2GOLB

Xray structure of gag278
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
135
structure length
135
Chain Sequence
HQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Matrix protein p17 (MA)
publication title Implications for Viral Capsid Assembly from Crystal Structures of HIV-1 Gag 1-278 and CAN 133-278.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 49
structure length 135
sequence length 135
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2golB00
1AFVA 3BP9A 4XROA 4U0EA 2KGFA 2M8LA 4U0AA 4E91A 2XGYA 1M9DC 4PH2A 4B4NA 1AK4C 3MGEA 4XFZA 5HGLA 1P7NA 4PH3A 2X2DD 1EIAA 1D1DA 4QNBA 2EIAA 4LQWC 4HTWA 3NTEA 4XFYA 4PH0A 2X82A 4U0DA 3P05A 2XGUA 1M9YC 1M9XC 2LF4A 4J93A 1QRJA 2XDEA 2M8PA 2PWOA 2PWMA 4DGAC 1M9CC 4XRQA 2XGVA 1M9EC 2WLVA 2JPRA 1M9FC 3H47A 5HGOA 4U0BA 2GOLB 4U0FA 4U0CA 1U7KA 1GWPA 2WLVB 4XFXA 2Y4ZA 4E92A 2GONA 4WYMA 5JPAA 1L6NA 2M8NA 4INBA 2PXRC 5HGNA 5HGMA 5HGKA 1G03A 3H4EA 2X83A 4NX4C 1EM9A 1E6JP 2V4XA 4DGEC
chains in the Genus database with same CATH superfamily
1AFVA 3BP9A 4XROA 4U0EA 2KGFA 2M8LA 4U0AA 4E91A 2XGYA 1M9DC 4PH2A 4B4NA 1AK4C 3MGEA 4XFZA 5HGLA 1P7NA 4PH3A 2X2DD 1EIAA 1D1DA 4QNBA 2EIAA 4LQWC 4HTWA 3NTEA 4XFYA 4PH0A 2X82A 4U0DA 3P05A 2XGUA 1M9YC 1M9XC 2LF4A 4J93A 1QRJA 2XDEA 2M8PA 2PWOA 2PWMA 4DGAC 1M9CC 4XRQA 2XGVA 1M9EC 2WLVA 2JPRA 1M9FC 3H47A 5HGOA 4U0BA 2GOLB 4U0FA 4U0CA 1U7KA 1GWPA 2WLVB 4XFXA 2Y4ZA 4E92A 2GONA 4WYMA 5JPAA 1L6NA 2M8NA 4INBA 2PXRC 5HGNA 5HGMA 5HGKA 1G03A 3H4EA 2X83A 4NX4C 1EM9A 1E6JP 2V4XA 4DGEC
chains in the Genus database with same CATH topology
1AFVA 3BP9A 4XROA 4U0EA 2KGFA 2M8LA 4U0AA 4E91A 2XGYA 1M9DC 4PH2A 4B4NA 1AK4C 3MGEA 4XFZA 5HGLA 1P7NA 4PH3A 2X2DD 1EIAA 1D1DA 4QNBA 2EIAA 4LQWC 4HTWA 3NTEA 4XFYA 4PH0A 2X82A 4U0DA 3P05A 2XGUA 1M9YC 1M9XC 2LF4A 4J93A 1QRJA 2XDEA 2M8PA 2PWOA 2PWMA 4DGAC 1M9CC 4XRQA 2XGVA 1M9EC 2WLVA 2JPRA 1M9FC 3H47A 5HGOA 4U0BA 2GOLB 4U0FA 4U0CA 1U7KA 1GWPA 2WLVB 4XFXA 2Y4ZA 4E92A 2GONA 4WYMA 5JPAA 1L6NA 2M8NA 4INBA 2PXRC 5HGNA 5HGMA 5HGKA 1G03A 3H4EA 2X83A 4NX4C 1EM9A 1E6JP 2V4XA 4DGEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AFV A;  3BP9 A;  4XRO A;  4U0E A;  2KGF A;  2M8L A;  4U0A A;  4E91 A;  2XGY A;  1M9D C;  4PH2 A;  4B4N A;  1AK4 C;  