2GOOB

Ternary complex of bmp-2 bound to bmpr-ia-ecd and actrii-ecd
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
b'PFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone morphogenetic protein 2
publication title Structure of the ternary signaling complex of a TGF-beta superfamily member.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 15
structure length 85
sequence length 85
chains with identical sequence E
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2006-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2gooB00
4OM4A 1IKCA 2CDXA 2I9BE 4LFTA 3U73U 4BDTB 1QKDA 1NTXA 1S4YA 2MHYA 2ABXA 2JVEA 4XJJA 3U74U 1CB9A 3NH7A 1TFSA 3PLCA 1IDHA 3NDSA 2HLQA 2UX2A 3KFDE 1FFJA 2BTXA 2MJ4A 2MUPA 3LAQU 3QB4B 1IQ9A 1CVOA 3EBXA 1NEAA 4DO8A 1JBDA 3BT2U 2H62D 1CDTA 3FEVA 1CODA 4EY8B 1JE9A 2PJYC 1FSSB 2BHIA 2CCXA 1MAHF 1UG4A 1LXHA 1ONJA 1REWC 2CRTA 2LA1A 4BIKB 1KTZB 2MJYA 1CHVS 1V6PA 3EVSC 3BT1U 1QM7A 1CXOA 1ZADA 1IK8A 4QTIU 2OFSA 1ERGA 1KBTA 1B41B 2MUOA 1LXGA 1RL5A 1BXPA 2N99A 2GOOC 5IMTD 4OM5A 5DZ5A 2H5FA 1FSCA 1L4WA 2L5SA 2H8UA 1NYUA 1CTXA 1HAAA 1CDRA 4FAOE 2QC1A 1TGXA 1ERAA 2K3GA 4RUDA 3ERAA 1CRFA 1XT3A 1FF4A 6EBXA 1M9ZA 2CTXA 2NBTA 5DU1A 2FD6U 1KFHA 1FRAA 2PJYB 1YWHA 3KFDI 2UWRA 1NORA 1F8UB 2HLRA 1PLOA 1NYSA 1W6BA 2H7ZA 1BTEA 2QJ9C 1HOYA 1RGJA 4P7UA 1KBSA 1JGKA 1FASA 3VTSA 1KBAA 2L03A 2QJAC 2J8BA 2H64C 2H7ZB 1KXIA 2GOOB 1KC4A 3HH7A 4UY2C 1CDQA 2ERAA 1NXBA 5IMYC 5EBXA 2LCRA 1LX5B 2MJ0A 2MFAA 1ES7B 1HAJA 2X8BB 1LSIA 1HC9B 2VLWA 1IDGA 1CCQA 1KU6B 4HQPF 5DO6A 1KS6A 1IDIA 1IDLA 1MR6A 1CDSA 1DRSA 4ZQYA 2H62C 1VB0A 2CRSA 4AEAA 1KL8A 1TXAA 1ABTA 1NTNA 1COEA 1F94A 1LJZA 2H64B 2JQPA 1TXBA 1HC9A 1IJCA 1I02A 1QKEA 4IYEA 1G6MA 3NEQA 1H0JA 1CXNA 2QJBC 1CREA 4FAOC
chains in the Genus database with same CATH superfamily
