2GOOB

Ternary complex of bmp-2 bound to bmpr-ia-ecd and actrii-ecd
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
PFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone morphogenetic protein 2
publication title Structure of the ternary signaling complex of a TGF-beta superfamily member.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 15
structure length 85
sequence length 85
chains with identical sequence E
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2006-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2gooB00
1CDRA 2CRSA 2H5FA 6EBXA 1IK8A 1TFSA 1TXAA 2JVEA 2H62D 1LXHA 2OFSA 4EY8B 1G6MA 2BTXA 2GOOB 1M9ZA 2FD6U 3KFDI 2ERAA 1NYUA 1XT3A 2QC1A 1CB9A 2MJYA 1RL5A 2N99A 3EBXA 5DU1A 2MUPA 4FAOC 2H64C 4ZQYA 1CHVS 2H7ZA 2L5SA 2PJYB 1JBDA 2MUOA 3U74U 1IDIA 4HQPF 1CDSA 4AEAA 2QJ9C 3QB4B 1ZADA 2K3GA 3FEVA 2VLWA 2LA1A 5IMYC 1V6PA 1JGKA 1CTXA 1CXNA 1JE9A 2UX2A 4LFTA 1LSIA 1KBSA 2MHYA 1QM7A 1HC9A 3LAQU 1LX5B 1IDHA 5IMTD 1S4YA 4OM5A 1NXBA 1FASA 1COEA 1NEAA 3PLCA 1MR6A 3BT2U 2H8UA 1KC4A 3KFDE 4IYEA 3NDSA 2BHIA 1DRSA 2J8BA 2I9BE 1F94A 2LCRA 2QJBC 5EBXA 1RGJA 1KS6A 4BDTB 1L4WA 1TXBA 1KBAA 1KTZB 3BT1U 4XJJA 2H64B 1KBTA 2H7ZB 3EVSC 1YWHA 1CVOA 1PLOA 1W6BA 1KXIA 5DO6A 2MJ4A 1NTXA 1UG4A 2CRTA 3HH7A 1NYSA 1CODA 1HAJA 2ABXA 1QKEA 1CCQA 1HAAA 1CXOA 1LJZA 2MJ0A 3NEQA 1HOYA 1I02A 1ERGA 1F8UB 1BTEA 2CDXA 1CDTA 1FF4A 4OM4A 1TGXA 1IJCA 1MAHF 1HC9B 4RUDA 4QTIU 4DO8A 2HLQA 4UY2C 4FAOE 1IDLA 2CTXA 2L03A 1ABTA 2HLRA 1IKCA 2H62C 1CDQA 1FRAA 1IDGA 4BIKB 1VB0A 2PJYC 2MFAA 4P7UA 1KFHA 2NBTA 5DZ5A 3ERAA 1IQ9A 1NTNA 1ES7B 1KL8A 1LXGA 1CRFA 2JQPA 1FSCA 2X8BB 1FSSB 1NORA 1CREA 1ONJA 3NH7A 2UWRA 3U73U 1KU6B 2GOOC 1B41B 2QJAC 1BXPA 1QKDA 1H0JA 1FFJA 1ERAA 1REWC 3VTSA 2CCXA
chains in the Genus database with same CATH superfamily
