2GP5A

Crystal structure of catalytic core domain of jmjd2a complexed with alpha-ketoglutarate
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
347
structure length
347
Chain Sequence
b'ASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jumonji domain-containing protein 2A
molecule tags Metal binding protein
source organism Homo sapiens
publication title Structural insights into histone demethylation by JMJD2 family members
pubmed doi rcsb
total genus 100
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2gp5A01
3UYJA 4CCJA 5F37A 4BISA 5A3TA 2YBPA 5IVVA 5ISLA 2WWUA 4HOOA 4QXCA 2XXZA 3ZLIA 2YPDA 5KR7A 1VRBA 5F5CA 5F5AA 3PUQA 4CCMA 3KV6A 3N9PA 5IVFA 5IVBA 4CSWA 5FYTA 3PU8A 5F32A 4Y3OA 3PUSA 3PDQA 2YU1A 4DIQA 5A7SA 5IW0A 2W2IA 5FJKA 2XUEA 5A7WB 5FZGA 5FUPA 4C8DA 2OT7A 3KVBA 4QXBA 5FYIA 4CCNA 5F3CA 5FZ9A 5F2WA 5FY1A 5LY2A 4CCLA 4EZ4A 3LDBA 4DO0A 5FXZA 3N9NA 5FWJA 2OQ6A 5F3EA 5FBJA 5FYCA 2Q8DA 5FYHA 2OQ7A 3N9OA 5FP3A 5FPVA 5FYZA 5FZ3A 5A7WA 4BXFA 2XDVA 5FZOB 3PU3A 5FZ1A 3ZPOA 3KV9A 4LXLA 3K2OA 5FY0A 5A7QA 2YBKA 5FXVA 2YU2A 5FY7A 4XDOA 4CUGA 3N9MA 4AAPA 5FPLA 5FP4A 5FYBA 5FZCA 4LIUA 5FP8A 5FZFA 5A3WA 4XDPA 4UF0B 3K3NA 2GP5A 3OPTA 5IVYA 5FWEA 4IGQA 5F5IA 2OX0A 5FY5A 3U78A 5A7OA 3AVRA 3KVAA 2GP3A 5K4LA 5FYMA 5F3IA 5FZOA 3KV5A 2VD7A 4IGPA 2P5BA 5FUNA 5FZ4A 4GJYA 3RVHA 4GJZA 5A1FA 5FZ0A 5A3PA 3DXTA 3DXUA 4LITA 4GAZA 5F3GA 5FPUA 4EYUA 5FV3A 3KV4A 5A1LA 2OS2A 3AL6A 5F2SA 5FPAA 5A7NA 4QU1A 5FPBA 5FY4A 5FYVA 5FYUA 4EZHA 5LWBA 5A7PA 4CCOA 4D6RA 4Y33A 4E4HA 5FZEA 5FZIA 3NJYA 5A3NA 5IWFA 3U4SA 3K3OA 5CEHA 2XMLA 5FZHA 5IVJA 3PUAA 3N9QA 5FP9A 5FY8A 5FJHA 5IVEA 3N9LA 4V2WA 3OPWA 4Y4RA 5FZKA 2Q8CA 4LIVA 4HONA 5FZMA 4D6QA 5A80A 5FZ6A 5FP7A 2PXJA 5FY9A 4QX8A 5IVCA 4QXHA 4GD4A 5FYSA 5ANQA 4ASKA 3LD8A 4CCKA 2YBSA 2Q8EA 5FZAA 3AL5A 3PURA 4QX7A 5LW9A 3PTRB 4NUBA 5FZDA 5FZBA 5FZ8A 2WWJA 5FZLA 4QWNA 4V2VA 4UF0A 5FXXA 3AVSA 5E6HA 4BU2A 5LY1A 4D6SA 4AI9A 5F39A 5FXWA 5FZ7A 4URAA 4TN7A 4IGOA 5FYYA
