2GOXB

Crystal structure of efb-c / c3d complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
65
structure length
65
Chain Sequence
TDATIKKEQKLIQAQNLVREFEKTHTVSAHRKAQKAVNLVSFEYKVKKMVLQERIDNVLKQGLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C3
publication title A structural basis for complement inhibition by Staphylococcus aureus.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/toxin
total genus 26
structure length 65
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12199 efb-c Extracellular fibrinogen binding protein C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2goxB00
2JVGA 2WY8Q 3D5RC 2GOXB 2GOMA 2NOJB 2JVHA 2WY7Q 3D5SC
chains in the Genus database with same CATH superfamily
1KONA 2GXGA 3VDXA 1OKRA 3RKWA 3FXOA 3OOUA 2MSYA 3PL8A 5IOZA 3TBIA 4FETA 2QGUA 2FUG2 3LQQA 2RAEA 3OYIA 3E6DA 3OIOA 4A3KJ 5DTDA 5FLMJ 2HEOA 1N78A 3H3UA 2JK3A 3K4MA 3DQVC 4HX4A 4OWRB 2Z9OA 3G3ZA 2GIVA 1XN7A 3OYEA 2BW3B 4BEHB 1DGRM 2IRFG 2BY0A 3S16J 4TV7A 1APLC 3BDDA 2CQQA 3FHNA 3VB2A 4MFEA 2ZJ2A 1ERDA 2BY1A 4S0HB 2BY3A 1ZTRA 2MD5A 3SDBA 2OD5A 3FZVA 3KZIC 4ANJA 2E36A 1ETYA 2Y69H 5K5RA 3L2VA 3T5XA 2KRHA 3OYCA 1VQMI 3WHBA 4CCMA 1NTCA 5EYRA 4E7ZA 4M73A 1TW2A 1BW6A 2L4AA 4I98B 3WTSC 5FLXK 1GV5A 2PBIA 1HSTA 1OYIA 1ZELA 2W4SA 3VODA 3LSPA 3S3NA 1H88C 2LLKA 3V42A 3GXOA 5F64A 4A93J 2DPUA 2LK2A 2XF6A 3OS2A 4KA4A 1S72I 4ZYHA 4ZDOA 3D1NI 5F1JA 3F0CA 4E7HA 5BQTA 2TDXA 2XAHA 1PVEA 5JLXA 4IHXA 4HAMA 2KMUA 3MCZA 3W6KB 2EA4A 2RN7A 1FJLA 1D0ZA 3BY6A 1AKHA 2JA2A 1LE8B 2PLYA 1G2HA 4KIFA 1DPRA 2YSRA 3J81Z 2CW7A 1IV6A 1D8KA 1MBGA 3ABTA 2JT1A 4XRSA 3DCFA 3QQAA 4LK1F 5D5WB 3EETA 4QLCU 1LNWA 3V7CA 4Q5SF 2EIKH 1CF7B 3TO7A 3JAMK 2ISYA 5C3EJ 4UB8C 1REPC 4FASD 3CUQA 4LD5A 4M3EA 4ZYDA 4E7SA 4G9YA 2IVMA 3HRMA 1Y1WJ 1B72A 1WZ2A 2HVSA 1UHWA 2ESNA 1F5TA 4ZJZA 4M72A 2M3AA 4RA2A 3LL7A 2R7SA 1DQUA 3HB9A 1UG2A 1MNDA 2Q0OA 2XB0X 3BTLA 3AKZA 2NRAC 1J09A 1U9NA 5DUIA 1TWHJ 3ZPLA 3MVPA 1MBKA 4CGZA 4Q4ZF 1EJ9A 1ZGJA 5D5VB 1X4PA 3KZYA 3TOAA 4XLNF 2W48A 3SEZA 2FOWA 1IN6A 4EATA 4NQWB 4FISA 2V4JC 5HDNA 3BJOA 4U7BA 1T95A 1OCOH 2XGCA 3GZNB 2VIXA 4I02A 1D1BA 1OPCA 3QU6A 4R79A 3JW4A 3NRVA 3O8GA 3C1DA 3KEOA 4QTRA 3QU3A 2K86A 3ZRGA 2K27A 1XGMA 2DLLA 5CJ9A 3OYDA 3RSNA 1FOKA 4HDUA 2AO9A 2KIFA 1NK3P 2IGKA 2RGVA 2EZHA 2LOOA 3K2AA 3CMMA 5IY5H 3D0SA 2F4OB 3I5UA 3FHZA 1IDYA 1HC8A 1E3PA 2CW0F 2R7DA 5LBQA 5ICGA 5AONA 2COMA 4I6ZA 3GF2A 1J9IA 1VTNC 1D8JA 4LG3A 4ESBA 4J01A 2ESHA 2JA5J 3C3WA 4CH7A 4XMYA 3HOTA 1GVJA 4YFKF 2V9KA 2ZFWA 5IP7J 4ZZDA 4XLEA 2FE3A 1EH6A 4MEYF 1VI0A 1G4DA 4IO9F 3OOPA 1Z77A 3U9GA 1VNDA 1X3UA 2MLGA 2V6CA 4BAYA 2F5EA 5BS6A 1X19A 4B3XA 1QGPA 3CCLI 4FX4A 2VKHA 3VYRB 2LKSA 3P9KA 1YRNB 2BEOA 3LA3A 5CVUA 3KPHA 3TP3A 1Y0NA 5CVIA 2K7LA 1D1AA 4U87A 5FB2A 3HL2A 1FOYA 1HF0A 1FMWA 3OR1C 5DUKA 1FTZA 2F48A 4CCLA 4GRIA 2ECCA 2DT5A 3FXLA 2EH3A 3KP5A 1O57A 3M8EA 2G7UA 1G6NA 3LSRA 4IHWA 1FP2A 3IV5A 3WG7H 4ETSA 2E1OA 2L4MA 1ODDA 2ICWG 5BMZA 2VB6A 4BXFA 2ACJA 1R1UA 4UUVA 2BE5F 1VQOI 5DCMA 3CMAI 3QOEA 1UMQA 5LHIA 2O5RA 4XKWA 1WJDA 2BYVE 2G7HA 5HLHA 2CWEA 1MNMC 2QA4I 1LFPA 2KHMA 4IOAF 4IVNA 1RR8C 2V9VA 2VQGA 4M9ZA 1MD0A 1MIJA 3FK6A 4LB6B 2VC0A 4CYCB 1O3RA 3QYFA 3SZTA 4JBAA 4MLOA 1SFEA 1ZRFA 3I55I 4HG2A 3BJ6A 3IAS2 3V7RA 3QYBA 1YIOA 1BW5A 4XN0A 4IF4A 3L2UA 2Q2EA 4BACA 4M3BA 2IAIA 2RNJA 1TP4A 3E97A 2HPIA 4NC8A 1ZREA 3CUQB 5HVQC 3L00A 2W00A 4L5IA 2A68F 3JREA 2Z3YA 3IKVA 1B72B 3OY9A 3FIWA 4HF0A 4D9JA 4GFBA 2PJRB 1TT0A 2IS2A 3GWZA 2CMPA 2LG4A 1F9NA 5M5YJ 4JQFA 1YJNI 3LMMA 4RB3C 1PUFA 3BZ6A 2I10A 2V26A 3D5SC 1RR7A 1YTYA 4NHJA 1OYYA 1IN4A 3H3ZA 1ETVA 2KIUA 4XRFA 4UVAA 3ULQB 2Q8KA 4UNOA 2LF8A 2AS5F 2EIJH 2HWVA 3JRIA 4G8XA 1G59A 5FRNA 1I6XA 2LKXA 3I3LA 1H9TA 2G9WA 1PYVA 1KU7A 4M3FA 3WTXC 5K7FA 2NAZA 2HYGD 1FMVA 3V4GA 1BR4A 3GFLA 4C3HJ 4AIJA 3BP8A 1IDZA 1ZRDA 1TT5B 2OBPA 4D7MA 4GCVA 4KMUX 3ECHA 4QSHA 2F5CA 1PDNC 2VT2A 1R36A 4L18B 3JSOA 2VKDA 2DFEA 2LRDA 5E3LA 5D4RA 1K78A 1AWCA 5F08A 2FBHA 1YHQI 2VONA 1YFHA 2MA3A 2M8EA 1YS6A 3RJPA 4X1EA 4P9UA 1VFCA 3L2WA 2N8GA 5L3GA 3ZMSA 1L0OC 3DFGA 1D3YA 4KIBA 3DF8A 1MBFA 2DMTA 1E2XA 3LSHA 4YIFA 3RKYA 3M1EA 1VQ9I 3WG9A 1JGSA 3GO5A 4BUPA 3N05A 3DU6A 4IZZA 3DKWA 4ZTJA 2XDVA 4RGRA 1G3YA 2E7XA 1JT0A 2QBYB 1SMTA 4ENKA 1N25A 2A6HF 2RVCA 3TDUC 3HEFA 1GXPA 4EM1A 2XASA 2P5LC 1RUNA 2IBDA 2PMHA 2QCOA 3BTIA 2RQPA 2VQHA 1JKQC 2ZNYA 1LUJB 3TKYA 2E7WA 2OV7A 4RMNA 4A3LJ 4JK1X 3P9CA 1R5HA 3A01B 1LDDA 3FMRA 1TWGJ 2W25A 3U21A 4XSZF 2XAQA 4NBQA 2Z2SB 2NS8A 4I99C 1JGGA 2ZKZA 4Q48A 2IXSA 1HQCA 3EUHC 5IYDJ 3KCCA 1DU6A 4EMSA 3KP7A 2XAUA 1Z67A 4YIIA 5JR3A 5EG0A 1DDNA 3MKWB 2KZVA 4ZDPA 5LGNA 2L9RA 2EZKA 2WV1A 2A6TA 4C3JJ 1VZ0A 3AFHA 4A2UA 4G6TB 4EQQA 4AM3A 2MBFA 2VOOA 3ZMDA 3M07A 3CTAA 1HW1A 2EWNA 2EZIA 5EF6A 4BE1A 1JKPC 1GHCA 3S1RJ 5KAIC 2R92J 5DYMA 2YU9J 3ZQFA 2K4BA 2OCEA 2M9HA 1UCRA 1SFKA 2P6TA 2BY2A 3QODA 2HOEA 3CF5F 3IUOA 2HS5A 1U8BA 3MAJA 1Y6IA 1R5ID 2A6EF 2ISZA 4U0VA 1YG2A 4I01A 3A4CA 3Q0WA 1HKSA 2IGMA 3EUKL 3Q0UA 4XKBA 3HPHA 5DV5A 3S32A 3GZ6A 3TW7A 3I59A 4KNYA 2KFDA 3BR1A 1NG6A 4F93B 2VE8A 5B66C 2XGDA 4OU0A 1BC7C 5FKKA 3G1OA 1I1GA 4AWXB 2F5DA 5D6FA 3V8JA 1BC8C 2L54A 5ICCA 1S29A 4LFUA 3SFIA 1QQIA 5FLVA 3C7JA 2Y31A 3I58A 1V5GA 1WJCA 4JX5A 2M0MA 4OAYA 3DLLF 4I7HA 5DD4A 2V1UA 5TRDA 1MJ9A 3DU5A 1W5CC 3U1KA 3Q3SA 2OA4A 2PI0A 2KIMA 2CJJA 2EV0A 2FQ3A 2VJIA 1VQ7I 3HOSA 1TWCJ 2NVUB 1BJZA 2KZGA 3RQ4A 4BEHA 5C4XJ 2PFBA 2YU3A 2WADA 3KP3A 2LY2A 2XUBA 2GA1A 4U0WA 4UV8A 3OYAA 4BHPA 1VQ8I 2E2HJ 4WK8F 1BOAA 3FBNB 2JPCA 3IWFA 1LFBA 4A3GJ 3I54A 1OR7C 5HLIA 1HW2A 4W1UA 1JJ8C 3W2WA 3JRHA 3HTUA 1USSA 2CRGA 4LG0B 3BR0A 2EPFA 2E5NA 2VN2A 2Q1ZB 4A5MA 2LC2A 1SAUA 4ESJA 1KYWA 4CICA 2JUGA 2QQ9A 3K4LA 2X4HA 3E6BA 1SVMA 4CO8A 4D1QA 1JUMA 2HYFA 1XDUA 2L7MP 2J5OA 1V5EA 4JX4A 2M2EA 5F6FA 4G7OF 4PSWA 2GIZA 3OIPA 2D1VA 1FBSA 2DU9A 3WTZA 4HQEA 3J7YJ 1QHGA 5GTIC 3CD6I 5H20A 2OPTA 2ZC2A 2BVMA 4C2TA 4Y52J 3J7AO 3N4MA 1H9GA 1RRJA 4G12A 1GT0C 2XKPA 3HOVJ 4R1HA 1OCRH 2QENA 1R7JA 3RCOA 2O9LA 2E1NA 3ZN0A 4XN3A 4M71A 1EA3A 4LB5A 4ZDLA 1TNSA 3GLLA 3A02A 3OYKA 2OTLI 1LQ1A 2DI3A 3M1CA 3SQNA 1Z6RA 5J6XA 5CPRB 2Y30A 5J1YA 1LE8A 2KL4A 5KK1A 3KYDB 1EKEA 3HUGB 1SANA 2O6GE 4XKCA 3WGGA 5EG0B 3FM3A 3GYHX 1FSEA 4QWQA 2DJNA 2A5WA 2PN6A 3SHFA 5IOYA 1RC9A 4HZFA 4CDGA 1ORKA 1W36C 1QBJA 3HZJA 3G2BA 1I50J 4CCKA 3F3XA 1CF7A 5CKTA 2QF7A 2LREA 2GOMA 3R4KA 3ML6A 1XX5A 2VASA 3E0JB 2F5FA 2CQNA 4ZYAA 3I9V2 2DCEA 3LSIA 1S5LC 5LHHA 5EEGA 4UV9A 2K4JA 3K4BA 1I27A 2X6YA 4DYCA 2XV4S 2OZ6A 3BR6A 4A3BJ 3G73A 5H2FC 1BOBA 5GAEJ 2XAGA 1J7KA 5GPAA 4U0YA 2D1HA 3TEDA 3GFMA 1TTYA 4W97A 2V6EA 3FXQA 4FTHA 3E5UA 2L5QA 3BR2A 3DPUA 3HOZJ 1GUUA 4L9NA 2RREA 3BQYA 4NQWA 2DYSH 4J19A 4DW6A 2DA6A 3PUBA 1U5TC 3B6CA 3C2GA 1S3JA 3KE2A 4E70A 4BGDA 5F1RA 5FKNA 5K7ZA 3JRBA 2ZMEA 2JA8J 2UXNA 2NVYJ 1SC7A 2IJLA 4IQJA 3WGHA 4LIUA 1I3AA 3MMYB 4GO1A 1FX7A 3BLYA 2UUZA 4KJZA 1UZCA 1WH7A 4AU7A 2HVQA 5J4VA 3ZMTA 4DJAA 1IN8A 3TDZC 1WHUA 4CCJA 1PP8F 3I56I 4DYRA 1JTYA 2EV5A 1LFUP 2L02A 2H1KA 4QPQA 3ABLH 1A35A 1ZRCA 1DU0A 2IGOA 3RZOJ 2OC6A 1OCPA 5L3BA 1U3EM 1DP3A 4HRIA 1Y56A 1YJWI 5GTHC 2MYSA 3G1MA 3ZGKA 2R7VA 4HW0A 4XOTA 2JZYA 3FX3A 3HRTA 1LDKB 2X1CA 4B09A 5JI6A 2GXAA 3SFZA 3ZOBA 1YRNA 5CVJA 3KFWX 4XKVA 2EFQA 2HXIA 2JQ7A 4BQAA 1B9MA 2K02A 2HZTA 1LVKA 3L9FA 1YOVB 1Z21A 5LRRA 2RC4A 3F9KA 1G3WA 1XCBA 2ECBA 1BI0A 2H6CA 2L01A 3REOA 3V7SA 1H0MA 4WXHA 3LSGA 4EGZA 1IUFA 2BHZA 2K9SA 3ELKA 2CU7A 