1CDRA 2CRSA 2H5FA 6EBXA 1IK8A 1TFSA 1TXAA 2JVEA 2H62D 1LXHA 2OFSA 4EY8B 1G6MA 2BTXA 2GOOB 1M9ZA 2FD6U 3KFDI 2ERAA 1NYUA 1XT3A 2QC1A 1CB9A 2MJYA 1RL5A 2N99A 3EBXA 5DU1A 2MUPA 4FAOC 2H64C 4ZQYA 1CHVS 2H7ZA 2L5SA 2PJYB 1JBDA 2MUOA 3U74U 1IDIA 4HQPF 1CDSA 4AEAA 2QJ9C 3QB4B 1ZADA 2K3GA 3FEVA 2VLWA 2LA1A 5IMYC 1V6PA 1JGKA 1CTXA 1CXNA 1JE9A 2UX2A 4LFTA 1LSIA 1KBSA 2MHYA 1QM7A 1HC9A 3LAQU 1LX5B 1IDHA 5IMTD 1S4YA 4OM5A 1NXBA 1FASA 1COEA 1NEAA 3PLCA 1MR6A 3BT2U 2H8UA 1KC4A 3KFDE 4IYEA 3NDSA 4KSNA 2BHIA 1DRSA 2J8BA 2I9BE 1F94A 2LCRA 2QJBC 5EBXA 1RGJA 1KS6A 4BDTB 1L4WA 1TXBA 1KBAA 1KTZB 3BT1U 4XJJA 2H64B 1KBTA 2H7ZB 3EVSC 1YWHA 1CVOA 1PLOA 1W6BA 1KXIA 5DO6A 2MJ4A 1NTXA 1UG4A 2CRTA 3HH7A 1NYSA 1CODA 1HAJA 2ABXA 1QKEA 1CCQA 1HAAA 1CXOA 1LJZA 2MJ0A 3NEQA 1HOYA 1I02A 1ERGA 1F8UB 1BTEA 2CDXA 1CDTA 1FF4A 4OM4A 1TGXA 1IJCA 1MAHF 1HC9B 4RUDA 4QTIU 4DO8A 2HLQA 4UY2C 4FAOE 1IDLA 2CTXA 2L03A 1ABTA 2HLRA 1IKCA 2H62C 1CDQA 1FRAA 1IDGA 4BIKB 1VB0A 2PJYC 2MFAA 4P7UA 1KFHA 2NBTA 5DZ5A 3ERAA 1IQ9A 1NTNA 1ES7B 1KL8A 1LXGA 1CRFA 2JQPA 1FSCA 2X8BB 1FSSB 1NORA 1CREA 1ONJA 3NH7A 2UWRA 3U73U 1KU6B 2GOOC 1B41B 2QJAC 1BXPA 1QKDA 1H0JA 1FFJA 1ERAA 1REWC 3VTSA 2CCXA
chains in the Genus database with same CATH topology
1CDRA 2CRSA 2H5FA 6EBXA 1IK8A 1TFSA 1TXAA 2JVEA 2H62D 1LXHA 2OFSA 4EY8B 1G6MA 2BTXA 2GOOB 1M9ZA 2FD6U 3KFDI 2ERAA 1NYUA 1XT3A 2QC1A 1CB9A 2MJYA 1RL5A 2N99A 3EBXA 5DU1A 2MUPA 4FAOC 2H64C 4ZQYA 1CHVS 2H7ZA 2L5SA 2PJYB 1JBDA 2MUOA 3U74U 1IDIA 4HQPF 1CDSA 4AEAA 2QJ9C 3QB4B 1ZADA 2K3GA 3FEVA 2VLWA 2LA1A 5IMYC 1V6PA 1JGKA 1CTXA 1CXNA 1JE9A 2UX2A 4LFTA 1LSIA 1KBSA 2MHYA 1QM7A 1HC9A 3LAQU 1LX5B 1IDHA 5IMTD 1S4YA 4OM5A 1NXBA 1FASA 1COEA 1NEAA 3PLCA 1MR6A 3BT2U 2H8UA 1KC4A 3KFDE 4IYEA 3NDSA 4KSNA 2BHIA 1DRSA 2J8BA 2I9BE 1F94A 2LCRA 2QJBC 5EBXA 1RGJA 1KS6A 4BDTB 1L4WA 1TXBA 1KBAA 1KTZB 3BT1U 4XJJA 2H64B 1KBTA 2H7ZB 3EVSC 1YWHA 1CVOA 1PLOA 1W6BA 1KXIA 5DO6A 2MJ4A 1NTXA 1UG4A 2CRTA 3HH7A 1NYSA 1CODA 1HAJA 2ABXA 1QKEA 1CCQA 1HAAA 1CXOA 1LJZA 2MJ0A 3NEQA 1HOYA 1I02A 1ERGA 1F8UB 1BTEA 2CDXA 1CDTA 1FF4A 4OM4A 1TGXA 1IJCA 1MAHF 1HC9B 4RUDA 