chains in the Genus database with same CATH superfamily
1UCXA 5IK8A 3T2PA 3W58A 2DCYA 1L7LA 1D0GA 2YBPA 3V0AA 3B01A 4Q8KA 1UL9A 1KDMA 4KU8A 4LE4A 4XFGA 4LT5A 2K0GA 2RV9A 1ENSA 1PHMA 2A6ZA 2VULA 4FTBA 2LALA 1W8HA 2JICA 4QB2A 4I3GA 5BNPC 3GZEA 3BVCA 4FTSA 4LKDA 3WF3A 1RIRA 3EBRA 5JZGC 4JKKA 3M7AA 2JDPA 3AZZA 4O9EA 2J22A 5T5JA 2BW8A 3GXUA 1GANA 1H1AA 2RG4A 2OA2A 5FMOS 2MEV2 2Z5WA 1IPKA 1N1VA 2D5FA 3PNAA 2VUDA 4TWTA 4YYOA 4V1PA 1UZVA 4AGRA 5C4WB 4M0NA 3ES4A 3A0KA 4Y1VA 1SLAA 5LBEA 3VGIA 3VBFC 3ASIA 2V4AA 3DL3A 3ZFGC 1R081 4FOQA 3UKTA 4YG0A 5FYCA 3E5UA 3AKPA 4L0PA 3SCHA 2R1BA 1QWRA 1LAJA 1ZZ8A 3LGRA 1BCXA 4KI5M 2JX9A 2VZQA 4LXLA 4TSVA 2UYAA 3CL1A 3DCQA 4XMIA 4LKFA 3KSCA 4XHXA 2IUWA 3PJYA 2E31A 3GCWA 2YU2A 1FMD3 1RUG3 4N9IA 4IL7A 1IS6A 1GZWA 1MS9A 5HV4A 2Q1FA 5FZFA 2RDRA 5C4WC 3JBG3 4AEKA 2ZHLA 1QDCA 2JDKA 4QPYA 4LR4A 1D2QA 1OLME 2VAUA 4AQ6A 1S2EA 2RHPA 5A3MA 1SFYA 2WO2A 2RJ2A 4LBNA 4QQ2A 4YGCA 4YVWC 1SDWA 4D8MA 1NKGA 3AP4A 4HETA 1VMJA 2A3WA 3GDBA 3ZPYA 4CDWC 5DAXA 3DXTA 2BV4A 4CPBD 1ZRRA 5C8WA 5I8SA 1K5JA 2D6NA 3KV4A 1PZ8A 4QQLA 4AFBA 3LFMA 4QM8A 4ZZ8A 2Y64A 4ET7A 1U5XA 3INAA 4QQOA 3W21A 4LBOA 3WCSA 1GICA 2NP0A 5A33A 1W8TA 1R083 1PMIA 2GH8A 4XAEA 1RVF3 1GNZA 3J8F1 4NIGA 3C7GA 2HWC2 3JB8A 4QPIA 5FQ0B 4HONA 4GH4A 2HWE3 1EV13 3A23A 3EO6A 4JGZA 1POV0 1OI6A 3K4DA 2VMCA 4Q4V1 4RGGA 4CCDA 5J1XA 4PIYA 1AR61 3CIHA 1ZA4A 2RE9A 5A3LA 1PGL2 3J4UH 5M0TA 4AEDA 3LOBA 3WX5A 1PX4A 3NNFA 5B2GB 2PTMA 1OOPC 2UY9A 3D0SA 1CONA 4Q27A 1WLCA 2GU9A 2FD8A 4XDQA 3T2OA 1N1TA 2PAKA 5CVRA 5CADA 1Y3TA 4OZXA 3SKVA 4AHYA 1AYM1 4TYSA 5FZLA 1XSQA 3C8XA 3SC7X 1FYUA 1S0GA 4FT8A 1WLWA 2WNUA 4CXXA 3NNLA 1B35A 4AL9A 4LKEA 4LNVA 1Y9MA 5FXWA 2G9FA 4UYBA 4MG2A 4LHLA 2P3JA 