3ZP5A 2O61A 1V5FA 4ZYGA 2EFWA 1WCMJ 1YX3A 1RI7A 4UVBA 4XOPA 4AUXA 3BPVA 2XF7A 2FF4A 4RLQA 4CSWA 1IRGA 4MTDA 4ON0A 1IXRC 2E35A 5IYCJ 3LSKA 3PSIA 1R22A 1ON2A 3GTKJ 1EF4A 3D5LA 4XQFA 2EBIA 5D5UB 3H36A 4DNCA 4HOBA 3ZQIA 3QRFF 1OYWA 1J75A 4A5NA 2WBMA 3CJQB 3W3CA 2ZXHA 4IHSA 2GOXB 5FROA 2HDCA 1A31A 3CMEI 2CUFA 4CYCA 5J3LA 2HR3A 4UB6C 5F04A 2B9SA 3MZ8A 1LPQA 1A6QA 1KU3A 4XK4A 1XMAA 1JUSA 2V79A 3E3VA 3E6CC 1ZR4A 2IT0A 4J00A 3H1CA 4OIRF 2Y75A 1ETOA 4LOCA 2KLOA 1YIJI 1V4RA 2OUMA 3ZQHA 4AIKA 4PJMA 1GVDA 4RB2C 2WB1N 1EH8A 2WAQN 3HSEA 1ITYA 3ERMA 1A36A 2P8TA 2GZWA 1U0JA 5HS8A 3H5NA 1W4MA 2CV0A 2QKMB 3G71I 2RKHA 3HXLA 1ZLKA 2ZXWH 2DN0A 2VT3A 2FBKA 2MG4A 4CXFA 3LA2A 2FBIA 1IC8A 2X51A 3IC7A 2PJRA 3GTGJ 4EV0A 2ZB9A 3NWTA 4RB0A 1J2XA 2E1MC 4Y33A 1A5JA 4XRSG 1KU9A 2CGPA 2HZDA 1XPXA 1MBEA 1ZAOA 2GQQA 3SZPA 3SYTA 3CP2A 5GAHJ 1YO5C 2X6XA 4M9XA 1IRXA 2NYXA 3J7ZI 2CUEA 4YG2F 3T8RA 3CCMI 1IN5A 4X0GA 1TBXA 2ID6A 2GM4A 4AVPA 3CCEI 2K85A 1E17A 1S6LA 3QYEA 5HNFA 4IRIA 4L0YB 1FYMA 4HQMA 1VQ5I 1X4OA 3H0DA 1MGTA 4RGSA 4RGUA 4XBFA 5BPDA 2HPMA 1TC3C 2XRNA 2ZMEB 1RPWA 1BI1A 4YELA 2YS9A 3O2PE 2PX9A 2WB1A 3IWZA 5HS9A 2WAQA 5JLWA 1XDSA 3LSJA 2CH0A 2GWRA 4E7IA 4IHTA 2W7NA 1T38A 1X1AA 5EEAA 3A03A 2L7KA 1D0XA 1SMYF 2BV6A 3OSGA 2DO7A 2GXBA 1X3WB 1VQLI 2H09A 1FNNA 4XICA 4DZPA 3GX4X 2A05A 1FBQA 2EA2A 3K10A 5EEHA 4UUTA 1S8NA 3NAUA 2DTRA 6PAXA 2HVRA 1B6AA 2ZSHB 2ZJPF 2FXAA 1H89C 2QUFA 3AG2H 4OOIA 3K1MA 3A1YA 3FISA 1U6GA 3S2DJ 1J59A 5IYBJ 4ENNA 2B0LA 2IS4A 3ZQLA 4MEXF 3ABMH 3I53A 2M5WA 3IH2A 2K9LA 3IP4B 3RPUA 2WTEA 1BR1A 3VWBA 4XM3A 2WAFA 2QBYA 1Z3YA 2KDOA 1YYVA 3OS0A 1KZHA 3S2WA 2DBBA 5KCMA 3QPHA 5E18F 4CCNA 1MMDA 3BG9A 2P7CB 2XKOA 3K9TA 4BHBA 2XAJA 3S2HJ 1X2NA 3KYLA 1ZGAA 2X48A 3ESWB 4N4NB 3WE3A 2RDPA 3IAM2 5ILUA 4BNCA 3OYLA 2M45A 2P5KA 2VBYA 3BCAA 1IAWA 2IS1A 2O0YA 3A01A 5D6EA 4DYQA 1FYLA 3LA7A 2OTJI 2K3FA 3HOXJ 2L3DA 5GADJ 4KT5C 4RB1A 2JVGA 2H8RA 4L5EA 4MQ9F 1T0FA 1RESA 3GW2A 2VI6A 3X2QH 3TOBA 1I6HJ 2PG4A 3WTWC 3K4NA 3M8FA 3ZMZA 3MZYA 2L9SA 3FMQA 4XRMA 3ASNH 2DT7B 4EJOA 2EQRA 2H1LA 3CUQC 4B43A 3AG1H 1ZG3A 4PGHA 2DOFA 3SXYA 4K2EA 1YJ9I 3TP0A 3T8TA 5CVRA 1VQ6I 1TQMA 2WA0A 2L2OA 3W2AA 5DS9A 2X85A 3CC4I 5J40A 5JVTA 1RIOH 2NOJB 5F0CA 3RPQA 2Y9YA 3B6AA 4MIMA 3P5JA 4BQNA 3L2RA 5E3MA 4FQGA 3HHGA 1SVOA 3TMOA 1IJWC 1HDPA 2WC2A 1V54H 3ECOA 3PM1A 2XPUA 2ZXIA 4II3A 4BDZA 5LFAA 1R49A 3CCRI 3EPZA 1WI3A 4AYBN 1JT6A 2QLZA 3FXRA 1QVUA 1MMSA 1B4AA 1NK2P 1N75A 3E5XA 5HOOA 3ERED 1R5GA 1O3SA 2VJ5A 2LYCA 3OYGA 4XSXF 4X6AJ 2FD5A 4P5OA 1WRJA 2H94A 1IUYA 1E3HA 4ZYEA 2Y48A 3KZZA 2EV6A 2KQRA 4B44A 2CO5A 1GV2A 3BOQA 3BG5A 3K1PA 1D5VA 3GTPJ 2FOKA 4OMYA 1A6IA 4DQ2A 5IT9K 1R58A 3VEPA 2M4GA 4BJ6C 3CDIA 3ABUA 5IT3A 1EH7A 2LSOA 3K4CA 4UUSB 5GP9A 1P7JA 3H92A 3DKYA 1ZK8A 2O7OA 3PFIA 1WSUA 1FLIA 3JCUC 3JRFA 2OU2A 3B73A 4JOMA 4Y4RA 3QAHA 3VOEA 1MMGA 1VQ4I 3MEXA 2HNHA 1FSHA 3CDHA 2LKPA 4DGWB 4ASNA 1FYKA 3RIRA 3WU0A 2HOSA 3RYRA 4I0BA 4EM2A 1GDTA 3WE2A 4AYBA 3GTJJ 2F2EA 1SVLA 3K6GA 4F92B 2AQEA 2OCCH 5HS7A 5E79C 4WF2A 3PQKA 3OYBA 2HOAA 1WVRA 1MMAA 4RLFA 2OQRA 1FIAA 2DA7A 4G6QA 2IGNA 4LG0A 3I4MJ 3F6OA 2KJCA 1YW9A 2I5UA 3ZMUA 3ZQGA 2QQBA 2IS6A 2P81A 2DPDA 1U8RA 3OYNA 4U88A 1XMXA 2R5YA 3IRQA 5JVGF 1VQKI 3KYCB 1R71A 1T0FC 1HKTA 4A0ZA 1R23A 1XS9A 3QPLA 2M34A 3L09A 5GPCA 1U2WA 1H8AC 5BNGA 5L3EA 3BT9A 1AA7A 2Y0MA 3VYTB 2MH9A 4HBLA 4HYEA 2R3SA 4FE4A 4XLHA 1LKXA 1B8IB 2O8KA 5M3FJ 2CQKA 3KLNA 1P7IA 4S04A 3ZXSA 4JX6A 4FHTA 1XGSA 2A3SA 2IA0A 1Y8QB 4I09A 5F27A 3GMEA 1V3FA 1PP7U 3HHHA 1I5ZA 1Q1VA 1HXDA 3HUGA 1BR2A 4BHCA 1KU2A 5E3OA 1OCTC 5E1XA 2VE9A 3LWFA 2K3PA 2O8XA 4GYGA 1K83J 2L9VA 4PJNA 2K40A 4ITVA 2VLAA 3GZ5A 4M9SA 2P6SA 2Y0SN 3N97A 3HOWJ 4B47A 2DYRH 4MFDA 4CZZA 2BXZA 2MLKA 2ZSIB 4FT8A 3FBIB 1XCVA 1GLNA 4V2FA 2F4IA 3J80K 2EB7A 3PSFA 2BBYA 4RAZA 4EJWA 2DW4A 3K7AJ 4ABZA 2JRMA 1Z7UA 4Y3OA 4HNVA 3CCJI 2JN6A 4L5JA 3S17J 5JHUA 4JP0A 1DPUA 3QP6A 3CJTB 2NOGA 1NG7A 2KPMA 5FO5A 3CJNA 2VPLA 4IL6C 3H9JA 2QSFX 2FMLA 3RQIA 5K5QA 1Q1HA 4EJTA 5FGMA 4BDYA 3HSFA 4RS8A 5M3MJ 1T6SA 1XB4A 3IRRA 5H6RA 5CLSA 1IO2A 1SD6A 3MN2A 2Y2ZA 3A2KA 2DA3A 4BQQA 1IV8A 3GLXA 5IPAA 1IZ1A 1XGOA 2LR8A 1XSDA 4PFOA 1BBYA 4BBRJ 3JRDA 2DDAA 3DPTA 2E2IJ 1XGNA 2IW5A 3PQJA 4FE7A 4IEJA 4LK0F 2Y0SA 3DKXA 3CCUI 1XSXA 3FWEA 4M74A 2UWMA 1HKQA 4I76A 2PMZN 2UV1A 3OYHA 2BXYA 2FQ4A 5B3SH 4F52A 2W24A 4D5CA 1SAXA 3HOYJ 3BJAA 3H0GJ 2DQRA 2JSCA 1MBJA 2R7QA 5HDKA 1SFUA 3P7NA 4LJZF 3GVAA 1MZBA 4EVIA 3D5RC 2XVCA 2UZKA 1FOXA 1G3SA 2L7FP 3KEQA 2PEXA 2EILH 3SZGA 1ZR2A 3W2VA 2DA4A 1ETWA 3IKTA 4DOZA 1Z9CA 4FX0A 1WFXA 1O4XA 2FNPA 3L7WA 4IPAA 5IT9Z 2MD0A 2WY7Q 4KUMA 4B8XA 1WH5A 3TO6A 3DTKA 4R8HA 3HTSB 3G6EI 3SEQA 4L9JA 2GLOA 2HKOA 4C30A 4XLAA 2MC3A 4KITB 3F6VA 4Y7NJ 2ADUA 1S7OA 5ICEA 4KMFA 1FOWA 5BPIA 2DOAA 2YPRA 3CDLA 1DP7P 4GGGA 2YUSA 4L0ZB 1ETKA 4F7ZA 3HSRA 5J8CA 2R5YB 1SD5A 3WU1B 5E1ZB 2X1EA 1BM9A 4BH9A 3CZ6A 1F43A 4IRHA 2PMZA 4IX7A 4PK4A 1XD7A 1T08B 5F0FA 2Z99A 4XLPF 3WTVC 1WJEA 1JJ6C 1ZKGA 4IKFA 1CGPA 2CFOA 1FP1D 5HLGA 3NQOA 2DA5A 3R61A 5C4JJ 5BOXA 2HU9A 2HDDA 2JA7J 3GTLJ 2NS7A 1RNLA 4B48A 4A3CJ 2LTPA 1YX5A 4NUBA 1ZQ3P 3L1PA 4YFNF 4EGYA 4MTEA 3CLQA 4D5FA 4MO7A 2CV1A 2WV0A 5CQEA 3UR3C 3S1MJ 2BVLA 1FIPA 2DOEA 3L2QA 1W5TA 2V1NA 4UVCA 1IRFA 1GXQA 2GA2A 3DWLE 4G7HF 4XL9A 4BE0A 4XLCA 2EFOA 1Y0UA 2D5VA 1JE8A 2RQQA 3LQRA 4HA8A 2EZLA 3V8LA 1LEBA 2IP2A 2E19A 2CSOA 3GTOJ 3ZCOA 2ZJRF 2DT6A 5D4SA 1L3LA 1YITI 3NARA 1JKRC 3MKYB 3H3VK 1FT9A 2R5ZB 2DDBA 3KP6A 1FBUA 3AG3H 1VF9A 4KICA 3DEEA 1OLTA 3GUDA 4OIQF 2BOLA 2ID3A 1B59A 5LEKA 3JTGA 1QHHD 4HLYA 3PFYA 2FA5A 4B4CA 3S3MA 4XONA 5DEQA 2UXXA 4O5VA 1WGXA 5ED4A 5ICFA 4C3IJ 2QEXI 5J47A 3A0BC 2XPWA 1UFMA 4RAYA 3K0LA 1UHSA 2QSHX 2ELJA 3ONQA 3BG6A 1Z05A 3K4KA 3J80Z 2MABA 3O6BB 3MD2A 3U1DA 4BKXA 1RUOA 1K79A 4OINF 1STZA 3T0YA 1W0TA 3TO9A 4ZZLA 2JWTA 1K6OA 1R4NB 1YQAA 1FZPB 2CUZA 4PJ0C 2Z16A 2D2WA 1DUXC 1KA8A 4MHGA 1HSJA 3OYFA 5J1RA 3HGYA 3M8JA 1MBHA 3HRSA 3ZN1A 4BBSJ 3BCBA 1QRYA 3JTHA 5DM7F 3ZQ7A 3LAPA 3S93A 3HG9A 1E3OC 1LJ9A 3TGNA 3KETA 4BXXJ 3TQNA 2VBWA 4A3DJ 1SFXA 4ZTFA 3FXUA 2XSDC 2XHKA 1SFOJ 1SD7A 3G1LA 3OMYA 2IA2A 1SD4A 3BZKA 4OAZA 2KDZA 3AL0B 5F0HA 4MGRA 3BG7A 2V9PA 2YR2A 5FKMA 2KRCA 1P9QC 2QWWA 3I0TA 1E0EA 1MMNA 5E1WA 4HF2A 5AIQA 4JYKA 3F23A 2EINH 3DLAA 5TISC 3COAC 3CJRB 3CQZJ 4V2GA 2O3FA 1Y39A 1U5TB 4BY1J 2EFNA 3J7AY 1QZZA 2Y9ZA 1W1WE 2W84A 1ETXA 2IEKA 2IA1A 2CS3A 4Y17A 4PDKA 1EV7A 1KGSA 3KLOA 2Z5UA 1HDDC 5DCFA 5L3FA 2MGQA 1OQYA 3KP4A 2BHYA 3K70C 3OS1A 1R00A 3VFZA 2VBXA 4B3AA 2YX7A 2X9DA 5CVVA 1Z7LA 1HA8A 4GXOA 4N9IA 1MJAA 3BROA 2FX0A 4WXDA 5B5EC 3AG4H 2XPVA 4F3QA 1IW7F 3RDIA 4A3EJ 4KDPA 4Z6YA 2W85A 3G4SI 2KJBA 2CG4A 5LLQA 2Z33A 1ONVA 1MJBA 1USTA 2M0CA 2HFHA 3JRGA 3S15J 1UG0A 2R7OA 5A2QZ 4M6YA 1M1EB 1IG7A 2STTA 1HCRA 2TCTA 1X1BA 4L9VA 3PO3J 4HPQA 1S7EA 1RKWA 1WKMA 1TL8A 3VPRA 2V7FA 4EJVA 3DEWA 2K9NA 1ZYRF 2HKXA 2DMUA 3OR2C 4DBRA 3R6SA 3TW6A 5KHDA 2CV2A 1MDMB 1SEUA 4AIDA 3MWMA 1ACIA 5H6QA 1R1VA 5IP9J 4PCQA 1MW7A 2KISA 4A69C 3LOCA 3S14J 2LBFB 5E3NA 5GAGJ 4YFXF 3BTCA 3CCVI 4C9YA 3RZDJ 3S8PA 3FXMA 1F36A 2ME0A 2HI3A 1JHHA 3JSPA 1TLHB 4BXUA 1W7PB 4DIQA 2EIMH 2JSPA 3H5RA 4RAFA 4YIRX 2LMDA 4M6VA 1HOMA 2ZMEC 4G94A 2W82A 1ZGWA 1B1BA 3CESA 1QZYA 3S1QJ 1IXCA 5JFRA 3LFUA 1RZ4A 5J4YA 1UHMA 3CF2A 1O3TA 4LLGF 3FXKA 1KQ9A 2QQ8A 2VJ4A 4PSXA 5J8FA 2I8DA 4HX8A 3E6MA 5FFZA 4QPOA 1K4TA 1V55H 3WTYC 1RKTA 3M9AA 4S05A 5FFXA 4EJUA 3SJMA 2NNNA 5EGOA 2ELKA 2V1XA 5JHFA 