4QTIU 4DO8A 2HLQA 4UY2C 4FAOE 1IDLA 2CTXA 2L03A 1ABTA 2HLRA 1IKCA 2H62C 1CDQA 1FRAA 1IDGA 4BIKB 1VB0A 2PJYC 2MFAA 4P7UA 1KFHA 2NBTA 5DZ5A 3ERAA 1IQ9A 1NTNA 1ES7B 1KL8A 1LXGA 1CRFA 2JQPA 1FSCA 2X8BB 1FSSB 1NORA 1CREA 1ONJA 3NH7A 2UWRA 3U73U 1KU6B 2GOOC 1B41B 2QJAC 1BXPA 1QKDA 1H0JA 1FFJA 1ERAA 1REWC 3VTSA 2CCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CDR A;  2CRS A;  2H5F A;  6EBX A;  1IK8 A;  1TFS A;  1TXA A;  2JVE A;  2H62 D;  1LXH A;  2OFS A;  4EY8 B;  1G6M A;  2BTX A;  2GOO B;  1M9Z A;  2FD6 U;  3KFD I;  2ERA A;  1NYU A;  1XT3 A;  2QC1 A;  1CB9 A;  2MJY A;  1RL5 A;  2N99 A;  3EBX A;  5DU1 A;  2MUP A;  4FAO C;  2H64 C;  4ZQY A;  1CHV S;  2H7Z A;  2L5S A;  2PJY B;  1JBD A;  2MUO A;  3U74 U;  1IDI A;  4HQP F;  1CDS A;  4AEA A;  2QJ9 C;  3QB4 B;  1ZAD A;  2K3G A;  3FEV A;  2VLW A;  2LA1 A;  5IMY C;  1V6P A;  1JGK A;  1CTX A;  1CXN A;  1JE9 A;  2UX2 A;  4LFT A;  1LSI A;  1KBS A;  2MHY A;  1QM7 A;  1HC9 A;  3LAQ U;  1LX5 B;  1IDH A;  5IMT D;  1S4Y A;  4OM5 A;  1NXB A;  1FAS A;  1COE A;  1NEA A;  3PLC A;  1MR6 A;  3BT2 U;  2H8U A;  1KC4 A;  3KFD E;  4IYE A;  3NDS A;  2BHI A;  1DRS A;  2J8B A;  2I9B E;  1F94 A;  2LCR A;  2QJB C;  5EBX A;  1RGJ A;  1KS6 A;  4BDT B;  1L4W A;  1TXB A;  1KBA A;  1KTZ B;  3BT1 U;  4XJJ A;  2H64 B;  1KBT A;  2H7Z B;  3EVS C;  1YWH A;  1CVO A;  1PLO A;  1W6B A;  1KXI A;  5DO6 A;  2MJ4 A;  1NTX A;  1UG4 A;  2CRT A;  3HH7 A;  1NYS A;  1COD A;  1HAJ A;  2ABX A;  1QKE A;  1CCQ A;  1HAA A;  1CXO A;  1LJZ A;  2MJ0 A;  3NEQ A;  1HOY A;  1I02 A;  1ERG A;  1F8U B;  1BTE A;  2CDX A;  1CDT A;  1FF4 A;  4OM4 A;  1TGX A;  1IJC A;  1MAH F;  1HC9 B;  4RUD A;  4QTI U;  4DO8 A;  2HLQ A;  4UY2 C;  4FAO E;  1IDL A;  2CTX A;  2L03 A;  1ABT A;  2HLR A;  1IKC A;  2H62 C;  1CDQ A;  1FRA A;  1IDG A;  4BIK B;  1VB0 A;  2PJY C;  2MFA A;  4P7U A;  1KFH A;  2NBT A;  5DZ5 A;  3ERA A;  1IQ9 A;  1NTN A;  1ES7 B;  1KL8 A;  1LXG A;  1CRF A;  2JQP A;  1FSC A;  2X8B B;  1FSS B;  1NOR A;  1CRE A;  1ONJ A;  3NH7 A;  2UWR A;  3U73 U;  1KU6 B;  2GOO C;  1B41 B;  2QJA C;  1BXP A;  1QKD A;  1H0J A;  1FFJ A;  1ERA A;  1REW C;  3VTS A;  2CCX A; 