4OM4A 1IKCA 2CDXA 2I9BE 4LFTA 3U73U 4BDTB 1QKDA 1NTXA 1S4YA 2MHYA 2ABXA 2JVEA 4XJJA 3U74U 1CB9A 3NH7A 1TFSA 3PLCA 1IDHA 3NDSA 2HLQA 2UX2A 3KFDE 1FFJA 2BTXA 2MJ4A 2MUPA 3LAQU 3QB4B 1IQ9A 1CVOA 3EBXA 1NEAA 4DO8A 1JBDA 3BT2U 2H62D 1CDTA 3FEVA 1CODA 4EY8B 1JE9A 2PJYC 1FSSB 2BHIA 2CCXA 1MAHF 1UG4A 1LXHA 1ONJA 1REWC 2CRTA 2LA1A 4BIKB 1KTZB 2MJYA 1CHVS 1V6PA 3EVSC 3BT1U 1QM7A 1CXOA 1ZADA 1IK8A 4QTIU 2OFSA 1ERGA 1KBTA 1B41B 2MUOA 1LXGA 1RL5A 1BXPA 2N99A 2GOOC 5IMTD 4OM5A 5DZ5A 2H5FA 1FSCA 1L4WA 2L5SA 2H8UA 1NYUA 1CTXA 1HAAA 1CDRA 4FAOE 2QC1A 1TGXA 1ERAA 2K3GA 4RUDA 3ERAA 1CRFA 1XT3A 1FF4A 6EBXA 1M9ZA 2CTXA 2NBTA 5DU1A 2FD6U 1KFHA 1FRAA 2PJYB 1YWHA 3KFDI 2UWRA 1NORA 1F8UB 2HLRA 1PLOA 1NYSA 1W6BA 2H7ZA 1BTEA 2QJ9C 1HOYA 1RGJA 4P7UA 4KSNA 1KBSA 1JGKA 1FASA 3VTSA 1KBAA 2L03A 2QJAC 2J8BA 2H64C 2H7ZB 1KXIA 2GOOB 1KC4A 3HH7A 4UY2C 1CDQA 2ERAA 1NXBA 5IMYC 5EBXA 2LCRA 1LX5B 2MJ0A 2MFAA 1ES7B 1HAJA 2X8BB 1LSIA 1HC9B 2VLWA 1IDGA 1CCQA 1KU6B 4HQPF 5DO6A 1KS6A 1IDIA 1IDLA 1MR6A 1CDSA 1DRSA 4ZQYA 2H62C 1VB0A 2CRSA 4AEAA 1KL8A 1TXAA 1ABTA 1NTNA 1COEA 1F94A 1LJZA 2H64B 2JQPA 1TXBA 1HC9A 1IJCA 1I02A 1QKEA 4IYEA 1G6MA 3NEQA 1H0JA 1CXNA 2QJBC 1CREA 4FAOC
chains in the Genus database with same CATH topology
4OM4A 1IKCA 2CDXA 2I9BE 4LFTA 3U73U 4BDTB 1QKDA 1NTXA 1S4YA 2MHYA 2ABXA 2JVEA 4XJJA 3U74U 1CB9A 3NH7A 1TFSA 3PLCA 1IDHA 3NDSA 2HLQA 2UX2A 3KFDE 1FFJA 2BTXA 2MJ4A 2MUPA 3LAQU 3QB4B 1IQ9A 1CVOA 3EBXA 1NEAA 4DO8A 1JBDA 3BT2U 2H62D 1CDTA 3FEVA 1CODA 4EY8B 1JE9A 2PJYC 1FSSB 2BHIA 2CCXA 1MAHF 1UG4A 1LXHA 1ONJA 1REWC 2CRTA 2LA1A 4BIKB 1KTZB 2MJYA 1CHVS 1V6PA 3EVSC 3BT1U 1QM7A 1CXOA 1ZADA 1IK8A 4QTIU 2OFSA 1ERGA 1KBTA 1B41B 2MUOA 1LXGA 1RL5A 1BXPA 2N99A 2GOOC 5IMTD 4OM5A 5DZ5A 2H5FA 1FSCA 1L4WA 2L5SA 2H8UA 1NYUA 1CTXA 1HAAA 1CDRA 4FAOE 2QC1A 1TGXA 1ERAA 2K3GA 4RUDA 3ERAA 1CRFA 1XT3A 1FF4A 6EBXA 1M9ZA 2CTXA 2NBTA 5DU1A 2FD6U 1KFHA 1FRAA 2PJYB 1YWHA 3KFDI 2UWRA 1NORA 1F8UB 2HLRA 1PLOA 1NYSA 1W6BA 2H7ZA 1BTEA 2QJ9C 1HOYA 1RGJA 4P7UA 4KSNA 1KBSA 1JGKA 1FASA 3VTSA 1KBAA 2L03A 2QJAC 2J8BA 2H64C 2H7ZB 1KXIA 2GOOB 1KC4A 3HH7A 4UY2C 1CDQA 