1P4XA 3DBRB 4NC7A 4YEJA 1U9OA 3GFJA 4UUSA 2LD5A 2DA1A 2R93J 2VXDA 1WI9A 2FEZA 2VXZA 4HSRA 4EM0B 3HDDA 3BZCA 4D0PA 4AD9A 1KYZA 4CYDA 2DA2A 2XROA 2DFHA 1JUPA 4PUSA 4BYYA 4ZH4F 4E7JA 1Y1VJ 5AIPA 3BWGA 3WGIA 3FK7A 2R7TA 3OWTA 3LSTA 2FU4A 1W36D 1MH3A 2XC7A 1FPQA 2VOPA 2CQ7A 1YW8A 2E1MB 3KEYA 2ZCWA 4BQOA 1QA6A 2BGCA 2DODA 5ERIA 1FY7A 2H8WA 4V19K 2LF7A 2O03A 3UKGA 4HDVA 3C2BA 3B02A 1UJ8A 2RV8A 2V1DA 1J5YA 1QZEA 2JMWA 2HGCA 3MKZA 3PO2J 2AHQA 5TJJA 2WWYA 2F4MB 4LGWA 5M5WJ 4N0BA 1QNTA 1T98A 4Z2YA 2COBA 1T56A 2ZNZA 1JI8A 4HV6A 2XGXA 1JHFA 2E60A 2A5YB 2LP0A 2QVOA 2M87A 2FJ1A 3RKQA 2EK5A 1ZH5A 2PQ8A 2DMQA 2CQXA 2L0KA 2E1CA 3HKZN 1CQTA 2R7FA 4ZC3A 1LEAA 2K9QA 1LDJA 1B8IA 3CP8A 1P6RA 1K61A 2DK8A 2VL8A 4QIWN 5FKOA 4L9TA 1X1PA 3KP2A 4UXNA 1PJRA 4G6DA 4P55A 3RTRA 5K5OA 5KNLA 4C2UA 2G0EA 3W6JB 2R4GA 1ZARA 5FD5A 4A3MJ 4HX7A 4NNJA 3PNTA 4YRVA 4H0EA 2CYYA 1JXSA 2DAOA 3RKXA 3HGGA 3ROUA 1UAAA 1JTXA 1XG1A 3BR3A 3WODF 3WTUC 2HQRA 3UNGC 2DMPA 1TZLA 5E20A 4M3GA 5FRMA 1OMIA 1POGA 2XSJC 3TL4X 3ASOH 4A12A 1WQ2A 5D8KB 2HOTA 5LHGA 1QVTA 1BI3A 3IH4A 2QYOA 5ILSA 4MQVA 4HV5A 4KN4X 3S1NJ 1KQ8A 3CUOA 1IN7A 1BI2A 1XTAA 3GBGA 2P0WA 2W1OA 3R60A 4PZJA 4PFPA 5FLXZ 3JR9A 1MKMA 1P4AA 2M8GX 1AKHB 4IJAA 3EDPA 3HKZA 2VUMJ 1IGNA 1T33A 2CW8A 4A0YA 1ETQA 4M6XA 4RGXA 2LVSA 2WAEA 4O3MA 2LFBA 5M5XJ 3F72A 1U78A 2ZXJA 2GAUA 1G8XA 1S7AA 2EFPA 5E8GA 1P4WA 5LGTA 4OIPF 3EUHA 1ULYA 3K70D 1YI2I 1ZG5A 1OJLA 2R7WA 4O6JA 3LNQA 3F8BA 3ISPA 1P92A 3C2HA 2JTVA 3DEUA 2HXOA 2JRTA 2X1DA 2A61A 1WWXA 4A6DA 2JPBA 1WJFA 3O8HA 4A3IJ 1W7PD 3CMYA 1J0RA 4B1RA 1HLVA 4CCOA 2X6WA 3MZHA 5DM6F 3FMSA 5EGOB 1MH4A 1T8IA 1I3QJ 3W6VA 2XB5A 2KP6A 1WJ5A 1LB2A 4PJLA 1BJAA 3PNYA 1O7FA 5EZGA 1F4KA 3QP5A 3JRCA 4UHTA 5LGUA 4HEA2 4ESFA 2W57A 3OIQA 2F5VA 3DPLC 3A0HC 3BTJA 4OIOF 1Z91A 3M3YJ 3JAMZ 5B1BH 3IHUA 2XF5A 2HQ5A 3DXJF 1X1CA 2E34A 3BC8A 1MNEA 3E7LA 1D0YA 5D8LB 2IPQX 3OYMA 3PJRA 1FTTA 1QU3A 1X2MA 4IXAA 3V8KA 4WWCA 5IP6A 3JRAA 3C18A 3GTMJ 4HLXA 3FF5A 3SDGA 1YS7A 3F8NA 4DZJA 2MC4A 3F8MA 3P9IA 4IQ4A 4RAGA 3PNVA 4A0XA 3H9QA 3BG3A 3HYIA 1X1DA 2JVHA 2NVTJ 3S3OA 4M3DA 3R0JA 1PUEE 3BR5A 3DV8A 3FM5A 1UELB 3LSMA 3QOPA 2OZUA 2OF7A 3MFKA 2XGEA 1C0WA 4HNTA 4OMZA 4PGGA 1QPIA 2JA6J 3ZR8X 5FD6A 1B9NA 3E1SA 4CA0A 1AU7A 1YE9A 2M7BA 3HC7A 4BL0B 2XAFA 4C2MJ 4E4HA 2ZJQF 2STWA 1VQPI 2QSGX 5L3DA 4I2OA 1OR7A 2LH9A 3M7GA 4IHVA 2VJJA 3IH3A 4II2A 1KQ0A 1VQNI 1BIAA 3I71A 5E8IA 2F6CA 3I4PA 4GDFA 4WCGA 1F1ZA 3WU2C 1T39A 1X3ZB 1I39A 1O7LA 3O3KA 5DCMB 2VPRA 2EJRA 1XMKA 2VQCA 3ZQQA 2VKEA 1R9TJ 3BPXA 4LLLA 3VYSB 2QZ8A 2HQNA 5HODA 5CYVA 1I1SA 1ZLJA 2YX4A 2DK5A 4HSTA 4AC0A 2DMNA 1AHDP 2KIQA 2R5ZA 1N77A 2R7UA 3NWSA 3KIOA 4Y13A 4IOCF 2VKVA 1BL0A 1R1TA 1LVAA 3EYYA 2DJIA 2AXLA 2A07F 1HBXG 3Q5FA 5ILVA 3RI4A 3MQ0A 2JJ7A 3F8CA 2TRTA 3FKJA 5K7HA 1FEXA 5D5XB 1OCZH 2QM3A 5CQGA 4EEFG 2OQGA 1FC3A 4KISA 2ME6A 2ETHA 3CLOA 2C6YA 3VSLA 4KFCA 3PIPF 2Q2EB 5EZHA 1ZHFA 1D1CA 2QQAA 2VBZA 1TQPA 4PJJA 1ON1A 1W5SA 2HYJA 4LMYA 1TWAJ 4DBQA 5LEJA 1G3TA 3OL3A 4NC6A 5LD2C 4Y15A 4P1WA 1A04A 3CCQI 1OCCH 4UY8I 1P2FA 2KKOA 5HNHA 2R0QC 4E6KG 4LITA 4WX9A 1PUFB 2M1BA 4RM3A 3T1BA 3CO6C 5KVRA 3Q9SA 3OYJA 3CC2I 4F55A 3F22A 1Y8RB 2LDUA 3PIOF 3AAFA 3ABKH 2NVXJ 3I64A 4KYWA 2D45A 4A3FJ 3F21A 2LY9A 4HNUA 1XC5A 5HLTA 3KX2A 3H9GA 2NVQJ 2K5CA 5DD8A 1OISA 2FNAA 3FDYA 1DGWY 2LNBA 3CCYA 3R0AA 5K1YA 4RBOA 3M4OJ 4A3JJ 2E5ZA 3ZMVA 3QPTA 1TWFJ 3K1NA 3CO7C 4KIGA 2CUJA 3CCSI 2WY8Q 3U2RA 1MSFC 2ZFUA 3WHCA 2X0LA 5L3CA 3K2ZA 2FMYA 4RM2A 2X6OA 2DTZA 2MW8A 1TNTA 5FKLA 2LY1A 3DBHB 4CUGA 3HBLA 4P96A 1Z1DA 1BIBA 4N4OB 1U5TA 4F91B 4MNUA 3Q9VA 2L7ZA 3OL4A 2BW3A 2DFIA 2QKLB 2B63J 2R7RA 1K78B 3GEZA 5A2QK 2M4KA 2HQAA 2OJED 3QWLA 4BU2A 2K9MA 3VSKA 4IRGA 3EYIA 2FRHA 4XNFA 1YW7A 4BJ5C 3RYPA 2L9NA 1WJBA 4AIHA 3DTIA 1IF1A 1TQIA 1IRZA 4A6EA 4CHUA 2A69F 3PUFA 2DQLA 3K4JA 2R7ZJ 3GCMA 4N9HA 5FJ8J 4E7KA 2M7AA 2B7EA 4RDUA 2NNYA 3FKIJ 4NDLA 4BE2A 3DP7A 2BZTA 5TGTA 5DDGA 4GYIA 3J81K 3BQZA 4ENMA 3IL2A 2ZBKA 3GTQJ 1MSEC 2ELHA 4NB5A 1XSVA 3OV8A 3OSFA 1RETA 4LLNA 4BY7J 3RPUD 4KN7X 2NS0A 2M30A 3QPSA 3L2CA 9ANTA 1ZN2A 2HTJA 2MH2A 2PMUA 1BA5A 4H4KC 1TW3A 2HTSA 3WTTC 3LFKA 5B1AH 1S9HA 2E2JJ 2E71A 2NXNB 2PJPA 1WJAA 1MDMA 1X58A 3HPGA 2DFFA 4CZCA 3E5QA 3LAJA 4FCYA 2RNGA 2LBFA 4XORA 5EJCA 4G7ZF 1T2KA 2H27A 5J1UA 1BN5A 1QPMA 3CC7I 4BS9A 1ENHA 3HOUJ 3HJEA 3H5AA 1HW5A 2CFXA 4U7DA 3GFIA 5HDGA 1W7PA 4XLFA 2AQFA 1WPKA 4XIDA 4IHYA 3EUAA 4E7LA 1K7AA 2DXIA 1O3QA 2Z1DA 1JKOC 1R6RA 3MKLA 5E17F 1YLFA 1K4SA 1FWZA 5EDNA 5LRSA 5C44J 3F8FA 1ZG1A 2XIGA 4HF1A 3VYUB 3HIFA 2KRFA 2AXTC 3DBLB 1Z6TA 1OFCX 1UB9A 4I0AA 2VQLA 3NEUA 4BJTA 2GBYA 4KT6A 1W0UA 3EQLF 1NH3A 2ZO4A 2XRLA 3H35A 2MFZA 4D7NA 1D5YA 3AL0C 1IXSB 3HM5A 2J5PA 2R7XA 3FXJA 2VC1A 5KAFC 4ENJA 2P5VA 4P9FA 4LIVA 1AOYA 1R4MB 2HDWA 3HRUA 2P7VB 2JUCA 2KT0A 2P4WA 4Q47A 3I59B 3Q0VA 4XR6A 3I4NJ 2VODA 3ZQCA 1Z3XA 4WXCA 1NHAA 3K69A 1K6YA 1Z0XA 4AVZA 2H6BA 2FSWA 3DTEA 2OAZA 1QO0D
chains in the Genus database with same CATH topology
2XC7A 4DGWB 1KONA 2E1MB 3DU5A 3VDXA 3KEYA 3OOUA 4BQOA 3PL8A 4AYBA 3TBIA 4FETA 3K6GA 4F92B 2VJIA 2AQEA 3HOSA 2FUG2 3OYIA 3RQ4A 3OYBA 4BEHA 1N78A 3MKZA 3K4MA 2WADA 1MMAA 3DQVC 4RLFA 2LY2A 3OYAA 4OWRB 2IGNA 3FBNB 3OYEA 2BW3B 4BEHB 1DGRM 1OR7C 3W2WA 1JI8A 2IS6A 2E60A 3OYNA 2E5NA 3FHNA 2Q1ZB 2LC2A 1SAUA 1ERDA 2JUGA 3SDBA 3K4LA 1T0FC 4D1QA 4ANJA 3L2VA 1V5EA 2KRHA 3OYCA 4CCMA 4ZC3A 4E7ZA 4PSWA 3OIPA 3CP8A 2VL8A 1AA7A 1QHGA 1ZELA 2W4SA 3VYTB 5KNLA 3RTRA 4C2UA 1PJRA 3S3NA 2BVMA 4XLHA 4C2TA 1LKXA 2R4GA 3V42A 4NNJA 3PNTA 2XF6A 4YRVA 3OS2A 3RCOA 3ZXSA 1UAAA 4ZDOA 4XN3A 1EA3A 4ZDLA 4E7HA 3OYKA 3UNGC 1TZLA 3M1CA 1BR2A 5FRMA 2XSJC 2KMUA 5CPRB 3TL4X 2K3PA 2KL4A 4PJNA 1D0ZA 3HUGB 4ITVA 2VLAA 4XKCA 2HNHA 2JA2A 4B47A 2A5WA 3GBGA 2P0WA 2W1OA 2ZSIB 4PFPA 2CW7A 1W36C 3FBIB 3G2BA 3HKZA 4CCKA 1GLNA 2CW8A 2F4IA 5CKTA 2LREA 3PSFA 2GOMA 2WAEA 2VASA 3E0JB 4ZYAA 4Y3OA 3I9V2 1G8XA 2DCEA 3LSIA 3K4BA 2X6YA 1NG7A 2KPMA 4FASD 2VPLA 3K70D 3H9JA 4E7SA 2R7WA 1BOBA 3C2HA 4BDYA 2HVSA 4ZJZA 2X1DA 2M3AA 3LL7A 2R7SA 1WJFA 2V6EA 1DQUA 1MNDA 3A2KA 3AKZA 4CCOA 1J09A 2L5QA 2X6WA 4BQQA 3DPUA 4PFOA 2RREA 2KP6A 1WJ5A 3DPTA 4PJLA 3PNYA 1X4PA 2Y0SA 3DKXA 3SEZA 2UWMA 3PUBA 4EATA 4NQWB 3C2GA 4BGDA 4HEA2 3OIQA 2V4JC 4U7BA 2UV1A 3OYHA 2F5VA 1T95A 3DPLC 4F52A 2VIXA 1D1BA 4R79A 4IQJA 4LIUA 2R7QA 2XF5A 3MMYB 3ZRGA 1X1CA 3BLYA 3D5RC 2UUZA 3BC8A 3RSNA 3OYDA 1MNEA 4KJZA 1D0YA 2IGKA 4AU7A 2HVQA 3OYMA 2LOOA 3PJRA 3SZGA 4CCJA 4DJAA 3W2VA 3CMMA 1QU3A 4DOZA 4QPQA 1WFXA 2MD0A 2WY7Q 2IGOA 4LG3A 2OC6A 4J01A 3DTKA 4CH7A 1DP3A 4XMYA 4HRIA 3HOTA 3SEQA 1Y56A 2V9KA 2MC4A 4C30A 4XLAA 2MYSA 3ZGKA 4IQ4A 4KITB 3PNVA 2R7VA 4XLEA 4XOTA 3H9QA 1LDKB 2X1CA 1X1DA 2DOAA 2JVHA 4XKVA 3S3OA 1LVKA 1X19A 4B3XA 1Z21A 1UELB 2VKHA 3LSMA 3VYRB 2X1EA 3F9KA 3CZ6A 2PMZA 4IX7A 4PK4A 4HNTA 1WJEA 3LSGA 4IKFA 3ZR8X 1D1AA 2CFOA 4U87A 3HL2A 3E1SA 4CA0A 1FMWA 3OR1C 1YE9A 1V5FA 2M7BA 2HU9A 4CCLA 3HC7A 1YX3A 4GRIA 4BL0B 4XOPA 4B48A 4E4HA 2XF7A 4RLQA 1YX5A 4NUBA 4CSWA 2LH9A 2VJJA 2VB6A 4BXFA 4II2A 3LSKA 3PSIA 2CV1A 3QOEA 5CQEA 3UR3C 2F6CA 2BVLA 2O5RA 3D5LA 4XQFA 3L2QA 2V1NA 4XKWA 3DWLE 1WJDA 2WBMA 3CJQB 4XL9A 2ZXHA 4XLCA 3W3CA 4BE0A 2GOXB 1LFPA 5FROA 2VQCA 3ZQQA 2KHMA 3VYSB 2RQQA 2VQGA 4J00A 4HSTA 2KLOA 3QYFA 3ZCOA 1N77A 2OUMA 2R7UA 2DT6A 3NWSA 4MLOA 4PJMA 2DJIA 3MKYB 4HG2A 1U0JA 3H5NA 3IAS2 3QYBA 2CV0A 3DEEA 1OLTA 2QKMB 4XN0A 3FKJA 3HXLA 3L2UA 2BOLA 4BACA 5CQGA 1QHHD 3PFYA 2HPIA 4NC8A 