3JAM g;  2P9L C;  3OKY B;  2I3T A;  2H6N A;  4A0A B;  1JJU B;  5TF2 A;  3UKU C;  4FAV D;  5B4W A;  4J77 A;  1MDA H;  4J78 A;  3MXX A;  4QT8 A;  5FKQ A;  2AH0 A;  4Y5R D;  2AGY A;  1JMZ B;  4PNK B;  2CN3 A;  3UVK A;  3I7P A;  3MKQ A;  4O3T B;  1TYQ C;  3PVU B;  2P9S C;  3CIK B;  4Z8L A;  5GXH A;  2QC5 A;  4NSX A;  4O1Q D;  2H9L A;  5H1M A;  3SBQ A;  3UVO A;  3GRE A;  4A09 B;  1K32 A;  2CO0 A;  3SVW D;  5FXY A;  4HDJ A;  1GOT B;  3OL2 A;  4ESG A;  3JPX A;  1P22 A;  4A08 B;  1JOF A;  3SBP A;  3HFQ A;  4E5Z B;  3SN6 B;  4X63 B;  3AL8 A;  4AEZ A;  4FWW A;  3BG1 A;  3EG6 A;  2P9N C;  3SHF A;  3C75 H;  2EBS A;  5K1C C;  4A11 A;  2YB8 B;  4E54 A;  1S4U X;  3C9C A;  3F3F A;  3RSE C;  4PXW A;  1ERJ A;  1RI6 A;  2PM7 B;  4BUJ C;  3JRO A;  2H68 A;  4XYH A;  5H17 A;  4GZ8 A;  5EAR A;  2H9P A;  3FRX A;  4A0A A;  5IJ8 E;  2Z2O A;  5C2W B;  2AGW A;  3OKY A;  3OL2 B;  3OTT A;  5HE0 B;  3FGB A;  4CY1 A;  3GFC A;  3PE7 A;  4PBY A;  3U4Y A;  2TRC B;  5EMJ B;  4JXM A;  4H5I A;  3NVQ A;  3MZL A;  2XYI A;  2OVR B;  4J8B A;  4J0W A;  2I0R A;  2MTA H;  1SQ9 A;  2G9A A;  4L1Q D;  2AQ5 A;  3BWS A;  2O9K A;  3I7K A;  4XYI A;  3W15 A;  4U1E I;  4J73 A;  3FM0 A;  4GMB A;  1N6E A;  4A08 A;  4PSW B;  4ERQ A;  1K8K C;  3I2N A;  2YNP A;  4A7J A;  4D0K A;  4PSX B;  3UVL A;  4BH6 A;  4MK0 B;  3N0E A;  3VA6 A;  2YBA A;  3EI2 B;  2IUQ A;  3C5M A;  4FB1 D;  2P9K C;  2GNQ A;  2YNO A;  4FHL A;  4X60 B;  3SCY A;  4CI2 A;  5FA5 B;  4I79 A;  3OKT A;  2CO0 C;  5AJA A;  4BL0 A;  3MZK A;  4X3E A;  3I89 A;  4LG9 A;  3AFC A;  3MMY A;  3CFS B;  2OK4 A;  3JRP A;  5IGQ A;  5FKS A;  4A2L A;  5HYN B;  4GGA A;  1JMX B;  5C2V B;  4K3J B;  3NVX A;  4J0X A;  4YVD A;  4L3H D;  4N14 A;  5I5I A;  5CXC A;  3RFG A;  2CN2 A;  3I7H A;  4GQ1 A;  4FA5 D;  5IGO A;  3I8C A;  5HE2 B;  1QNI A;  5EM2 A;  4JSN C;  2HKR A;  1U4C A;  3SXT D;  3RRM C;  3V9F A;  2AGL A;  2H47 A;  5AFU 3;  3BG0 A;  1NR0 A;  1PGU A;  5CXB A;  2J57 G;  3DXK C;  4CI3 A;  3UR4 A;  4IMM A;  3EWE A;  4PBZ A;  4L9O A;  4JT6 C;  5C9Z B;  2HKM A;  2W18 A;  3OKW A;  4CC9 A;  4ZOX A;  1SQJ A;  2H6K A;  3CFV A;  1N6D A;  3B7F A;  1YFQ A;  3F3P A;  2OVP B;  2CE8 A;  2OJY A;  3ZWL B;  5SXM A;  1PEV A;  3SBR A;  2I3S A;  3EI3 B;  3UKR C;  2PM9 A;  3A0F A;  1L0Q A;  4L3G D;  1PBY B;  2HJB A;  4A11 B;  3PSC B;  5EAL A;  4LGN A;  4CZY A;  3J81 g;  1MG2 A;  5CXC B;  2HXC A;  2AGX A;  3EI4 B;  3JB9 L;  4J79 A;  2B4E A;  4J87 A;  4JSV C;  4H5J A;  3ORV D;  1GXR A;  2YNN A;  1VYH C;  1FWX A;  1XKS A;  3PXT D;  5I5J A;  4QQE A;  4A0B B;  4CY3 A;  4ZOV A;  4FA4 D;  4XEI C;  3DM0 A;  2J56 H;  4TZ4 A;  3L4M D;  3SFZ A;  3JZN A;  3OW8 A;  4J8G A;  4Y7R A;  3RN1 D;  4CY2 A;  3VGZ A;  4A09 A;  4CI8 A;  4QL1 A;  3EU7 A;  5HQG A;  4QRJ A;  4ERY A;  4FA9 D;  4E54 B;  3DXM C;  2P9I C;  4J86 A;  4A0B A;  5FLX g;  4JSP C;  2HYE A;  2IUV A;  4X61 B;  5EML B;  2UZY B;  2IWF A;  2BCJ B;  3RFH A;  5IJ7 E;  1NEX B;  3SJL D;  2XU7 A;  2B5M A;  3V5W B;  3PSL A;  5CXB B;  4E5Z A;  2HES X;  3JZH A;  3K26 A;  2G99 A;  3C99 A;  2OIZ A;  4OZU A;  3E0C A;  5IC7 A;  5H14 A;  5TEE A;  3K27 A;  5KDO B;  3AL9 A;  4PC0 A;  3IIY A;  5K19 A;  4ZOZ A;  5FKR A;  3MKS B;  5HE1 B;  3ODT A;  3EMH A;  5CYK A;  2P9U C;  4O9D A;  1Q47 A;  3IJ0 A;  4ERZ A;  1GG2 B;  3V7D B;  2H3X A;  4A2M A;  4U7A A;  3I8E A;  2HJ4 A;  1B9Y A;  4AOW A;  3JZG A;  4EWR A;  1PI6 A;  3PXW D;  2IWK A;  2CE9 A;  2P9P C;  3EI2 A;  3I7L A;  3IJC A;  4IA9 A;  2PM6 B;  4FA1 D;  1XIP A;  3IKO A;  3EI1 A;  2CNX A;  2H6Q A;  4KFM B;  3DWL C;  4R7A B;  5EAM A;  3AH8 B;  1OMW B;  3PXS D;  3AL8 B;  3J80 g;  4GGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...