3MGE A;  4XFZ A;  5HGL A;  1P7N A;  4PH3 A;  2X2D D;  1EIA A;  1D1D A;  4QNB A;  2EIA A;  4LQW C;  4HTW A;  3NTE A;  4XFY A;  4PH0 A;  2X82 A;  4U0D A;  3P05 A;  2XGU A;  1M9Y C;  1M9X C;  2LF4 A;  4J93 A;  1QRJ A;  2XDE A;  2M8P A;  2PWO A;  2PWM A;  4DGA C;  1M9C C;  4XRQ A;  2XGV A;  1M9E C;  2WLV A;  2JPR A;  1M9F C;  3H47 A;  5HGO A;  4U0B A;  2GOL B;  4U0F A;  4U0C A;  1U7K A;  1GWP A;  2WLV B;  4XFX A;  2Y4Z A;  4E92 A;  2GON A;  4WYM A;  5JPA A;  1L6N A;  2M8N A;  4INB A;  2PXR C;  5HGN A;  5HGM A;  5HGK A;  1G03 A;  3H4E A;  2X83 A;  4NX4 C;  1EM9 A;  1E6J P;  2V4X A;  4DGE C; 
#chains in the Genus database with same CATH topology
 1AFV A;  3BP9 A;  4XRO A;  4U0E A;  2KGF A;  2M8L A;  4U0A A;  4E91 A;  2XGY A;  1M9D C;  4PH2 A;  4B4N A;  1AK4 C;  3MGE A;  4XFZ A;  5HGL A;  1P7N A;  4PH3 A;  2X2D D;  1EIA A;  1D1D A;  4QNB A;  2EIA A;  4LQW C;  4HTW A;  3NTE A;  4XFY A;  4PH0 A;  2X82 A;  4U0D A;  3P05 A;  2XGU A;  1M9Y C;  1M9X C;  2LF4 A;  4J93 A;  1QRJ A;  2XDE A;  2M8P A;  2PWO A;  2PWM A;  4DGA C;  1M9C C;  4XRQ A;  2XGV A;  1M9E C;  2WLV A;  2JPR A;  1M9F C;  3H47 A;  5HGO A;  4U0B A;  2GOL B;  4U0F A;  4U0C A;  1U7K A;  1GWP A;  2WLV B;  4XFX A;  2Y4Z A;  4E92 A;  2GON A;  4WYM A;  5JPA A;  1L6N A;  2M8N A;  4INB A;  2PXR C;  5HGN A;  5HGM A;  5HGK A;  1G03 A;  3H4E A;  2X83 A;  4NX4 C;  1EM9 A;  1E6J P;  2V4X A;  4DGE C; 
#chains in the Genus database with same CATH homology
 1AFV A;  3BP9 A;  4XRO A;  4U0E A;  2KGF A;  2M8L A;  4U0A A;  4E91 A;  2XGY A;  1M9D C;  4PH2 A;  4B4N A;  1AK4 C;  3MGE A;  4XFZ A;  5HGL A;  1P7N A;  4PH3 A;  2X2D D;  1EIA A;  1D1D A;  4QNB A;  2EIA A;  4LQW C;  4HTW A;  3NTE A;  4XFY A;  4PH0 A;  2X82 A;  4U0D A;  3P05 A;  2XGU A;  1M9Y C;  1M9X C;  2LF4 A;  4J93 A;  1QRJ A;  2XDE A;  2M8P A;  2PWO A;  2PWM A;  4DGA C;  1M9C C;  4XRQ A;  2XGV A;  1M9E C;  2WLV A;  2JPR A;  1M9F C;  3H47 A;  5HGO A;  4U0B A;  2GOL B;  4U0F A;  4U0C A;  1U7K A;  1GWP A;  2WLV B;  4XFX A;  2Y4Z A;  4E92 A;  2GON A;  4WYM A;  5JPA A;  1L6N A;  2M8N A;  4INB A;  2PXR C;  5HGN A;  5HGM A;  5HGK A;  1G03 A;  3H4E A;  2X83 A;  4NX4 C;  1EM9 A;  1E6J P;  2V4X A;  4DGE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...