3S3MA 4KISA 5HVQC 2X51A 3VSLA 4XONA 2W00A 2PJRA 2Q2EB 3NWTA 4Y33A 2E1MC 1D1CA 3OY9A 2HZDA 4D9JA 4PJJA 2PJRB 1TT0A 3SYTA 2IS2A 3CP2A 2CMPA 2LG4A 2X6XA 4JQFA 1IRXA 3LMMA 2ELJA 4DBQA 3ONQA 3D5SC 2V26A 3OL3A 5LD2C 4X0GA 3BG6A 3K4KA 4P1WA 2MABA 3MD2A 5HNHA 4E6KG 3QYEA 4LITA 5HNFA 4RM3A 1X4OA 3H0DA 3OYJA 4F55A 2CUZA 1G59A 2HPMA 5FRNA 2Z16A 3I3LA 3OYFA 1PYVA 3M8JA 4HNUA 5HLTA 4YELA 3BCBA 2WB1A 3H9GA 3KX2A 2WAQA 2K5CA 3FDYA 3S93A 1FMVA 1DGWY 1BR4A 3HG9A 2CH0A 4E7IA 2W7NA 2E5ZA 1X1AA 2CUJA 2L7KA 1D0XA 2WY8Q 2ZFUA 4ZTFA 4RM2A 3OMYA 3K10A 2LY1A 3AL0B 2VKDA 4OAZA 4CUGA 2LRDA 3BG7A 2HVRA 2ZSHB 2KRCA 1P9QC 1E0EA 3A1YA 4N4OB 1MMNA 4F91B 2IS4A 3OL4A 2BW3A 3DLAA 2QKLB 3CJRB 3L2WA 2R7RA 2K9LA 3IP4B 2M4KA 3J7AY 1BR1A 2HQAA 4XM3A 2WAFA 3VWBA 1Z3YA 2KDOA 4BU2A 2K9MA 3LSHA 3VSKA 3OS0A 2CS3A 4XNFA 5KCMA 4BJ5C 4BUPA 4IZZA 2L9NA 1WJBA 3DU6A 1MMDA 3DTIA 3N05A 2XDVA 4CCNA 4ZTJA 3KYLA 4N4NB 3K70C 3IAM2 3OS1A 3OYLA 3K4JA 3BCAA 4E7KA 2M7AA 2IS1A 1Z7LA 1HA8A 2VQHA 4BE2A 5TGTA 4F3QA 2OV7A 4RMNA 1MMGA 2JVGA 3U21A 3RPUD 3K4NA 2Z2SB 1UG0A 2R7OA 2L9SA 4H4KC 2IXSA 2DT7B 1X1BA 3EUHC 4HPQA 1S9HA 4B43A 1WJAA 2V7FA 2XAUA 3HPGA 4CZCA 3MKWB 2KZVA 2WA0A 3OR2C 2RNGA 2L2OA 2LBFA 4XORA 4ZDPA 4DBRA 5KHDA 2CV2A 3W2AA 2X85A 2A6TA 4BS9A 1VZ0A 3AFHA 3H5AA 1MW7A 2NOJB 4G6TB 4BQNA 2LBFB 3L2RA 4XLFA 2AQFA 3TMOA 4C9YA 3EUAA 3S8PA 4E7LA 2ZXIA 4II3A 4BDZA 4BE1A 2DXIA 5LFAA 2Z1DA 4DIQA 1R6RA 3EPZA 2JSPA 3H5RA 2W82A 3CESA 1SFKA 1N75A 3LFUA 5HOOA 3QODA 3VYUB 2VJ5A 2LYCA 3CF2A 3OYGA 3IUOA 1Y6IA 2VJ4A 4PSXA 2I8DA 4P5OA 2VQLA 4QPOA 4BJTA 3A4CA 2IGMA 4KT6A 3EUKL 2KQRA 4B44A 5JHFA 4XKBA 3HPHA 4NC7A 4YEJA 3S32A 3H35A 2MFZA 3AL0C 2R7XA 1NG6A 2M4GA 2VXDA 4BJ6C 4F93B 2VXZA 4HSRA 4LIVA 3K4CA 2HDWA 4PUSA 3DKYA 4XR6A 4E7JA 1Z3XA 2R7TA 1K6YA 3OWTA 4JOMA 4AVZA 1V5GA 1WJCA 4Y4RA 2M0MA 1W36D 4OAYA 3DTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JVG A;  2WY8 Q;  3D5R C;  2GOX B;  2GOM A;  2NOJ B;  2JVH A;  2WY7 Q;  3D5S C; 
#chains in the Genus database with same CATH topology
 1KON A;  2GXG A;  3VDX A;  1OKR A;  3RKW A;  3FXO A;  3OOU A;  2MSY A;  3PL8 A;  5IOZ A;  3TBI A;  4FET A;  2QGU A;  2FUG 2;  3LQQ A;  2RAE A;  3OYI A;  3E6D A;  3OIO A;  4A3K J;  5DTD A;  5FLM J;  2HEO A;  1N78 A;  3H3U A;  2JK3 A;  3K4M A;  3DQV C;  4HX4 A;  4OWR B;  2Z9O A;  3G3Z A;  2GIV A;  1XN7 A;  3OYE A;  2BW3 B;  4BEH B;  1DGR M;  2IRF G;  2BY0 A;  3S16 J;  4TV7 A;  1APL C;  3BDD A;  2CQQ A;  3FHN A;  3VB2 A;  4MFE A;  2ZJ2 A;  1ERD A;  2BY1 A;  4S0H B;  2BY3 A;  1ZTR A;  2MD5 A;  3SDB A;  2OD5 A;  3FZV A;  3KZI C;  4ANJ A;  2E36 A;  1ETY A;  2Y69 H;  5K5R A;  3L2V A;  3T5X A;  2KRH A;  3OYC A;  1VQM I;  3WHB A;  4CCM A;  1NTC A;  5EYR A;  4E7Z A;  4M73 A;  1TW2 A;  1BW6 A;  2L4A A;  4I98 B;  3WTS C;  5FLX K;  1GV5 A;  2PBI A;  1HST A;  1OYI A;  1ZEL A;  2W4S A;  3VOD A;  3LSP A;  3S3N A;  1H88 C;  2LLK A;  3V42 A;  3GXO A;  5F64 A;  4A93 J;  2DPU A;  2LK2 A;  2XF6 A;  3OS2 A;  4KA4 A;  1S72 I;  4ZYH A;  4ZDO A;  3D1N I;  5F1J A;  3F0C A;  4E7H A;  5BQT A;  2TDX A;  2XAH A;  1PVE A;  5JLX A;  4IHX A;  4HAM A;  2KMU A;  3MCZ A;  3W6K B;  2EA4 A;  2RN7 A;  1FJL A;  1D0Z A;  3BY6 A;  1AKH A;  2JA2 A;  1LE8 B;  2PLY A;  1G2H A;  4KIF A;  1DPR A;  2YSR A;  3J81 Z;  2CW7 A;  1IV6 A;  1D8K A;  1MBG A;  3ABT A;  2JT1 A;  4XRS A;  3DCF A;  3QQA A;  4LK1 F;  5D5W B;  3EET A;  4QLC U;  1LNW A;  3V7C A;  4Q5S F;  2EIK H;  1CF7 B;  3TO7 A;  3JAM K;  2ISY A;  5C3E J;  4UB8 C;  1REP C;  4FAS D;  3CUQ A;  4LD5 A;  4M3E A;  4ZYD A;  4E7S A;  4G9Y A;  2IVM A;  3HRM A;  1Y1W J;  1B72 A;  1WZ2 A;  2HVS A;  1UHW A;  2ESN A;  1F5T A;  4ZJZ A;  4M72 A;  2M3A A;  4RA2 A;  3LL7 A;  2R7S A;  1DQU A;  3HB9 A;  1UG2 A;  1MND A;  2Q0O A;  2XB0 X;  3BTL A;  3AKZ A;  2NRA C;  1J09 A;  1U9N A;  5DUI A;  1TWH J;  3ZPL A;  3MVP A;  1MBK A;  4CGZ A;  4Q4Z F;  1EJ9 A;  1ZGJ A;  5D5V B;  1X4P A;  3KZY A;  3TOA A;  4XLN F;  2W48 A;  3SEZ A;  2FOW A;  1IN6 A;  4EAT A;  4NQW B;  4FIS A;  2V4J C;  5HDN A;  3BJO A;  4U7B A;  1T95 A;  1OCO H;  2XGC A;  3GZN B;  2VIX A;  4I02 A;  1D1B A;  1OPC A;  3QU6 A;  4R79 A;  3JW4 A;  3NRV A;  3O8G A;  3C1D A;  3KEO A;  4QTR A;  3QU3 A;  2K86 A;  3ZRG A;  2K27 A;  1XGM A;  2DLL A;  5CJ9 A;  3OYD A;  3RSN A;  1FOK A;  4HDU A;  2AO9 A;  2KIF A;  1NK3 P;  2IGK A;  2RGV A;  2EZH A;  2LOO A;  3K2A A;  3CMM A;  5IY5 H;  3D0S A;  2F4O B;  3I5U A;  3FHZ A;  1IDY A;  1HC8 A;  1E3P A;  2CW0 F;  2R7D A;  5LBQ A;  5ICG A;  5AON A;  2COM A;  4I6Z A;  3GF2 A;  1J9I A;  1VTN C;  1D8J A;  4LG3 A;  4ESB A;  4J01 A;  2ESH A;  2JA5 J;  3C3W A;  4CH7 A;  4XMY A;  3HOT A;  1GVJ A;  4YFK F;  2V9K A;  2ZFW A;  5IP7 J;  4ZZD A;  4XLE A;  2FE3 A;  1EH6 A;  4MEY F;  1VI0 A;  1G4D A;  4IO9 F;  3OOP A;  1Z77 A;  3U9G A;  1VND A;  1X3U A;  2MLG A;  2V6C A;  4BAY A;  2F5E A;  5BS6 A;  1X19 A;  4B3X A;  1QGP A;  3CCL I;  4FX4 A;  2VKH A;  3VYR B;  2LKS A;  3P9K A;  1YRN B;  2BEO A;  3LA3 A;  5CVU A;  3KPH A;  3TP3 A;  1Y0N A;  5CVI A;  2K7L A;  1D1A A;  4U87 A;  5FB2 A;  3HL2 A;  1FOY A;  1HF0 A;  1FMW A;  3OR1 C;  5DUK A;  1FTZ A;  2F48 A;  4CCL A;  4GRI A;  2ECC A;  2DT5 A;  3FXL A;  2EH3 A;  3KP5 A;  1O57 A;  3M8E A;  2G7U A;  1G6N A;  3LSR A;  4IHW A;  1FP2 A;  3IV5 A;  3WG7 H;  4ETS A;  2E1O A;  2L4M A;  1ODD A;  2ICW G;  5BMZ A;  2VB6 A;  4BXF A;  2ACJ A;  1R1U A;  4UUV A;  2BE5 F;  1VQO I;  5DCM A;  3CMA I;  3QOE A;  1UMQ A;  5LHI A;  2O5R A;  4XKW A;  1WJD A;  2BYV E;  2G7H A;  5HLH A;  2CWE A;  1MNM C;  2QA4 I;  1LFP A;  2KHM A;  4IOA F;  4IVN A;  1RR8 C;  2V9V A;  2VQG A;  4M9Z A;  1MD0 A;  1MIJ A;  3FK6 A;  4LB6 B;  2VC0 A;  4CYC B;  1O3R A;  3QYF A;  3SZT A;  4JBA A;  4MLO A;  1SFE A;  1ZRF A;  3I55 I;  4HG2 A;  3BJ6 A;  3IAS 2;  3V7R A;  3QYB A;  1YIO A;  1BW5 A;  4XN0 A;  4IF4 A;  3L2U A;  2Q2E A;  4BAC A;  4M3B A;  2IAI A;  2RNJ A;  1TP4 A;  3E97 A;  2HPI A;  4NC8 A;  1ZRE A;  3CUQ B;  5HVQ C;  3L00 A;  2W00 A;  4L5I A;  2A68 F;  3JRE A;  2Z3Y A;  3IKV A;  1B72 B;  3OY9 A;  3FIW A;  4HF0 A;  4D9J A;  4GFB A;  2PJR B;  1TT0 A;  2IS2 A;  3GWZ A;  2CMP A;  2LG4 A;  1F9N A;  5M5Y J;  4JQF A;  1YJN I;  3LMM A;  4RB3 C;  1PUF A;  3BZ6 A;  2I10 A;  2V26 A;  3D5S C;  1RR7 A;  1YTY A;  4NHJ A;  1OYY A;  1IN4 A;  3H3Z A;  1ETV A;  2KIU A;  4XRF A;  4UVA A;  3ULQ B;  2Q8K A;  4UNO A;  2LF8 A;  2AS5 F;  2EIJ H;  2HWV A;  3JRI A;  4G8X A;  1G59 A;  5FRN A;  1I6X A;  2LKX A;  3I3L A;  1H9T A;  2G9W A;  1PYV A;  1KU7 A;  4M3F A;  3WTX C;  5K7F A;  2NAZ A;  2HYG D;  1FMV A;  3V4G A;  1BR4 A;  3GFL A;  4C3H J;  4AIJ A;  3BP8 A;  1IDZ A;  1ZRD A;  1TT5 B;  2OBP A;  4D7M A;  4GCV A;  4KMU X;  3ECH A;  4QSH A;  2F5C A;  1PDN C;  2VT2 A;  1R36 A;  4L18 B;  3JSO A;  2VKD A;  2DFE A;  2LRD A;  5E3L A;  5D4R A;  1K78 A;  1AWC A;  5F08 A;  2FBH A;  1YHQ I;  2VON A;  1YFH A;  2MA3 A;  2M8E A;  1YS6 A;  3RJP A;  4X1E A;  4P9U A;  1VFC A;  3L2W A;  2N8G A;  5L3G A;  3ZMS A;  1L0O C;  3DFG A;  1D3Y A;  4KIB A;  3DF8 A;  1MBF A;  2DMT A;  1E2X A;  3LSH A;  4YIF A;  3RKY A;  3M1E A;  1VQ9 I;  3WG9 A;  1JGS A;  3GO5 A;  4BUP A;  3N05 A;  3DU6 A;  4IZZ A;  3DKW A;  4ZTJ A;  2XDV A;  4RGR A;  1G3Y A;  2E7X A;  1JT0 A;  2QBY B;  1SMT A;  4ENK A;  1N25 A;  2A6H F;  2RVC A;  3TDU C;  3HEF A;  1GXP A;  4EM1 A;  2XAS A;  2P5L C;  1RUN A;  2IBD A;  2PMH A;  2QCO