1SPPA 4K21A 2BBAA 2GN7A 3J8F2 3WZ1A 1W0OA 2RR12 3J7LA 2VC9A 4AF9A 3A22A 5K9YA 1AR73 1GBGA 1JU3A 3IM0A 5KR7A 4PI0A 2FQPA 4UW6A 4AE2A 1W3XA 2BOJA 2B45X 5CBLA 1OUXA 2YROA 4Q4Y1 3UL2A 2VTXA 3AC0A 3JCIA 4YG3A 1WD3A 1Q5OA 3AMMA 3ZVXA 2ATFA 4XUOA 3TAYA 3B02A 1HQWA 2QUOA 5BY5A 2KXLA 3U07A 4YVSA 3VN4A 5IT6A 1AL22 3HOBA 4UAPA 3BI3A 1RUE2 3HT1A 3ZIXA 2F17A 2OUJA 4HKOA 4PDWB 3AK0A 4ZU4A 2VW0A 5CIRA 3P6BA 4AFDA 5LRSA 5FO7B 1UOJA 1NYWA 1YQ8A 2JG8B 5FXZA 3ZMNA 4ARYA 5F3EA 5LBBA 1C8M2 4NPLA 1NCRB 1W9TA 5SV8A 3U78A 5AC92 1PVXA 3OY8A 2ZGOA 4CDUC 2VZRA 4RFT0 3AFKA 5FZOB 3I3DA 2JDYA 2P17A 2YDEA 3KT4A 1OBNA 3U10A 3J7NA 1OH3A 4JV4A 5FMCA 4DXRA 4CDXC 4Z8BA 1J59A 2ZACA 2AREA 1OKQA 1YIFA 5B4XA 4AAPA 3DKWA 3PVBB 1M4WA 3MIEA 2W9XA 4CCCA 1PO13 5ABJB 4QGMA 4HXCA 3VZJA 1JBCA 1ULFA 4E2QA 4F8AA 5KWRA 2A6XA 1RUF1 1VBB2 4D7TA 3I2KA 1H4GA 1ULOA 1ZYBA 3IN9A 3DPRC 1K5MB 1WCDJ 2WC2A 4BB3A 1O6UA 5GM0A 4E8DA 1H30A 5JOYA 5BNPB 3TNPB 2EXHA 5DAWA 4C0BA 1Y7BA 3KQ4B 4M00A 5C3OA 2OZ6A 1WMFA 2HEYF 2R16A 2VNOA 3WVJA 5JDBA 1ZA7A 1AXZA 4G3YC 4YM3A 1K5MC 1VBE1 2VXRA 5FPBA 2AACA 5C8CC 2X5IA 3AZYA 4Q4V3 5C9AA 4YARA 3U4XA 4OVEA 4Y33A 3MLLA 3TEYA 2BWAA 3T0BA 5FPXA 1VLNA 3PIJA 4KWUA 1J58A 1F2NA 3B94A 1HV0A 1OHFA 2ADEA 2IXIA 2DTWA 4LE3A 5IVEA 3H8OA 1PGW1 4WM8A 2VXJA 3X29B 4YW4A 4DEQA 1Z7S2 5BNOA 3WD5A 5FFOC 2G4IA 4LTAA 2JJ6A 4QXHA 4GALA 3TEWA 4XEZA 4LUMA 3SMHA 5DABA 1PM4A 3ZSKA 1RHI3 3LA7A 4LK6A 3B9IA 1YLLA 2WO3A 1SBEA 2QQMA 2YBSA 2OZJA 3RRDA 3ETQA 1K45A 2WLPA 1RJ7A 1PGW2 4V2VA 3HBZA 2DWRA 2PLV1 3S5QA 3LPFA 2E9QA 2WINB 3AYCA 4R8HA 4WBBA 4ZONA 1OH4A 1RC6A 2NMNA 4YNIA 4RS5B 2B46X 4K40A 4XW3A 4INDA 4AEMA 1GUIA 1XYOA 4C91A 1QJX3 3CKHA 1JZ5A 5L36A 5HXVA 4Y26A 1UD1A 2D3RA 1K42A 5F5CA 2HWF3 1O4YA 1C5HA 2W5FA 3RZZA 3WP6A 2JG8A 1IPSA 4DNYA 4LBQD 1FOD1 2R0FA 3L2YA 1NCQB 3ZSLA 1BMV2 4Q4W1 4QX5A 3VKNA 4MXWB 1TNRA 2WKKA 