2ERAA 1NXBA 5IMYC 5EBXA 2LCRA 1LX5B 2MJ0A 2MFAA 1ES7B 1HAJA 2X8BB 1LSIA 1HC9B 2VLWA 1IDGA 1CCQA 1KU6B 4HQPF 5DO6A 1KS6A 1IDIA 1IDLA 1MR6A 1CDSA 1DRSA 4ZQYA 2H62C 1VB0A 2CRSA 4AEAA 1KL8A 1TXAA 1ABTA 1NTNA 1COEA 1F94A 1LJZA 2H64B 2JQPA 1TXBA 1HC9A 1IJCA 1I02A 1QKEA 4IYEA 1G6MA 3NEQA 1H0JA 1CXNA 2QJBC 1CREA 4FAOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OM4 A;  1IKC A;  2CDX A;  2I9B E;  4LFT A;  3U73 U;  4BDT B;  1QKD A;  1NTX A;  1S4Y A;  2MHY A;  2ABX A;  2JVE A;  4XJJ A;  3U74 U;  1CB9 A;  3NH7 A;  1TFS A;  3PLC A;  1IDH A;  3NDS A;  2HLQ A;  2UX2 A;  3KFD E;  1FFJ A;  2BTX A;  2MJ4 A;  2MUP A;  3LAQ U;  3QB4 B;  1IQ9 A;  1CVO A;  3EBX A;  1NEA A;  4DO8 A;  1JBD A;  3BT2 U;  2H62 D;  1CDT A;  3FEV A;  1COD A;  4EY8 B;  1JE9 A;  2PJY C;  1FSS B;  2BHI A;  2CCX A;  1MAH F;  1UG4 A;  1LXH A;  1ONJ A;  1REW C;  2CRT A;  2LA1 A;  4BIK B;  1KTZ B;  2MJY A;  1CHV S;  1V6P A;  3EVS C;  3BT1 U;  1QM7 A;  1CXO A;  1ZAD A;  1IK8 A;  4QTI U;  2OFS A;  1ERG A;  1KBT A;  1B41 B;  2MUO A;  1LXG A;  1RL5 A;  1BXP A;  2N99 A;  2GOO C;  5IMT D;  4OM5 A;  5DZ5 A;  2H5F A;  1FSC A;  1L4W A;  2L5S A;  2H8U A;  1NYU A;  1CTX A;  1HAA A;  1CDR A;  4FAO E;  2QC1 A;  1TGX A;  1ERA A;  2K3G A;  4RUD A;  3ERA A;  1CRF A;  1XT3 A;  1FF4 A;  6EBX A;  1M9Z A;  2CTX A;  2NBT A;  5DU1 A;  2FD6 U;  1KFH A;  1FRA A;  2PJY B;  1YWH A;  3KFD I;  2UWR A;  1NOR A;  1F8U B;  2HLR A;  1PLO A;  1NYS A;  1W6B A;  2H7Z A;  1BTE A;  2QJ9 C;  1HOY A;  1RGJ A;  4P7U A;  1KBS A;  1JGK A;  1FAS A;  3VTS A;  1KBA A;  2L03 A;  2QJA C;  2J8B A;  2H64 C;  2H7Z B;  1KXI A;  2GOO B;  1KC4 A;  3HH7 A;  4UY2 C;  1CDQ A;  2ERA A;  1NXB A;  5IMY C;  5EBX A;  2LCR A;  1LX5 B;  2MJ0 A;  2MFA A;  1ES7 B;  1HAJ A;  2X8B B;  1LSI A;  1HC9 B;  2VLW A;  1IDG A;  1CCQ A;  1KU6 B;  4HQP F;  5DO6 A;  1KS6 A;  1IDI A;  1IDL A;  1MR6 A;  1CDS A;  1DRS A;  4ZQY A;  2H62 C;  1VB0 A;  2CRS A;  4AEA A;  1KL8 A;  1TXA A;  1ABT A;  1NTN A;  1COE A;  1F94 A;  1LJZ A;  2H64 B;  2JQP A;  1TXB A;  1HC9 A;  1IJC A;  1I02 A;  1QKE A;  4IYE A;  1G6M A;  3NEQ A;  1H0J A;  1CXN A;  2QJB C;  1CRE A;  4FAO C; 