A;  3BTI A;  2RQP A;  2VQH A;  1JKQ C;  2ZNY A;  1LUJ B;  3TKY A;  2E7W A;  2OV7 A;  4RMN A;  4A3L J;  4JK1 X;  3P9C A;  1R5H A;  3A01 B;  1LDD A;  3FMR A;  1TWG J;  2W25 A;  3U21 A;  4XSZ F;  2XAQ A;  4NBQ A;  2Z2S B;  2NS8 A;  4I99 C;  1JGG A;  2ZKZ A;  4Q48 A;  2IXS A;  1HQC A;  3EUH C;  5IYD J;  3KCC A;  1DU6 A;  4EMS A;  3KP7 A;  2XAU A;  1Z67 A;  4YII A;  5JR3 A;  5EG0 A;  1DDN A;  3MKW B;  2KZV A;  4ZDP A;  5LGN A;  2L9R A;  2EZK A;  2WV1 A;  2A6T A;  4C3J J;  1VZ0 A;  3AFH A;  4A2U A;  4G6T B;  4EQQ A;  4AM3 A;  2MBF A;  2VOO A;  3ZMD A;  3M07 A;  3CTA A;  1HW1 A;  2EWN A;  2EZI A;  5EF6 A;  4BE1 A;  1JKP C;  1GHC A;  3S1R J;  5KAI C;  2R92 J;  5DYM A;  2YU9 J;  3ZQF A;  2K4B A;  2OCE A;  2M9H A;  1UCR A;  1SFK A;  2P6T A;  2BY2 A;  3QOD A;  2HOE A;  3CF5 F;  3IUO A;  2HS5 A;  1U8B A;  3MAJ A;  1Y6I A;  1R5I D;  2A6E F;  2ISZ A;  4U0V A;  1YG2 A;  4I01 A;  3A4C A;  3Q0W A;  1HKS A;  2IGM A;  3EUK L;  3Q0U A;  4XKB A;  3HPH A;  5DV5 A;  3S32 A;  3GZ6 A;  3TW7 A;  3I59 A;  4KNY A;  2KFD A;  3BR1 A;  1NG6 A;  4F93 B;  2VE8 A;  5B66 C;  2XGD A;  4OU0 A;  1BC7 C;  5FKK A;  3G1O A;  1I1G A;  4AWX B;  2F5D A;  5D6F A;  3V8J A;  1BC8 C;  2L54 A;  5ICC A;  1S29 A;  4LFU A;  3SFI A;  1QQI A;  5FLV A;  3C7J A;  2Y31 A;  3I58 A;  1V5G A;  1WJC A;  4JX5 A;  2M0M A;  4OAY A;  3DLL F;  4I7H A;  5DD4 A;  2V1U A;  5TRD A;  1MJ9 A;  3DU5 A;  1W5C C;  3U1K A;  3Q3S A;  2OA4 A;  2PI0 A;  2KIM A;  2CJJ A;  2EV0 A;  2FQ3 A;  2VJI A;  1VQ7 I;  3HOS A;  1TWC J;  2NVU B;  1BJZ A;  2KZG A;  3RQ4 A;  4BEH A;  5C4X J;  2PFB A;  2YU3 A;  2WAD A;  3KP3 A;  2LY2 A;  2XUB A;  2GA1 A;  4U0W A;  4UV8 A;  3OYA A;  4BHP A;  1VQ8 I;  2E2H J;  4WK8 F;  1BOA A;  3FBN B;  2JPC A;  3IWF A;  1LFB A;  4A3G J;  3I54 A;  1OR7 C;  5HLI A;  1HW2 A;  4W1U A;  1JJ8 C;  3W2W A;  3JRH A;  3HTU A;  1USS A;  2CRG A;  4LG0 B;  3BR0 A;  2EPF A;  2E5N A;  2VN2 A;  2Q1Z B;  4A5M A;  2LC2 A;  1SAU A;  4ESJ A;  1KYW A;  4CIC A;  2JUG A;  2QQ9 A;  3K4L A;  2X4H A;  3E6B A;  1SVM A;  4CO8 A;  4D1Q A;  1JUM A;  2HYF A;  1XDU A;  2L7M P;  2J5O A;  1V5E A;  4JX4 A;  2M2E A;  5F6F A;  4G7O F;  4PSW A;  2GIZ A;  3OIP A;  2D1V A;  1FBS A;  2DU9 A;  3WTZ A;  4HQE A;  3J7Y J;  1QHG A;  5GTI C;  3CD6 I;  5H20 A;  2OPT A;  2ZC2 A;  2BVM A;  4C2T A;  4Y52 J;  3J7A O;  3N4M A;  1H9G A;  1RRJ A;  4G12 A;  1GT0 C;  2XKP A;  3HOV J;  4R1H A;  1OCR H;  2QEN A;  1R7J A;  3RCO A;  2O9L A;  2E1N A;  3ZN0 A;  4XN3 A;  4M71 A;  1EA3 A;  4LB5 A;  4ZDL A;  1TNS A;  3GLL A;  3A02 A;  3OYK A;  2OTL I;  1LQ1 A;  2DI3 A;  3M1C A;  3SQN A;  1Z6R A;  5J6X A;  5CPR B;  2Y30 A;  5J1Y A;  1LE8 A;  2KL4 A;  5KK1 A;  3KYD B;  1EKE A;  3HUG B;  1SAN A;  2O6G E;  4XKC A;  3WGG A;  5EG0 B;  3FM3 A;  3GYH X;  1FSE A;  4QWQ A;  2DJN A;  2A5W A;  2PN6 A;  3SHF A;  5IOY A;  1RC9 A;  4HZF A;  4CDG A;  1ORK A;  1W36 C;  1QBJ A;  3HZJ A;  3G2B A;  1I50 J;  4CCK A;  3F3X A;  1CF7 A;  5CKT A;  2QF7 A;  2LRE A;  2GOM A;  3R4K A;  3ML6 A;  1XX5 A;  2VAS A;  3E0J B;  2F5F A;  2CQN A;  4ZYA A;  3I9V 2;  2DCE A;  3LSI A;  1S5L C;  5LHH A;  5EEG A;  4UV9 A;  2K4J A;  3K4B A;  1I27 A;  2X6Y A;  4DYC A;  2XV4 S;  2OZ6 A;  3BR6 A;  4A3B J;  3G73 A;  5H2F C;  1BOB A;  5GAE J;  2XAG A;  1J7K A;  5GPA A;  4U0Y A;  2D1H A;  3TED A;  3GFM A;  1TTY A;  4W97 A;  2V6E A;  3FXQ A;  4FTH A;  3E5U A;  2L5Q A;  3BR2 A;  3DPU A;  3HOZ J;  1GUU A;  4L9N A;  2RRE A;  3BQY A;  4NQW A;  2DYS H;  4J19 A;  4DW6 A;  2DA6 A;  3PUB A;  1U5T C;  3B6C A;  3C2G A;  1S3J A;  3KE2 A;  4E70 A;  4BGD A;  5F1R A;  5FKN A;  5K7Z A;  3JRB A;  2ZME A;  2JA8 J;  2UXN A;  2NVY J;  1SC7 A;  2IJL A;  4IQJ A;  3WGH A;  4LIU A;  1I3A A;  3MMY B;  4GO1 A;  1FX7 A;  3BLY A;  2UUZ A;  4KJZ A;  1UZC A;  1WH7 A;  4AU7 A;  2HVQ A;  5J4V A;  3ZMT A;  4DJA A;  1IN8 A;  3TDZ C;  1WHU A;  4CCJ A;  1PP8 F;  3I56 I;  4DYR A;  1JTY A;  2EV5 A;  1LFU P;  2L02 A;  2H1K A;  4QPQ A;  3ABL H;  1A35 A;  1ZRC A;  1DU0 A;  2IGO A;  3RZO J;  2OC6 A;  1OCP A;  5L3B A;  1U3E M;  1DP3 A;  4HRI A;  1Y56 A;  1YJW I;  5GTH C;  2MYS A;  3G1M A;  3ZGK A;  2R7V A;  4HW0 A;  4XOT A;  2JZY A;  3FX3 A;  3HRT A;  1LDK B;  2X1C A;  4B09 A;  5JI6 A;  2GXA A;  3SFZ A;  3ZOB A;  1YRN A;  5CVJ A;  3KFW X;  4XKV A;  2EFQ A;  2HXI A;  2JQ7 A;  4BQA A;  1B9M A;  2K02 A;  2HZT A;  1LVK A;  3L9F A;  1YOV B;  1Z21 A;  5LRR A;  2RC4 A;  3F9K A;  1G3W A;  1XCB A;  2ECB A;  1BI0 A;  2H6C A;  2L01 A;  3REO A;  3V7S A;  1H0M A;  4WXH A;  3LSG A;  4EGZ A;  1IUF A;  2BHZ A;  2K9S A;  3ELK A;  2CU7 A;  3ZP5 A;  2O61 A;  1V5F A;  4ZYG A;  2EFW A;  1WCM J;  1YX3 A;  1RI7 A;  4UVB A;  4XOP A;  4AUX A;  3BPV A;  2XF7 A;  2FF4 A;  4RLQ A;  4CSW A;  1IRG A;  4MTD A;  4ON0 A;  1IXR C;  2E35 A;  5IYC J;  3LSK A;  3PSI A;  1R22 A;  1ON2 A;  3GTK J;  1EF4 A;  3D5L A;  4XQF A;  2EBI A;  5D5U B;  3H36 A;  4DNC A;  4HOB A;  3ZQI A;  3QRF F;  1OYW A;  1J75 A;  4A5N A;  2WBM A;  3CJQ B;  3W3C A;  2ZXH A;  4IHS A;  2GOX B;  5FRO A;  2HDC A;  1A31 A;  3CME I;  2CUF A;  4CYC A;  5J3L A;  2HR3 A;  4UB6 C;  5F04 A;  2B9S A;  3MZ8 A;  1LPQ A;  1A6Q A;  1KU3 A;  4XK4 A;  1XMA A;  1JUS A;  2V79 A;  3E3V A;  3E6C C;  1ZR4 A;  2IT0 A;  4J00 A;  3H1C A;  4OIR F;  2Y75 A;  1ETO A;  4LOC A;  2KLO A;  1YIJ I;  1V4R A;  2OUM A;  3ZQH A;  4AIK A;  4PJM A;  1GVD A;  4RB2 C;  2WB1 N;  1EH8 A;  2WAQ N;  3HSE A;  1ITY A;  3ERM A;  1A36 A;  2P8T A;  2GZW A;  1U0J A;  5HS8 A;  3H5N A;  1W4M A;  2CV0 A;  2QKM B;  3G71 I;  2RKH A;  3HXL A;  1ZLK A;  2ZXW H;  2DN0 A;  2VT3 A;  2FBK A;  2MG4 A;  4CXF A;  3LA2 A;  2FBI A;  1IC8 A;  2X51 A;  3IC7 A;  2PJR A;  3GTG J;  4EV0 A;  2ZB9 A;  3NWT A;  4RB0 A;  1J2X A;  2E1M C;  4Y33 A;  1A5J A;  4XRS G;  1KU9 A;  2CGP A;  2HZD A;  1XPX A;  1MBE A;  1ZAO A;  2GQQ A;  3SZP A;  3SYT A;  3CP2 A;  5GAH J;  1YO5 C;  2X6X A;  4M9X A;  1IRX A;  2NYX A;  3J7Z I;  2CUE A;  4YG2 F;  3T8R A;  3CCM I;  1IN5 A;  4X0G A;  1TBX A;  2ID6 A;  2GM4 A;  4AVP A;  3CCE I;  2K85 A;  1E17 A;  1S6L A;  3QYE A;  5HNF A;  4IRI A;  4L0Y B;  1FYM A;  4HQM A;  1VQ5 I;  1X4O A;  3H0D A;  1MGT A;  4RGS A;  4RGU A;  4XBF A;  5BPD A;  2HPM A;  1TC3 C;  2XRN A;  2ZME B;  1RPW A;  1BI1 A;  4YEL A;  2YS9 A;  3O2P E;  2PX9 A;  2WB1 A;  3IWZ A;  5HS9 A;  2WAQ A;  5JLW A;  1XDS A;  3LSJ A;  2CH0 A;  2GWR A;  4E7I A;  4IHT A;  2W7N A;  1T38 A;  1X1A A;  5EEA A;  3A03 A;  2L7K A;  1D0X A;  1SMY F;  2BV6 A;  3OSG A;  2DO7 A;  2GXB A;  1X3W B;  1VQL I;  2H09 A;  1FNN A;  4XIC A;  4DZP A;  3GX4 X;  2A05 A;  1FBQ A;  2EA2 A;  3K10 A;  5EEH A;  4UUT A;  1S8N A;  3NAU A;  2DTR A;  6PAX A;  2HVR A;  1B6A A;  2ZSH B;  2ZJP F;  2FXA A;  1H89 C;  2QUF A;  3AG2 H;  4OOI A;  3K1M A;  3A1Y A;  3FIS A;  1U6G A;  3S2D J;  1J59 A;  5IYB J;  4ENN A;  2B0L A;  2IS4 A;  3ZQL A;  4MEX F;  3ABM H;  3I53 A;  2M5W A;  3IH2 A;  2K9L A;  3IP4 B;  3RPU A;  2WTE A;  1BR1 A;  3VWB A;  4XM3 A;  2WAF A;  2QBY A;  1Z3Y A;  2KDO A;  1YYV A;  3OS0 A;  1KZH A;  3S2W A;  2DBB A;  5KCM A;  3QPH A;  5E18 F;  4CCN A;  1MMD A;  3BG9 A;  2P7C B;  2XKO A;  3K9T A;  4BHB A;  2XAJ A;  3S2H J;  1X2N A;  3KYL A;  1ZGA A;  2X48 A;  3ESW B;  4N4N B;  3WE3 A;  2RDP A;  3IAM 2;  5ILU A;  4BNC A;  3OYL A;  2M45 A;  2P5K A;  2VBY A;  3BCA A;  1IAW A;  2IS1 A;  2O0Y A;  3A01 A;  5D6E A;  4DYQ A;  1FYL A;  