2WT1A 3I4IA 2VM9A 5KHKA 1S1AA 3U1XA 3M8LA 4CCNA 3DUIA 4HMZA 1QXRA 4EQVA 2NN8A 4CCLA 2WN2A 5FDBA 4UT5A 1HXS3 3C7HA 1RB8G 4LO5B 4YZ4A 1U5YA 2D97A 4MGIE 4QMAA 2VMDA 4WV8A 1YHFA 4P00B 1EAH1 1RHI2 5FYZA 4FAHA 4XZUG 1OLQA 3ZFEB 3PVEA 3PU3A 4JC1A 3KV9A 3OGGA 2ZZQA 3JXSA 2ZX3A 4RSUA 1Z7S3 4PLNA 2XQXA 5LK7B 2PHDA 3AZVA 1W99A 1VAKA 4EROA 3N9MA 4QT6A 1WCKA 1KDKA 2ZEXA 1QJX1 1WW5A 1GOGA 4CA9A 1PVC1 1QNYA 1W2NA 3JU9A 4TLGA 1U5ZA 5L7OA 5FWEA 3AXEA 1UZWA 1FPN3 4OCTA 4QPGC 1BK0A 4DRRA 5A7OA 2GP3A 2LROA 4RR3B 3B93A 2R071 2JDZA 3I3BA 3H8XA 1RUJ3 5EJZB 4YPJA 1PO11 3LA3A 4N90A 4NHKA 4DXZA 2JE7A 1LHVA 3CQOA 3POJA 1X50A 1H8TB 4WZFA 1AR91 3WUCA 4BQ2A 4NHXA 5HCAA 3RFRA 3AB0A 5CZKA 4E4HA 3GHNA 2WZEA 1H8VA 3KLSA 3IDAA 1Q8OA 3LB9A 3W20A 5CISA 2PELA 1OVSA 2IFRA 3J9SA 5FY8A 5IHRA 1RUI1 1E5IA 2ZPXA 3ACFA 1W6PA 1CQ9A 3J26N 2BTVC 4RGAA 1V9U2 3THTA 4O61A 4P5YA 3T4VA 1DZTA 2N7GA 5T5OA 1UY0A 1OA3A 2AR6A 4NWWA 4XBQA 2ET1A 2HWE1 2IVIB 3EJKA 4W6XA 3WQBA 5CFCA 5L7OB 1HQNA 2X5IC 1SEFA 2VOKA 2QCSB 4ASKA 3LPGA 3W5MA 5BNNC 1JUHA 4M4PA 3JQWA 3WHTA 3MICA 3ALQA 5FMOL 5GLVA 2ZCWA 4HVQA 3JUUA 3CU7A 1G9DA 1JTZX 1QOTA 1V00A 3AL5A 1IS4A 4KG8A 5LW9A 4HN1A 2R043 3VLBB 3OBTA 5LZ6A 1DCSA 4FP2A 2K2SA 1AX1A 4XJUA 4BM8A 4DB5A 3VKOA 2K9ZA 3WNNA 3A7QA 3VBHB 3VUOA 1S0EA 1TZOA 1GQGA 4QB6A 4DZGA 1HXS2 3B3QE 3WNMA 3MDPA 5FYYA 4QX3A 1OF3A 4IV3C 3OCPA 2HKXA 5E1RA 5ISLA 4Y4YA 3MW3A 3JZVA 5IVVA 4HOOA 4P9GA 1VAVA 3V64A 1LOCA 5G05L 3NJXA 5C70A 2YPDA 3HQRA 3N7MA 5F6LB 5F5AA 4AVSA 5TSWA 1WUVA 3FLPA 4UW5A 4UXAA 1AR72 2G9ZA 3ILNA 1PZ7A 3HMYA 3POFA 4ITCA 5HI0A 2VMEA 5F32A 4CDUA 1VR3A 3PLQA 5F7UA 1ONAA 4IE6A 1E5RA 1MS4A 3ZXFA 4HT1T 5J3UA 5FTTC 4JRAA 2VTFA 2RS52 4TZDA 2XUEA 1W6NA 4I3PA 1Q8PA 1RVF1 1WCQA 2BVVA 3KF5A 3B9CA 5CFDC 4CPBA 3RWNA 1T6GC 2R042 2ARCA 4Q29A 1DF0A 5FY1A 4BPZA 1ZBE2 4KU7A 1S55A 4MGQA 4XFCA 4K8RB 3I97A 4YZ1A 