#chains in the Genus database with same CATH topology
 1CDR A;  2CRS A;  2H5F A;  6EBX A;  1IK8 A;  1TFS A;  1TXA A;  2JVE A;  2H62 D;  1LXH A;  2OFS A;  4EY8 B;  1G6M A;  2BTX A;  2GOO B;  1M9Z A;  2FD6 U;  3KFD I;  2ERA A;  1NYU A;  1XT3 A;  2QC1 A;  1CB9 A;  2MJY A;  1RL5 A;  2N99 A;  3EBX A;  5DU1 A;  2MUP A;  4FAO C;  2H64 C;  4ZQY A;  1CHV S;  2H7Z A;  2L5S A;  2PJY B;  1JBD A;  2MUO A;  3U74 U;  1IDI A;  4HQP F;  1CDS A;  4AEA A;  2QJ9 C;  3QB4 B;  1ZAD A;  2K3G A;  3FEV A;  2VLW A;  2LA1 A;  5IMY C;  1V6P A;  1JGK A;  1CTX A;  1CXN A;  1JE9 A;  2UX2 A;  4LFT A;  1LSI A;  1KBS A;  2MHY A;  1QM7 A;  1HC9 A;  3LAQ U;  1LX5 B;  1IDH A;  5IMT D;  1S4Y A;  4OM5 A;  1NXB A;  1FAS A;  1COE A;  1NEA A;  3PLC A;  1MR6 A;  3BT2 U;  2H8U A;  1KC4 A;  3KFD E;  4IYE A;  3NDS A;  4KSN A;  2BHI A;  1DRS A;  2J8B A;  2I9B E;  1F94 A;  2LCR A;  2QJB C;  5EBX A;  1RGJ A;  1KS6 A;  4BDT B;  1L4W A;  1TXB A;  1KBA A;  1KTZ B;  3BT1 U;  4XJJ A;  2H64 B;  1KBT A;  2H7Z B;  3EVS C;  1YWH A;  1CVO A;  1PLO A;  1W6B A;  1KXI A;  5DO6 A;  2MJ4 A;  1NTX A;  1UG4 A;  2CRT A;  3HH7 A;  1NYS A;  1COD A;  1HAJ A;  2ABX A;  1QKE A;  1CCQ A;  1HAA A;  1CXO A;  1LJZ A;  2MJ0 A;  3NEQ A;  1HOY A;  1I02 A;  1ERG A;  1F8U B;  1BTE A;  2CDX A;  1CDT A;  1FF4 A;  4OM4 A;  1TGX A;  1IJC A;  1MAH F;  1HC9 B;  4RUD A;  4QTI U;  4DO8 A;  2HLQ A;  4UY2 C;  4FAO E;  1IDL A;  2CTX A;  2L03 A;  1ABT A;  2HLR A;  1IKC A;  2H62 C;  1CDQ A;  1FRA A;  1IDG A;  4BIK B;  1VB0 A;  2PJY C;  2MFA A;  4P7U A;  1KFH A;  2NBT A;  5DZ5 A;  3ERA A;  1IQ9 A;  1NTN A;  1ES7 B;  1KL8 A;  1LXG A;  1CRF A;  2JQP A;  1FSC A;  2X8B B;  1FSS B;  1NOR A;  1CRE A;  1ONJ A;  3NH7 A;  2UWR A;  3U73 U;  1KU6 B;  2GOO C;  1B41 B;  2QJA C;  1BXP A;  1QKD A;  1H0J A;  1FFJ A;  1ERA A;  1REW C;  3VTS A;  2CCX A; 