3LA7 A;  2OTJ I;  2K3F A;  3HOX J;  2L3D A;  5GAD J;  4KT5 C;  4RB1 A;  2JVG A;  2H8R A;  4L5E A;  4MQ9 F;  1T0F A;  1RES A;  3GW2 A;  2VI6 A;  3X2Q H;  3TOB A;  1I6H J;  2PG4 A;  3WTW C;  3K4N A;  3M8F A;  3ZMZ A;  3MZY A;  2L9S A;  3FMQ A;  4XRM A;  3ASN H;  2DT7 B;  4EJO A;  2EQR A;  2H1L A;  3CUQ C;  4B43 A;  3AG1 H;  1ZG3 A;  4PGH A;  2DOF A;  3SXY A;  4K2E A;  1YJ9 I;  3TP0 A;  3T8T A;  5CVR A;  1VQ6 I;  1TQM A;  2WA0 A;  2L2O A;  3W2A A;  5DS9 A;  2X85 A;  3CC4 I;  5J40 A;  5JVT A;  1RIO H;  2NOJ B;  5F0C A;  3RPQ A;  2Y9Y A;  3B6A A;  4MIM A;  3P5J A;  4BQN A;  3L2R A;  5E3M A;  4FQG A;  3HHG A;  1SVO A;  3TMO A;  1IJW C;  1HDP A;  2WC2 A;  1V54 H;  3ECO A;  3PM1 A;  2XPU A;  2ZXI A;  4II3 A;  4BDZ A;  5LFA A;  1R49 A;  3CCR I;  3EPZ A;  1WI3 A;  4AYB N;  1JT6 A;  2QLZ A;  3FXR A;  1QVU A;  1MMS A;  1B4A A;  1NK2 P;  1N75 A;  3E5X A;  5HOO A;  3ERE D;  1R5G A;  1O3S A;  2VJ5 A;  2LYC A;  3OYG A;  4XSX F;  4X6A J;  2FD5 A;  4P5O A;  1WRJ A;  2H94 A;  1IUY A;  1E3H A;  4ZYE A;  2Y48 A;  3KZZ A;  2EV6 A;  2KQR A;  4B44 A;  2CO5 A;  1GV2 A;  3BOQ A;  3BG5 A;  3K1P A;  1D5V A;  3GTP J;  2FOK A;  4OMY A;  1A6I A;  4DQ2 A;  5IT9 K;  1R58 A;  3VEP A;  2M4G A;  4BJ6 C;  3CDI A;  3ABU A;  5IT3 A;  1EH7 A;  2LSO A;  3K4C A;  4UUS B;  5GP9 A;  1P7J A;  3H92 A;  3DKY A;  1ZK8 A;  2O7O A;  3PFI A;  1WSU A;  1FLI A;  3JCU C;  3JRF A;  2OU2 A;  3B73 A;  4JOM A;  4Y4R A;  3QAH A;  3VOE A;  1MMG A;  1VQ4 I;  3MEX A;  2HNH A;  1FSH A;  3CDH A;  2LKP A;  4DGW B;  4ASN A;  1FYK A;  3RIR A;  3WU0 A;  2HOS A;  3RYR A;  4I0B A;  4EM2 A;  1GDT A;  3WE2 A;  4AYB A;  3GTJ J;  2F2E A;  1SVL A;  3K6G A;  4F92 B;  2AQE A;  2OCC H;  5HS7 A;  5E79 C;  4WF2 A;  3PQK A;  3OYB A;  2HOA A;  1WVR A;  1MMA A;  4RLF A;  2OQR A;  1FIA A;  2DA7 A;  4G6Q A;  2IGN A;  4LG0 A;  3I4M J;  3F6O A;  2KJC A;  1YW9 A;  2I5U A;  3ZMU A;  3ZQG A;  2QQB A;  2IS6 A;  2P81 A;  2DPD A;  1U8R A;  3OYN A;  4U88 A;  1XMX A;  2R5Y A;  3IRQ A;  5JVG F;  1VQK I;  3KYC B;  1R71 A;  1T0F C;  1HKT A;  4A0Z A;  1R23 A;  1XS9 A;  3QPL A;  2M34 A;  3L09 A;  5GPC A;  1U2W A;  1H8A C;  5BNG A;  5L3E A;  3BT9 A;  1AA7 A;  2Y0M A;  3VYT B;  2MH9 A;  4HBL A;  4HYE A;  2R3S A;  4FE4 A;  4XLH A;  1LKX A;  1B8I B;  2O8K A;  5M3F J;  2CQK A;  3KLN A;  1P7I A;  4S04 A;  3ZXS A;  4JX6 A;  4FHT A;  1XGS A;  2A3S A;  2IA0 A;  1Y8Q B;  4I09 A;  5F27 A;  3GME A;  1V3F A;  1PP7 U;  3HHH A;  1I5Z A;  1Q1V A;  1HXD A;  3HUG A;  1BR2 A;  4BHC A;  1KU2 A;  5E3O A;  1OCT C;  5E1X A;  2VE9 A;  3LWF A;  2K3P A;  2O8X A;  4GYG A;  1K83 J;  2L9V A;  4PJN A;  2K40 A;  4ITV A;  2VLA A;  3GZ5 A;  4M9S A;  2P6S A;  2Y0S N;  3N97 A;  3HOW J;  4B47 A;  2DYR H;  4MFD A;  4CZZ A;  2BXZ A;  2MLK A;  2ZSI B;  4FT8 A;  3FBI B;  1XCV A;  1GLN A;  4V2F A;  2F4I A;  3J80 K;  2EB7 A;  3PSF A;  2BBY A;  4RAZ A;  4EJW A;  2DW4 A;  3K7A J;  4ABZ A;  2JRM A;  1Z7U A;  4Y3O A;  4HNV A;  3CCJ I;  2JN6 A;  4L5J A;  3S17 J;  5JHU A;  4JP0 A;  1DPU A;  3QP6 A;  3CJT B;  2NOG A;  1NG7 A;  2KPM A;  5FO5 A;  3CJN A;  2VPL A;  4IL6 C;  3H9J A;  2QSF X;  2FML A;  3RQI A;  5K5Q A;  1Q1H A;  4EJT A;  5FGM A;  4BDY A;  3HSF A;  4RS8 A;  5M3M J;  1T6S A;  1XB4 A;  3IRR A;  5H6R A;  5CLS A;  1IO2 A;  1SD6 A;  3MN2 A;  2Y2Z A;  3A2K A;  2DA3 A;  4BQQ A;  1IV8 A;  3GLX A;  5IPA A;  1IZ1 A;  1XGO A;  2LR8 A;  1XSD A;  4PFO A;  1BBY A;  4BBR J;  3JRD A;  2DDA A;  3DPT A;  2E2I J;  1XGN A;  2IW5 A;  3PQJ A;  4FE7 A;  4IEJ A;  4LK0 F;  2Y0S A;  3DKX A;  3CCU I;  1XSX A;  3FWE A;  4M74 A;  2UWM A;  1HKQ A;  4I76 A;  2PMZ N;  2UV1 A;  3OYH A;  2BXY A;  2FQ4 A;  5B3S H;  4F52 A;  2W24 A;  4D5C A;  1SAX A;  3HOY J;  3BJA A;  3H0G J;  2DQR A;  2JSC A;  1MBJ A;  2R7Q A;  5HDK A;  1SFU A;  3P7N A;  4LJZ F;  3GVA A;  1MZB A;  4EVI A;  3D5R C;  2XVC A;  2UZK A;  1FOX A;  1G3S A;  2L7F P;  3KEQ A;  2PEX A;  2EIL H;  3SZG A;  1ZR2 A;  3W2V A;  2DA4 A;  1ETW A;  3IKT A;  4DOZ A;  1Z9C A;  4FX0 A;  1WFX A;  1O4X A;  2FNP A;  3L7W A;  4IPA A;  5IT9 Z;  2MD0 A;  2WY7 Q;  4KUM A;  4B8X A;  1WH5 A;  3TO6 A;  3DTK A;  4R8H A;  3HTS B;  3G6E I;  3SEQ A;  4L9J A;  2GLO A;  2HKO A;  4C30 A;  4XLA A;  2MC3 A;  4KIT B;  3F6V A;  4Y7N J;  2ADU A;  1S7O A;  5ICE A;  4KMF A;  1FOW A;  5BPI A;  2DOA A;  2YPR A;  3CDL A;  1DP7 P;  4GGG A;  2YUS A;  4L0Z B;  1ETK A;  4F7Z A;  3HSR A;  5J8C A;  2R5Y B;  1SD5 A;  3WU1 B;  5E1Z B;  2X1E A;  1BM9 A;  4BH9 A;  3CZ6 A;  1F43 A;  4IRH A;  2PMZ A;  4IX7 A;  4PK4 A;  1XD7 A;  1T08 B;  5F0F A;  2Z99 A;  4XLP F;  3WTV C;  1WJE A;  1JJ6 C;  1ZKG A;  4IKF A;  1CGP A;  2CFO A;  1FP1 D;  5HLG A;  3NQO A;  2DA5 A;  3R61 A;  5C4J J;  5BOX A;  2HU9 A;  2HDD A;  2JA7 J;  3GTL J;  2NS7 A;  1RNL A;  4B48 A;  4A3C J;  2LTP A;  1YX5 A;  4NUB A;  1ZQ3 P;  3L1P A;  4YFN F;  4EGY A;  4MTE A;  3CLQ A;  4D5F A;  4MO7 A;  2CV1 A;  2WV0 A;  5CQE A;  3UR3 C;  3S1M J;  2BVL A;  1FIP A;  2DOE A;  3L2Q A;  1W5T A;  2V1N A;  4UVC A;  1IRF A;  1GXQ A;  2GA2 A;  3DWL E;  4G7H F;  4XL9 A;  4BE0 A;  4XLC A;  2EFO A;  1Y0U A;  2D5V A;  1JE8 A;  2RQQ A;  3LQR A;  4HA8 A;  2EZL A;  3V8L A;  1LEB A;  2IP2 A;  2E19 A;  2CSO A;  3GTO J;  3ZCO A;  2ZJR F;  2DT6 A;  5D4S A;  1L3L A;  1YIT I;  3NAR A;  1JKR C;  3MKY B;  3H3V K;  1FT9 A;  2R5Z B;  2DDB A;  3KP6 A;  1FBU A;  3AG3 H;  1VF9 A;  4KIC A;  3DEE A;  1OLT A;  3GUD A;  4OIQ F;  2BOL A;  2ID3 A;  1B59 A;  5LEK A;  3JTG A;  1QHH D;  4HLY A;  3PFY A;  2FA5 A;  4B4C A;  3S3M A;  4XON A;  5DEQ A;  2UXX A;  4O5V A;  1WGX A;  5ED4 A;  5ICF A;  4C3I J;  2QEX I;  5J47 A;  3A0B C;  2XPW A;  1UFM A;  4RAY A;  3K0L A;  1UHS A;  2QSH X;  2ELJ A;  3ONQ A;  3BG6 A;  1Z05 A;  3K4K A;  3J80 Z;  2MAB A;  3O6B B;  3MD2 A;  3U1D A;  4BKX A;  1RUO A;  1K79 A;  4OIN F;  1STZ A;  3T0Y A;  1W0T A;  3TO9 A;  4ZZL A;  2JWT A;  1K6O A;  1R4N B;  1YQA A;  1FZP B;  2CUZ A;  4PJ0 C;  2Z16 A;  2D2W A;  1DUX C;  1KA8 A;  4MHG A;  1HSJ A;  3OYF A;  5J1R A;  3HGY A;  3M8J A;  1MBH A;  3HRS A;  3ZN1 A;  4BBS J;  3BCB A;  1QRY A;  3JTH A;  5DM7 F;  3ZQ7 A;  3LAP A;  3S93 A;  3HG9 A;  1E3O C;  1LJ9 A;  3TGN A;  3KET A;  4BXX J;  3TQN A;  2VBW A;  4A3D J;  1SFX A;  4ZTF A;  3FXU A;  2XSD C;  2XHK A;  1SFO J;  1SD7 A;  3G1L A;  3OMY A;  2IA2 A;  1SD4 A;  3BZK A;  4OAZ A;  2KDZ A;  3AL0 B;  5F0H A;  4MGR A;  3BG7 A;  2V9P A;  2YR2 A;  5FKM A;  2KRC A;  1P9Q C;  2QWW A;  3I0T A;  1E0E A;  1MMN A;  5E1W A;  4HF2 A;  5AIQ A;  4JYK A;  3F23 A;  2EIN H;  3DLA A;  5TIS C;  3COA C;  3CJR B;  3CQZ J;  4V2G A;  2O3F A;  1Y39 A;  1U5T B;  4BY1 J;  2EFN A;  3J7A Y;  1QZZ A;  2Y9Z A;  1W1W E;  2W84 A;  1ETX A;  2IEK A;  2IA1 A;  2CS3 A;  4Y17 A;  4PDK A;  1EV7 A;  1KGS A;  3KLO A;  2Z5U A;  1HDD C;  5DCF A;  5L3F A;  2MGQ A;  1OQY A;  3KP4 A;  2BHY A;  3K70 C;  3OS1 A;  1R00 A;  3VFZ A;  2VBX A;  4B3A A;  2YX7 A;  2X9D A;  5CVV A;  1Z7L A;  1HA8 A;  4GXO A;  4N9I A;  1MJA A;  3BRO A;  2FX0 A;  4WXD A;  5B5E C;  3AG4 H;  2XPV A;  4F3Q A;  1IW7 F;  3RDI A;  4A3E J;  4KDP A;  4Z6Y A;  2W85 A;  3G4S I;  2KJB A;  2CG4 A;  5LLQ A;  2Z33 A;  1ONV A;  1MJB A;  1UST A;  2M0C A;  2HFH A;  3JRG A;  3S15 J;  1UG0 A;  2R7O A;  5A2Q Z;  4M6Y A;  1M1E B;  1IG7 A;  2STT A;  1HCR A;  2TCT A;  1X1B A;  4L9V A;  3PO3 J;  4HPQ A;  1S7E A;  1RKW A;  1WKM A;  1TL8 A;  3VPR A;  