2GOLB

Xray structure of gag278
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
135
structure length
135
Chain Sequence
b'HQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Matrix protein p17 (MA)
publication title Implications for Viral Capsid Assembly from Crystal Structures of HIV-1 Gag 1-278 and CAN 133-278.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 49
structure length 135
sequence length 135
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2golB00
1D1DA 5HGNA 4XFZA 4HTWA 3NTEA 5HGKA 4U0DA 4WYMA 2M8PA 3MGEA 5JPAA 4U0AA 2XGYA 1GWPA 2EIAA 2LF4A 2Y4ZA 2XGUA 1M9YC 1P7NA 1M9EC 1AFVA 2JPRA 1M9DC 4XFXA 2PWOA 2X83A 4DGAC 1E6JP 2X2DD 5HGOA 4PH0A 3P05A 2PXRC 4XRQA 1M9CC 2XDEA 3BP9A 4J93A 4DGEC 2GOLB 4B4NA 2PWMA 2WLVA 1M9FC 4QNBA 2GONA 2KGFA 2XGVA 4XFYA 2M8LA 4U0BA 5HGLA 4PH2A 1AK4C 1EIAA 4E91A 2WLVB 1G03A 3H47A 4PH3A 4XROA 1M9XC 4U0EA 4INBA 4E92A 1EM9A 2M8NA 1U7KA 4LQWC 4U0FA 4U0CA 4NX4C 2X82A 1L6NA 5HGMA 3H4EA 2V4XA 1QRJA
chains in the Genus database with same CATH superfamily
1D1DA 5HGNA 4XFZA 4HTWA 3NTEA 5HGKA 4U0DA 4WYMA 2M8PA 3MGEA 5JPAA 4U0AA 2XGYA 1GWPA 2EIAA 2LF4A 2Y4ZA 2XGUA 1M9YC 1P7NA 1M9EC 1AFVA 2JPRA 1M9DC 4XFXA 2PWOA 2X83A 4DGAC 1E6JP 2X2DD 5HGOA 4PH0A 3P05A 2PXRC 4XRQA 1M9CC 2XDEA 3BP9A 4J93A 4DGEC 2GOLB 4B4NA 2PWMA 2WLVA 1M9FC 4QNBA 2GONA 2KGFA 2XGVA 4XFYA 2M8LA 4U0BA 5HGLA 4PH2A 1AK4C 1EIAA 4E91A 2WLVB 1G03A 3H47A 4PH3A 4XROA 1M9XC 4U0EA 4INBA 4E92A 1EM9A 2M8NA 1U7KA 4LQWC 4U0FA 4U0CA 4NX4C 2X82A 1L6NA 5HGMA 3H4EA 2V4XA 1QRJA
chains in the Genus database with same CATH topology
1D1DA 5HGNA 4XFZA 4HTWA 3NTEA 5HGKA 4U0DA 4WYMA 2M8PA 3MGEA 5JPAA 4U0AA 2XGYA 1GWPA 2EIAA 2LF4A 2Y4ZA 2XGUA 1M9YC 1P7NA 1M9EC 1AFVA 2JPRA 1M9DC 4XFXA 2PWOA 2X83A 4DGAC 1E6JP 2X2DD 5HGOA 4PH0A 3P05A 2PXRC 4XRQA 1M9CC 2XDEA 3BP9A 4J93A 4DGEC 2GOLB 4B4NA 2PWMA 2WLVA 1M9FC 4QNBA 2GONA 2KGFA 2XGVA 4XFYA 2M8LA 4U0BA 5HGLA 4PH2A 1AK4C 1EIAA 4E91A 2WLVB 1G03A 3H47A 4PH3A 4XROA 1M9XC 4U0EA 4INBA 4E92A 1EM9A 2M8NA 1U7KA 4LQWC 4U0FA 4U0CA 4NX4C 2X82A 1L6NA 5HGMA 3H4EA 2V4XA 1QRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1D A;  5HGN A;  4XFZ A;  4HTW A;  3NTE A;  5HGK A;  4U0D A;  4WYM A;  2M8P A;  3MGE A;  5JPA A;  4U0A A;  2XGY A;  