#chains in the Genus database with same CATH topology
 4OM4 A;  1IKC A;  2CDX A;  2I9B E;  4LFT A;  3U73 U;  4BDT B;  1QKD A;  1NTX A;  1S4Y A;  2MHY A;  2ABX A;  2JVE A;  4XJJ A;  3U74 U;  1CB9 A;  3NH7 A;  1TFS A;  3PLC A;  1IDH A;  3NDS A;  2HLQ A;  2UX2 A;  3KFD E;  1FFJ A;  2BTX A;  2MJ4 A;  2MUP A;  3LAQ U;  3QB4 B;  1IQ9 A;  1CVO A;  3EBX A;  1NEA A;  4DO8 A;  1JBD A;  3BT2 U;  2H62 D;  1CDT A;  3FEV A;  1COD A;  4EY8 B;  1JE9 A;  2PJY C;  1FSS B;  2BHI A;  2CCX A;  1MAH F;  1UG4 A;  1LXH A;  1ONJ A;  1REW C;  2CRT A;  2LA1 A;  4BIK B;  1KTZ B;  2MJY A;  1CHV S;  1V6P A;  3EVS C;  3BT1 U;  1QM7 A;  1CXO A;  1ZAD A;  1IK8 A;  4QTI U;  2OFS A;  1ERG A;  1KBT A;  1B41 B;  2MUO A;  1LXG A;  1RL5 A;  1BXP A;  2N99 A;  2GOO C;  5IMT D;  4OM5 A;  5DZ5 A;  2H5F A;  1FSC A;  1L4W A;  2L5S A;  2H8U A;  1NYU A;  1CTX A;  1HAA A;  1CDR A;  4FAO E;  2QC1 A;  1TGX A;  1ERA A;  2K3G A;  4RUD A;  3ERA A;  1CRF A;  1XT3 A;  1FF4 A;  6EBX A;  1M9Z A;  2CTX A;  2NBT A;  5DU1 A;  2FD6 U;  1KFH A;  1FRA A;  2PJY B;  1YWH A;  3KFD I;  2UWR A;  1NOR A;  1F8U B;  2HLR A;  1PLO A;  1NYS A;  1W6B A;  2H7Z A;  1BTE A;  2QJ9 C;  1HOY A;  1RGJ A;  4P7U A;  4KSN A;  1KBS A;  1JGK A;  1FAS A;  3VTS A;  1KBA A;  2L03 A;  2QJA C;  2J8B A;  2H64 C;  2H7Z B;  1KXI A;  2GOO B;  1KC4 A;  3HH7 A;  4UY2 C;  1CDQ A;  2ERA A;  1NXB A;  5IMY C;  5EBX A;  2LCR A;  1LX5 B;  2MJ0 A;  2MFA A;  1ES7 B;  1HAJ A;  2X8B B;  1LSI A;  1HC9 B;  2VLW A;  1IDG A;  1CCQ A;  1KU6 B;  4HQP F;  5DO6 A;  1KS6 A;  1IDI A;  1IDL A;  1MR6 A;  1CDS A;  1DRS A;  4ZQY A;  2H62 C;  1VB0 A;  2CRS A;  4AEA A;  1KL8 A;  1TXA A;  1ABT A;  1NTN A;  1COE A;  1F94 A;  1LJZ A;  2H64 B;  2JQP A;  1TXB A;  1HC9 A;  1IJC A;  1I02 A;  1QKE A;  4IYE A;  1G6M A;  3NEQ A;  1H0J A;  1CXN A;  2QJB C;  1CRE A;  4FAO C; 