2V7F A;  4EJV A;  3DEW A;  2K9N A;  1ZYR F;  2HKX A;  2DMU A;  3OR2 C;  4DBR A;  3R6S A;  3TW6 A;  5KHD A;  2CV2 A;  1MDM B;  1SEU A;  4AID A;  3MWM A;  1ACI A;  5H6Q A;  1R1V A;  5IP9 J;  4PCQ A;  1MW7 A;  2KIS A;  4A69 C;  3LOC A;  3S14 J;  2LBF B;  5E3N A;  5GAG J;  4YFX F;  3BTC A;  3CCV I;  4C9Y A;  3RZD J;  3S8P A;  3FXM A;  1F36 A;  2ME0 A;  2HI3 A;  1JHH A;  3JSP A;  1TLH B;  4BXU A;  1W7P B;  4DIQ A;  2EIM H;  2JSP A;  3H5R A;  4RAF A;  4YIR X;  2LMD A;  4M6V A;  1HOM A;  2ZME C;  4G94 A;  2W82 A;  1ZGW A;  1B1B A;  3CES A;  1QZY A;  3S1Q J;  1IXC A;  5JFR A;  3LFU A;  1RZ4 A;  5J4Y A;  1UHM A;  3CF2 A;  1O3T A;  4LLG F;  3FXK A;  1KQ9 A;  2QQ8 A;  2VJ4 A;  4PSX A;  5J8F A;  2I8D A;  4HX8 A;  3E6M A;  5FFZ A;  4QPO A;  1K4T A;  1V55 H;  3WTY C;  1RKT A;  3M9A A;  4S05 A;  5FFX A;  4EJU A;  3SJM A;  2NNN A;  5EGO A;  2ELK A;  2V1X A;  5JHF A;  1P4X A;  3DBR B;  4NC7 A;  4YEJ A;  1U9O A;  3GFJ A;  4UUS A;  2LD5 A;  2DA1 A;  2R93 J;  2VXD A;  1WI9 A;  2FEZ A;  2VXZ A;  4HSR A;  4EM0 B;  3HDD A;  3BZC A;  4D0P A;  4AD9 A;  1KYZ A;  4CYD A;  2DA2 A;  2XRO A;  2DFH A;  1JUP A;  4PUS A;  4BYY A;  4ZH4 F;  4E7J A;  1Y1V J;  5AIP A;  3BWG A;  3WGI A;  3FK7 A;  2R7T A;  3OWT A;  3LST A;  2FU4 A;  1W36 D;  1MH3 A;  2XC7 A;  1FPQ A;  2VOP A;  2CQ7 A;  1YW8 A;  2E1M B;  3KEY A;  2ZCW A;  4BQO A;  1QA6 A;  2BGC A;  2DOD A;  5ERI A;  1FY7 A;  2H8W A;  4V19 K;  2LF7 A;  2O03 A;  3UKG A;  4HDV A;  3C2B A;  3B02 A;  1UJ8 A;  2RV8 A;  2V1D A;  1J5Y A;  1QZE A;  2JMW A;  2HGC A;  3MKZ A;  3PO2 J;  2AHQ A;  5TJJ A;  2WWY A;  2F4M B;  4LGW A;  5M5W J;  4N0B A;  1QNT A;  1T98 A;  4Z2Y A;  2COB A;  1T56 A;  2ZNZ A;  1JI8 A;  4HV6 A;  2XGX A;  1JHF A;  2E60 A;  2A5Y B;  2LP0 A;  2QVO A;  2M87 A;  2FJ1 A;  3RKQ A;  2EK5 A;  1ZH5 A;  2PQ8 A;  2DMQ A;  2CQX A;  2L0K A;  2E1C A;  3HKZ N;  1CQT A;  2R7F A;  4ZC3 A;  1LEA A;  2K9Q A;  1LDJ A;  1B8I A;  3CP8 A;  1P6R A;  1K61 A;  2DK8 A;  2VL8 A;  4QIW N;  5FKO A;  4L9T A;  1X1P A;  3KP2 A;  4UXN A;  1PJR A;  4G6D A;  4P55 A;  3RTR A;  5K5O A;  5KNL A;  4C2U A;  2G0E A;  3W6J B;  2R4G A;  1ZAR A;  5FD5 A;  4A3M J;  4HX7 A;  4NNJ A;  3PNT A;  4YRV A;  4H0E A;  2CYY A;  1JXS A;  2DAO A;  3RKX A;  3HGG A;  3ROU A;  1UAA A;  1JTX A;  1XG1 A;  3BR3 A;  3WOD F;  3WTU C;  2HQR A;  3UNG C;  2DMP A;  1TZL A;  5E20 A;  4M3G A;  5FRM A;  1OMI A;  1POG A;  2XSJ C;  3TL4 X;  3ASO H;  4A12 A;  1WQ2 A;  5D8K B;  2HOT A;  5LHG A;  1QVT A;  1BI3 A;  3IH4 A;  2QYO A;  5ILS A;  4MQV A;  4HV5 A;  4KN4 X;  3S1N J;  1KQ8 A;  3CUO A;  1IN7 A;  1BI2 A;  1XTA A;  3GBG A;  2P0W A;  2W1O A;  3R60 A;  4PZJ A;  4PFP A;  5FLX Z;  3JR9 A;  1MKM A;  1P4A A;  2M8G X;  1AKH B;  4IJA A;  3EDP A;  3HKZ A;  2VUM J;  1IGN A;  1T33 A;  2CW8 A;  4A0Y A;  1ETQ A;  4M6X A;  4RGX A;  2LVS A;  2WAE A;  4O3M A;  2LFB A;  5M5X J;  3F72 A;  1U78 A;  2ZXJ A;  2GAU A;  1G8X A;  1S7A A;  2EFP A;  5E8G A;  1P4W A;  5LGT A;  4OIP F;  3EUH A;  1ULY A;  3K70 D;  1YI2 I;  1ZG5 A;  1OJL A;  2R7W A;  4O6J A;  3LNQ A;  3F8B A;  3ISP A;  1P92 A;  3C2H A;  2JTV A;  3DEU A;  2HXO A;  2JRT A;  2X1D A;  2A61 A;  1WWX A;  4A6D A;  2JPB A;  1WJF A;  3O8H A;  4A3I J;  1W7P D;  3CMY A;  1J0R A;  4B1R A;  1HLV A;  4CCO A;  2X6W A;  3MZH A;  5DM6 F;  3FMS A;  5EGO B;  1MH4 A;  1T8I A;  1I3Q J;  3W6V A;  2XB5 A;  2KP6 A;  1WJ5 A;  1LB2 A;  4PJL A;  1BJA A;  3PNY A;  1O7F A;  5EZG A;  1F4K A;  3QP5 A;  3JRC A;  4UHT A;  5LGU A;  4HEA 2;  4ESF A;  2W57 A;  3OIQ A;  2F5V A;  3DPL C;  3A0H C;  3BTJ A;  4OIO F;  1Z91 A;  3M3Y J;  3JAM Z;  5B1B H;  3IHU A;  2XF5 A;  2HQ5 A;  3DXJ F;  1X1C A;  2E34 A;  3BC8 A;  1MNE A;  3E7L A;  1D0Y A;  5D8L B;  2IPQ X;  3OYM A;  3PJR A;  1FTT A;  1QU3 A;  1X2M A;  4IXA A;  3V8K A;  4WWC A;  5IP6 A;  3JRA A;  3C18 A;  3GTM J;  4HLX A;  3FF5 A;  3SDG A;  1YS7 A;  3F8N A;  4DZJ A;  2MC4 A;  3F8M A;  3P9I A;  4IQ4 A;  4RAG A;  3PNV A;  4A0X A;  3H9Q A;  3BG3 A;  3HYI A;  1X1D A;  2JVH A;  2NVT J;  3S3O A;  4M3D A;  3R0J A;  1PUE E;  3BR5 A;  3DV8 A;  3FM5 A;  1UEL B;  3LSM A;  3QOP A;  2OZU A;  2OF7 A;  3MFK A;  2XGE A;  1C0W A;  4HNT A;  4OMZ A;  4PGG A;  1QPI A;  2JA6 J;  3ZR8 X;  5FD6 A;  1B9N A;  3E1S A;  4CA0 A;  1AU7 A;  1YE9 A;  2M7B A;  3HC7 A;  4BL0 B;  2XAF A;  4C2M J;  4E4H A;  2ZJQ F;  2STW A;  1VQP I;  2QSG X;  5L3D A;  4I2O A;  1OR7 A;  2LH9 A;  3M7G A;  4IHV A;  2VJJ A;  3IH3 A;  4II2 A;  1KQ0 A;  1VQN I;  1BIA A;  3I71 A;  5E8I A;  2F6C A;  3I4P A;  4GDF A;  4WCG A;  1F1Z A;  3WU2 C;  1T39 A;  1X3Z B;  1I39 A;  1O7L A;  3O3K A;  5DCM B;  2VPR A;  2EJR A;  1XMK A;  2VQC A;  3ZQQ A;  2VKE A;  1R9T J;  3BPX A;  4LLL A;  3VYS B;  2QZ8 A;  2HQN A;  5HOD A;  5CYV A;  1I1S A;  1ZLJ A;  2YX4 A;  2DK5 A;  4HST A;  4AC0 A;  2DMN A;  1AHD P;  2KIQ A;  2R5Z A;  1N77 A;  2R7U A;  3NWS A;  3KIO A;  4Y13 A;  4IOC F;  2VKV A;  1BL0 A;  1R1T A;  1LVA A;  3EYY A;  2DJI A;  2AXL A;  2A07 F;  1HBX G;  3Q5F A;  5ILV A;  3RI4 A;  3MQ0 A;  2JJ7 A;  3F8C A;  2TRT A;  3FKJ A;  5K7H A;  1FEX A;  5D5X B;  1OCZ H;  2QM3 A;  5CQG A;  4EEF G;  2OQG A;  1FC3 A;  4KIS A;  2ME6 A;  2ETH A;  3CLO A;  2C6Y A;  3VSL A;  4KFC A;  3PIP F;  2Q2E B;  5EZH A;  1ZHF A;  1D1C A;  2QQA A;  2VBZ A;  1TQP A;  4PJJ A;  1ON1 A;  1W5S A;  2HYJ A;  4LMY A;  1TWA J;  4DBQ A;  5LEJ A;  1G3T A;  3OL3 A;  4NC6 A;  5LD2 C;  4Y15 A;  4P1W A;  1A04 A;  3CCQ I;  1OCC H;  4UY8 I;  1P2F A;  2KKO A;  5HNH A;  2R0Q C;  4E6K G;  4LIT A;  4WX9 A;  1PUF B;  2M1B A;  4RM3 A;  3T1B A;  3CO6 C;  5KVR A;  3Q9S A;  3OYJ A;  3CC2 I;  4F55 A;  3F22 A;  1Y8R B;  2LDU A;  3PIO F;  3AAF A;  3ABK H;  2NVX J;  3I64 A;  4KYW A;  2D45 A;  4A3F J;  3F21 A;  2LY9 A;  4HNU A;  1XC5 A;  5HLT A;  3KX2 A;  3H9G A;  2NVQ J;  2K5C A;  5DD8 A;  1OIS A;  2FNA A;  3FDY A;  1DGW Y;  2LNB A;  3CCY A;  3R0A A;  5K1Y A;  4RBO A;  3M4O J;  4A3J J;  2E5Z A;  3ZMV A;  3QPT A;  1TWF J;  3K1N A;  3CO7 C;  4KIG A;  2CUJ A;  3CCS I;  2WY8 Q;  3U2R A;  1MSF C;  2ZFU A;  3WHC A;  2X0L A;  5L3C A;  3K2Z A;  2FMY A;  4RM2 A;  2X6O A;  2DTZ A;  2MW8 A;  1TNT A;  5FKL A;  2LY1 A;  3DBH B;  4CUG A;  3HBL A;  4P96 A;  1Z1D A;  1BIB A;  4N4O B;  1U5T A;  4F91 B;  4MNU A;  3Q9V A;  2L7Z A;  3OL4 A;  2BW3 A;  2DFI A;  2QKL B;  2B63 J;  2R7R A;  1K78 B;  3GEZ A;  5A2Q K;  2M4K A;  2HQA A;  2OJE D;  3QWL A;  4BU2 A;  2K9M A;  3VSK A;  4IRG A;  3EYI A;  2FRH A;  4XNF A;  1YW7 A;  4BJ5 C;  3RYP A;  2L9N A;  1WJB A;  4AIH A;  3DTI A;  1IF1 A;  1TQI A;  1IRZ A;  4A6E A;  4CHU A;  2A69 F;  3PUF A;  2DQL A;  3K4J A;  2R7Z J;  3GCM A;  4N9H A;  5FJ8 J;  4E7K A;  2M7A A;  2B7E A;  4RDU A;  2NNY A;  3FKI J;  4NDL A;  4BE2 A;  3DP7 A;  2BZT A;  5TGT A;  5DDG A;  4GYI A;  3J81 K;  3BQZ A;  4ENM A;  3IL2 A;  2ZBK A;  3GTQ J;  1MSE C;  2ELH A;  4NB5 A;  1XSV A;  3OV8 A;  3OSF A;  1RET A;  4LLN A;  4BY7 J;  3RPU D;  4KN7 X;  2NS0 A;  2M30 A;  3QPS A;  3L2C A;  9ANT A;  1ZN2 A;  2HTJ A;  2MH2 A;  2PMU A;  1BA5 A;  4H4K C;  1TW3 A;  2HTS A;  3WTT C;  3LFK A;  5B1A H;  1S9H A;  2E2J J;  2E71 A;  2NXN B;  2PJP A;  1WJA A;  1MDM A;  1X58 A;  3HPG A;  2DFF A;  4CZC A;  3E5Q A;  3LAJ A;  4FCY A;  2RNG A;  2LBF A;  4XOR A;  5EJC A;  4G7Z F;  1T2K A;  2H27 A;  5J1U A;  1BN5 A;  1QPM A;  3CC7 I;  4BS9 A;  1ENH A;  3HOU J;  3HJE A;  3H5A A;  1HW5 A;  2CFX A;  4U7D A;  3GFI A;  5HDG A;  1W7P A;  4XLF A;  2AQF A;  1WPK A;  4XID A;  4IHY A;  3EUA A;  4E7L A;  1K7A A;  2DXI A;  1O3Q A;  2Z1D A;  1JKO C;  1R6R A;  3MKL A;  5E17 F;  1YLF A;  1K4S A;  1FWZ A;  5EDN A;  5LRS A;  5C44 J;  3F8F A;  1ZG1 A;  2XIG A;  4HF1 A;  3VYU B;  3HIF A;  2KRF A;  2AXT C;  3DBL B;  1Z6T A;  1OFC X;  1UB9 A;  4I0A A;  2VQL A;  3NEU A;  4BJT A;  2GBY A;  4KT6 A;  1W0U A;  3EQL F;  1NH3 A;  2ZO4 A;  2XRL A;  3H35 A;  2MFZ A;  4D7N A;  1D5Y A;  3AL0 C;  1IXS B;  3HM5 A;  2J5P A;  2R7X A;  3FXJ A;  2VC1 A;  5KAF C;  4ENJ A;  2P5V A;  4P9F A;  4LIV A;  1AOY A;  1R4M B;  2HDW A;  3HRU A;  2P7V B;  2JUC A;  2KT0 A;  2P4W A;  4Q47 A;  3I59 B;  3Q0V A;  4XR6 A;  3I4N J;  2VOD A;  3ZQC A;  1Z3X A;  4WXC A;  1NHA A;  3K69 A;  1K6Y A;  1Z0X A;  4AVZ A;  2H6B A;  2FSW A;  3DTE A;  2OAZ A;  1QO0 D; 