#chains in the Genus database with same CATH homology
 1CDR A;  2CRS A;  2H5F A;  6EBX A;  1IK8 A;  1TFS A;  1TXA A;  2JVE A;  2H62 D;  1LXH A;  2OFS A;  4EY8 B;  1G6M A;  2BTX A;  2GOO B;  1M9Z A;  2FD6 U;  3KFD I;  2ERA A;  1NYU A;  1XT3 A;  2QC1 A;  1CB9 A;  2MJY A;  1RL5 A;  2N99 A;  3EBX A;  5DU1 A;  2MUP A;  4FAO C;  2H64 C;  4ZQY A;  1CHV S;  2H7Z A;  2L5S A;  2PJY B;  1JBD A;  2MUO A;  3U74 U;  1IDI A;  4HQP F;  1CDS A;  4AEA A;  2QJ9 C;  3QB4 B;  1ZAD A;  2K3G A;  3FEV A;  2VLW A;  2LA1 A;  5IMY C;  1V6P A;  1JGK A;  1CTX A;  1CXN A;  1JE9 A;  2UX2 A;  4LFT A;  1LSI A;  1KBS A;  2MHY A;  1QM7 A;  1HC9 A;  3LAQ U;  1LX5 B;  1IDH A;  5IMT D;  1S4Y A;  4OM5 A;  1NXB A;  1FAS A;  1COE A;  1NEA A;  3PLC A;  1MR6 A;  3BT2 U;  2H8U A;  1KC4 A;  3KFD E;  4IYE A;  3NDS A;  4KSN A;  2BHI A;  1DRS A;  2J8B A;  2I9B E;  1F94 A;  2LCR A;  2QJB C;  5EBX A;  1RGJ A;  1KS6 A;  4BDT B;  1L4W A;  1TXB A;  1KBA A;  1KTZ B;  3BT1 U;  4XJJ A;  2H64 B;  1KBT A;  2H7Z B;  3EVS C;  1YWH A;  1CVO A;  1PLO A;  1W6B A;  1KXI A;  5DO6 A;  2MJ4 A;  1NTX A;  1UG4 A;  2CRT A;  3HH7 A;  1NYS A;  1COD A;  1HAJ A;  2ABX A;  1QKE A;  1CCQ A;  1HAA A;  1CXO A;  1LJZ A;  2MJ0 A;  3NEQ A;  1HOY A;  1I02 A;  1ERG A;  1F8U B;  1BTE A;  2CDX A;  1CDT A;  1FF4 A;  4OM4 A;  1TGX A;  1IJC A;  1MAH F;  1HC9 B;  4RUD A;  4QTI U;  4DO8 A;  2HLQ A;  4UY2 C;  4FAO E;  1IDL A;  2CTX A;  2L03 A;  1ABT A;  2HLR A;  1IKC A;  2H62 C;  1CDQ A;  1FRA A;  1IDG A;  4BIK B;  1VB0 A;  2PJY C;  2MFA A;  4P7U A;  1KFH A;  2NBT A;  5DZ5 A;  3ERA A;  1IQ9 A;  1NTN A;  1ES7 B;  1KL8 A;  1LXG A;  1CRF A;  2JQP A;  1FSC A;  2X8B B;  1FSS B;  1NOR A;  1CRE A;  1ONJ A;  3NH7 A;  2UWR A;  3U73 U;  1KU6 B;  2GOO C;  1B41 B;  2QJA C;  1BXP A;  1QKD A;  1H0J A;  1FFJ A;  1ERA A;  1REW C;  3VTS A;  2CCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...