#chains in the Genus database with same CATH homology
 4OM4 A;  1IKC A;  2CDX A;  2I9B E;  4LFT A;  3U73 U;  4BDT B;  1QKD A;  1NTX A;  1S4Y A;  2MHY A;  2ABX A;  2JVE A;  4XJJ A;  3U74 U;  1CB9 A;  3NH7 A;  1TFS A;  3PLC A;  1IDH A;  3NDS A;  2HLQ A;  2UX2 A;  3KFD E;  1FFJ A;  2BTX A;  2MJ4 A;  2MUP A;  3LAQ U;  3QB4 B;  1IQ9 A;  1CVO A;  3EBX A;  1NEA A;  4DO8 A;  1JBD A;  3BT2 U;  2H62 D;  1CDT A;  3FEV A;  1COD A;  4EY8 B;  1JE9 A;  2PJY C;  1FSS B;  2BHI A;  2CCX A;  1MAH F;  1UG4 A;  1LXH A;  1ONJ A;  1REW C;  2CRT A;  2LA1 A;  4BIK B;  1KTZ B;  2MJY A;  1CHV S;  1V6P A;  3EVS C;  3BT1 U;  1QM7 A;  1CXO A;  1ZAD A;  1IK8 A;  4QTI U;  2OFS A;  1ERG A;  1KBT A;  1B41 B;  2MUO A;  1LXG A;  1RL5 A;  1BXP A;  2N99 A;  2GOO C;  5IMT D;  4OM5 A;  5DZ5 A;  2H5F A;  1FSC A;  1L4W A;  2L5S A;  2H8U A;  1NYU A;  1CTX A;  1HAA A;  1CDR A;  4FAO E;  2QC1 A;  1TGX A;  1ERA A;  2K3G A;  4RUD A;  3ERA A;  1CRF A;  1XT3 A;  1FF4 A;  6EBX A;  1M9Z A;  2CTX A;  2NBT A;  5DU1 A;  2FD6 U;  1KFH A;  1FRA A;  2PJY B;  1YWH A;  3KFD I;  2UWR A;  1NOR A;  1F8U B;  2HLR A;  1PLO A;  1NYS A;  1W6B A;  2H7Z A;  1BTE A;  2QJ9 C;  1HOY A;  1RGJ A;  4P7U A;  4KSN A;  1KBS A;  1JGK A;  1FAS A;  3VTS A;  1KBA A;  2L03 A;  2QJA C;  2J8B A;  2H64 C;  2H7Z B;  1KXI A;  2GOO B;  1KC4 A;  3HH7 A;  4UY2 C;  1CDQ A;  2ERA A;  1NXB A;  5IMY C;  5EBX A;  2LCR A;  1LX5 B;  2MJ0 A;  2MFA A;  1ES7 B;  1HAJ A;  2X8B B;  1LSI A;  1HC9 B;  2VLW A;  1IDG A;  1CCQ A;  1KU6 B;  4HQP F;  5DO6 A;  1KS6 A;  1IDI A;  1IDL A;  1MR6 A;  1CDS A;  1DRS A;  4ZQY A;  2H62 C;  1VB0 A;  2CRS A;  4AEA A;  1KL8 A;  1TXA A;  1ABT A;  1NTN A;  1COE A;  1F94 A;  1LJZ A;  2H64 B;  2JQP A;  1TXB A;  1HC9 A;  1IJC A;  1I02 A;  1QKE A;  4IYE A;  1G6M A;  3NEQ A;  1H0J A;  1CXN A;  2QJB C;  1CRE A;  4FAO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...