#chains in the Genus database with same CATH homology
 2XC7 A;  4DGW B;  1KON A;  2E1M B;  3DU5 A;  3VDX A;  3KEY A;  3OOU A;  4BQO A;  3PL8 A;  4AYB A;  3TBI A;  4FET A;  3K6G A;  4F92 B;  2VJI A;  2AQE A;  3HOS A;  2FUG 2;  3OYI A;  3RQ4 A;  3OYB A;  4BEH A;  1N78 A;  3MKZ A;  3K4M A;  2WAD A;  1MMA A;  3DQV C;  4RLF A;  2LY2 A;  3OYA A;  4OWR B;  2IGN A;  3FBN B;  3OYE A;  2BW3 B;  4BEH B;  1DGR M;  1OR7 C;  3W2W A;  1JI8 A;  2IS6 A;  2E60 A;  3OYN A;  2E5N A;  3FHN A;  2Q1Z B;  2LC2 A;  1SAU A;  1ERD A;  2JUG A;  3SDB A;  3K4L A;  1T0F C;  4D1Q A;  4ANJ A;  3L2V A;  1V5E A;  2KRH A;  3OYC A;  4CCM A;  4ZC3 A;  4E7Z A;  4PSW A;  3OIP A;  3CP8 A;  2VL8 A;  1AA7 A;  1QHG A;  1ZEL A;  2W4S A;  3VYT B;  5KNL A;  3RTR A;  4C2U A;  1PJR A;  3S3N A;  2BVM A;  4XLH A;  4C2T A;  1LKX A;  2R4G A;  3V42 A;  4NNJ A;  3PNT A;  2XF6 A;  4YRV A;  3OS2 A;  3RCO A;  3ZXS A;  1UAA A;  4ZDO A;  4XN3 A;  1EA3 A;  4ZDL A;  4E7H A;  3OYK A;  3UNG C;  1TZL A;  3M1C A;  1BR2 A;  5FRM A;  2XSJ C;  2KMU A;  5CPR B;  3TL4 X;  2K3P A;  2KL4 A;  4PJN A;  1D0Z A;  3HUG B;  4ITV A;  2VLA A;  4XKC A;  2HNH A;  2JA2 A;  4B47 A;  2A5W A;  3GBG A;  2P0W A;  2W1O A;  2ZSI B;  4PFP A;  2CW7 A;  1W36 C;  3FBI B;  3G2B A;  3HKZ A;  4CCK A;  1GLN A;  2CW8 A;  2F4I A;  5CKT A;  2LRE A;  3PSF A;  2GOM A;  2WAE A;  2VAS A;  3E0J B;  4ZYA A;  4Y3O A;  3I9V 2;  1G8X A;  2DCE A;  3LSI A;  3K4B A;  2X6Y A;  1NG7 A;  2KPM A;  4FAS D;  2VPL A;  3K70 D;  3H9J A;  4E7S A;  2R7W A;  1BOB A;  3C2H A;  4BDY A;  2HVS A;  4ZJZ A;  2X1D A;  2M3A A;  3LL7 A;  2R7S A;  1WJF A;  2V6E A;  1DQU A;  1MND A;  3A2K A;  3AKZ A;  4CCO A;  1J09 A;  2L5Q A;  2X6W A;  4BQQ A;  3DPU A;  4PFO A;  2RRE A;  2KP6 A;  1WJ5 A;  3DPT A;  4PJL A;  3PNY A;  1X4P A;  2Y0S A;  3DKX A;  3SEZ A;  2UWM A;  3PUB A;  4EAT A;  4NQW B;  3C2G A;  4BGD A;  4HEA 2;  3OIQ A;  2V4J C;  4U7B A;  2UV1 A;  3OYH A;  2F5V A;  1T95 A;  3DPL C;  4F52 A;  2VIX A;  1D1B A;  4R79 A;  4IQJ A;  4LIU A;  2R7Q A;  2XF5 A;  3MMY B;  3ZRG A;  1X1C A;  3BLY A;  3D5R C;  2UUZ A;  3BC8 A;  3RSN A;  3OYD A;  1MNE A;  4KJZ A;  1D0Y A;  2IGK A;  4AU7 A;  2HVQ A;  3OYM A;  2LOO A;  3PJR A;  3SZG A;  4CCJ A;  4DJA A;  3W2V A;  3CMM A;  1QU3 A;  4DOZ A;  4QPQ A;  1WFX A;  2MD0 A;  2WY7 Q;  2IGO A;  4LG3 A;  2OC6 A;  4J01 A;  3DTK A;  4CH7 A;  1DP3 A;  4XMY A;  4HRI A;  3HOT A;  3SEQ A;  1Y56 A;  2V9K A;  2MC4 A;  4C30 A;  4XLA A;  2MYS A;  3ZGK A;  4IQ4 A;  4KIT B;  3PNV A;  2R7V A;  4XLE A;  4XOT A;  3H9Q A;  1LDK B;  2X1C A;  1X1D A;  2DOA A;  2JVH A;  4XKV A;  3S3O A;  1LVK A;  1X19 A;  4B3X A;  1Z21 A;  1UEL B;  2VKH A;  3LSM A;  3VYR B;  2X1E A;  3F9K A;  3CZ6 A;  2PMZ A;  4IX7 A;  4PK4 A;  4HNT A;  1WJE A;  3LSG A;  4IKF A;  3ZR8 X;  1D1A A;  2CFO A;  4U87 A;  3HL2 A;  3E1S A;  4CA0 A;  1FMW A;  3OR1 C;  1YE9 A;  1V5F A;  2M7B A;  2HU9 A;  4CCL A;  3HC7 A;  1YX3 A;  4GRI A;  4BL0 B;  4XOP A;  4B48 A;  4E4H A;  2XF7 A;  4RLQ A;  1YX5 A;  4NUB A;  4CSW A;  2LH9 A;  2VJJ A;  2VB6 A;  4BXF A;  4II2 A;  3LSK A;  3PSI A;  2CV1 A;  3QOE A;  5CQE A;  3UR3 C;  2F6C A;  2BVL A;  2O5R A;  3D5L A;  4XQF A;  3L2Q A;  2V1N A;  4XKW A;  3DWL E;  1WJD A;  2WBM A;  3CJQ B;  4XL9 A;  2ZXH A;  4XLC A;  3W3C A;  4BE0 A;  2GOX B;  1LFP A;  5FRO A;  2VQC A;  3ZQQ A;  2KHM A;  3VYS B;  2RQQ A;  2VQG A;  4J00 A;  4HST A;  2KLO A;  3QYF A;  3ZCO A;  1N77 A;  2OUM A;  2R7U A;  2DT6 A;  3NWS A;  4MLO A;  4PJM A;  2DJI A;  3MKY B;  4HG2 A;  1U0J A;  3H5N A;  3IAS 2;  3QYB A;  2CV0 A;  3DEE A;  1OLT A;  2QKM B;  4XN0 A;  3FKJ A;  3HXL A;  3L2U A;  2BOL A;  4BAC A;  5CQG A;  1QHH D;  3PFY A;  2HPI A;  4NC8 A;  3S3M A;  4KIS A;  5HVQ C;  2X51 A;  3VSL A;  4XON A;  2W00 A;  2PJR A;  2Q2E B;  3NWT A;  4Y33 A;  2E1M C;  1D1C A;  3OY9 A;  2HZD A;  4D9J A;  4PJJ A;  2PJR B;  1TT0 A;  3SYT A;  2IS2 A;  3CP2 A;  2CMP A;  2LG4 A;  2X6X A;  4JQF A;  1IRX A;  3LMM A;  2ELJ A;  4DBQ A;  3ONQ A;  3D5S C;  2V26 A;  3OL3 A;  5LD2 C;  4X0G A;  3BG6 A;  3K4K A;  4P1W A;  2MAB A;  3MD2 A;  5HNH A;  4E6K G;  3QYE A;  4LIT A;  5HNF A;  4RM3 A;  1X4O A;  3H0D A;  3OYJ A;  4F55 A;  2CUZ A;  1G59 A;  2HPM A;  5FRN A;  2Z16 A;  3I3L A;  3OYF A;  1PYV A;  3M8J A;  4HNU A;  5HLT A;  4YEL A;  3BCB A;  2WB1 A;  3H9G A;  3KX2 A;  2WAQ A;  2K5C A;  3FDY A;  3S93 A;  1FMV A;  1DGW Y;  1BR4 A;  3HG9 A;  2CH0 A;  4E7I A;  2W7N A;  2E5Z A;  1X1A A;  2CUJ A;  2L7K A;  1D0X A;  2WY8 Q;  2ZFU A;  4ZTF A;  4RM2 A;  3OMY A;  3K10 A;  2LY1 A;  3AL0 B;  2VKD A;  4OAZ A;  4CUG A;  2LRD A;  3BG7 A;  2HVR A;  2ZSH B;  2KRC A;  1P9Q C;  1E0E A;  3A1Y A;  4N4O B;  1MMN A;  4F91 B;  2IS4 A;  3OL4 A;  2BW3 A;  3DLA A;  2QKL B;  3CJR B;  3L2W A;  2R7R A;  2K9L A;  3IP4 B;  2M4K A;  3J7A Y;  1BR1 A;  2HQA A;  4XM3 A;  2WAF A;  3VWB A;  1Z3Y A;  2KDO A;  4BU2 A;  2K9M A;  3LSH A;  3VSK A;  3OS0 A;  2CS3 A;  4XNF A;  5KCM A;  4BJ5 C;  4BUP A;  4IZZ A;  2L9N A;  1WJB A;  3DU6 A;  1MMD A;  3DTI A;  3N05 A;  2XDV A;  4CCN A;  4ZTJ A;  3KYL A;  4N4N B;  3K70 C;  3IAM 2;  3OS1 A;  3OYL A;  3K4J A;  3BCA A;  4E7K A;  2M7A A;  2IS1 A;  1Z7L A;  1HA8 A;  2VQH A;  4BE2 A;  5TGT A;  4F3Q A;  2OV7 A;  4RMN A;  1MMG A;  2JVG A;  3U21 A;  3RPU D;  3K4N A;  2Z2S B;  1UG0 A;  2R7O A;  2L9S A;  4H4K C;  2IXS A;  2DT7 B;  1X1B A;  3EUH C;  4HPQ A;  1S9H A;  4B43 A;  1WJA A;  2V7F A;  2XAU A;  3HPG A;  4CZC A;  3MKW B;  2KZV A;  2WA0 A;  3OR2 C;  2RNG A;  2L2O A;  2LBF A;  4XOR A;  4ZDP A;  4DBR A;  5KHD A;  2CV2 A;  3W2A A;  2X85 A;  2A6T A;  4BS9 A;  1VZ0 A;  3AFH A;  3H5A A;  1MW7 A;  2NOJ B;  4G6T B;  4BQN A;  2LBF B;  3L2R A;  4XLF A;  2AQF A;  3TMO A;  4C9Y A;  3EUA A;  3S8P A;  4E7L A;  2ZXI A;  4II3 A;  4BDZ A;  4BE1 A;  2DXI A;  5LFA A;  2Z1D A;  4DIQ A;  1R6R A;  3EPZ A;  2JSP A;  3H5R A;  2W82 A;  3CES A;  1SFK A;  1N75 A;  3LFU A;  5HOO A;  3QOD A;  3VYU B;  2VJ5 A;  2LYC A;  3CF2 A;  3OYG A;  3IUO A;  1Y6I A;  2VJ4 A;  4PSX A;  2I8D A;  4P5O A;  2VQL A;  4QPO A;  4BJT A;  3A4C A;  2IGM A;  4KT6 A;  3EUK L;  2KQR A;  4B44 A;  5JHF A;  4XKB A;  3HPH A;  4NC7 A;  4YEJ A;  3S32 A;  3H35 A;  2MFZ A;  3AL0 C;  2R7X A;  1NG6 A;  2M4G A;  2VXD A;  4BJ6 C;  4F93 B;  2VXZ A;  4HSR A;  4LIV A;  3K4C A;  2HDW A;  4PUS A;  3DKY A;  4XR6 A;  4E7J A;  1Z3X A;  2R7T A;  1K6Y A;  3OWT A;  4JOM A;  4AVZ A;  1V5G A;  1WJC A;  4Y4R A;  2M0M A;  1W36 D;  4OAY A;  3DTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...