1GWP A;  2EIA A;  2LF4 A;  2Y4Z A;  2XGU A;  1M9Y C;  1P7N A;  1M9E C;  1AFV A;  2JPR A;  1M9D C;  4XFX A;  2PWO A;  2X83 A;  4DGA C;  1E6J P;  2X2D D;  5HGO A;  4PH0 A;  3P05 A;  2PXR C;  4XRQ A;  1M9C C;  2XDE A;  3BP9 A;  4J93 A;  4DGE C;  2GOL B;  4B4N A;  2PWM A;  2WLV A;  1M9F C;  4QNB A;  2GON A;  2KGF A;  2XGV A;  4XFY A;  2M8L A;  4U0B A;  5HGL A;  4PH2 A;  1AK4 C;  1EIA A;  4E91 A;  2WLV B;  1G03 A;  3H47 A;  4PH3 A;  4XRO A;  1M9X C;  4U0E A;  4INB A;  4E92 A;  1EM9 A;  2M8N A;  1U7K A;  4LQW C;  4U0F A;  4U0C A;  4NX4 C;  2X82 A;  1L6N A;  5HGM A;  3H4E A;  2V4X A;  1QRJ A; 
#chains in the Genus database with same CATH topology
 1D1D A;  5HGN A;  4XFZ A;  4HTW A;  3NTE A;  5HGK A;  4U0D A;  4WYM A;  2M8P A;  3MGE A;  5JPA A;  4U0A A;  2XGY A;  1GWP A;  2EIA A;  2LF4 A;  2Y4Z A;  2XGU A;  1M9Y C;  1P7N A;  1M9E C;  1AFV A;  2JPR A;  1M9D C;  4XFX A;  2PWO A;  2X83 A;  4DGA C;  1E6J P;  2X2D D;  5HGO A;  4PH0 A;  3P05 A;  2PXR C;  4XRQ A;  1M9C C;  2XDE A;  3BP9 A;  4J93 A;  4DGE C;  2GOL B;  4B4N A;  2PWM A;  2WLV A;  1M9F C;  4QNB A;  2GON A;  2KGF A;  2XGV A;  4XFY A;  2M8L A;  4U0B A;  5HGL A;  4PH2 A;  1AK4 C;  1EIA A;  4E91 A;  2WLV B;  1G03 A;  3H47 A;  4PH3 A;  4XRO A;  1M9X C;  4U0E A;  4INB A;  4E92 A;  1EM9 A;  2M8N A;  1U7K A;  4LQW C;  4U0F A;  4U0C A;  4NX4 C;  2X82 A;  1L6N A;  5HGM A;  3H4E A;  2V4X A;  1QRJ A; 
#chains in the Genus database with same CATH homology
 1D1D A;  5HGN A;  4XFZ A;  4HTW A;  3NTE A;  5HGK A;  4U0D A;  4WYM A;  2M8P A;  3MGE A;  5JPA A;  4U0A A;  2XGY A;  1GWP A;  2EIA A;  2LF4 A;  2Y4Z A;  2XGU A;  1M9Y C;  1P7N A;  1M9E C;  1AFV A;  2JPR A;  1M9D C;  4XFX A;  2PWO A;  2X83 A;  4DGA C;  1E6J P;  2X2D D;  5HGO A;  4PH0 A;  3P05 A;  2PXR C;  4XRQ A;  1M9C C;  2XDE A;  3BP9 A;  4J93 A;  4DGE C;  2GOL B;  4B4N A;  2PWM A;  2WLV A;  1M9F C;  4QNB A;  2GON A;  2KGF A;  2XGV A;  4XFY A;  2M8L A;  4U0B A;  5HGL A;  4PH2 A;  1AK4 C;  1EIA A;  4E91 A;  2WLV B;  1G03 A;  3H47 A;  4PH3 A;  4XRO A;  1M9X C;  4U0E A;  4INB A;  4E92 A;  1EM9 A;  2M8N A;  1U7K A;  4LQW C;  4U0F A;  4U0C A;  4NX4 C;  2X82 A;  1L6N A;  5HGM A;  3H4E A;  2V4X A;  1QRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...