5JUVA 3MYXA 1UXXX 1ND3B 5FWJA 1CPNA 5HCBA 2Q8DA 2JDNA 1FXZA 1R1A3 1BBT1 1VPHA 2BYVE 3GBGA 4IV1B 4UFKA 5FO9B 1R1A1 2OYZA 3VL8A 4D94A 1V9U1 2L9LA 4UFMA 4KGQA 1EV12 3H3ZA 1A34A 3M3IA 1XOYA 2C1FA 1SACA 3VKFC 3IDCB 1WLTA 2JG8C 3RYKA 2MEV1 3ZXAC 1GSLA 1SLTA 1V6IA 5GJ6A 2VMIA 2ZX0A 3POGA 4IGQA 1BYHA 1CX1A 1YJKA 4QPWA 3RPQA 1LTEA 4Y5SA 1G6NA 1VRH1 2JXAA 4HK8A 2VNRA 4XXAA 3U11A 3WG3A 4FPJA 4JZRA 5FZOA 5FQ0A 5H9SA 3JBG1 1BXHA 2R072 2LRPA 2I45A 4LBQB 4YZ3A 3MBWA 3WW1A 1KJLA 2Y6FA 2FCTA 5EHDA 4CP1A 2A70A 3IIAA 4NAOA 1UYXA 4Y20A 5FY4A 2YPJA 2ZTNA 4ES8A 2EAAA 3T09A 3S57A 4KMQA 3OBZA 4R52A 4BH9A 1JZ2A 3BIEA 4CU9A 2EICA 2P34A 1U12A 3PMEA 1ASJ1 2QQPA 2ILMA 3N9QA 1SBDA 3JBG2 2BGCA 3N9LA 1XNCA 3S7IA 1ZNPA 1NA1A 1OUSA 4XF4A 1J3PA 3HWJA 3E6CC 4D6QA 4NHLA 4H7MA 5FZ6A 4B4PA 1VP6A 1AXKA 2VMHA 2O8QA 3IBMA 4LOSA 3O1SA 1OQEA 3ZSEA 1IS3A 1KS5A 1XBFA 3Q8BA 2Q1ZB 4OMCA 3URFA 4L8QA 3WINE 4CP9A 1GKBA 4URTA 1CD3G 2DVFA 1N47A 1RUC1 4DS0A 1SLBA 4Y20B 1SPPB 2JENA 3H1YA 4A7YA 3WG1A 2QFEA 5JI9A 1KXGA 1IKPA 5DDJ3 2WFPA 3RMXA 1ZRCA 2HWB3 5E6HA 2YYOA 1CVNA 4FXKB 1E5HA 2QBXA 1W8ZA 5GLZA 4Q4W2 4AI9A 3HEIA 4WZCA 5JZGB 2R062 1BZWA 1W6QB 3IB3A 5I0TA 3DPRA 3S30A 1ZBE1 3R0RA 3WNOA 2YY1A 5A3TA 3ORJA 1JZ3A 4BQWA 2XXZA 2ZMLA 3QBQA 3QH6A 4RQPB 5BNOC 1XC6A 3KV6A 3ELNA 2Q0AA 2WLQA 5C7GA 5A32B 1M06G 4H55A 3D8CA 2D93A 5LA9A 3WSOA 2GC1A 1LOAA 1LOEA 3NNGA 5L9BA 3VBFA 5A33B 3UGFA 4DY5A 1ZZ7A 1WMDA 4BLJA 3CJXA 4IETA 4PF1A 5BXXA 4UBHA 1VIWB 1ODMA 2QJVA 3KQRA 4BMEA 2DF7A 4LBKA 1IHMA 2CNAA 2OPKA 3AX4A 4NIAA 3UKVA 2WWSA 5EWSA 1HXS1 3MLKA 1US2A 3PMSA 1BJQA 4L11A 5BNPA 2XDVA 2ZS6B 5FREA 1JYXA 2IWGB 3DPRB 3K75B 3ZPOA 2I07B 5H9RA 5A7QA 1DGRN 1QKQA 3FBYA 4FCAA 5FXVA 3I2HA 4OQ9A 4DUVA 1J3QA 1KRIA 4QDSA 1RMU3 1DYKA 3LEMA 3HD8B 3ZR6A 1F8VA 2IXHA 2EAKA 1I6XA 3DF0A 3OPTA 4RYDA 2X05A 4AK3A 4Z2WA 2C26A 3HBKA 3PHMA 2Q5TA 1T6BX 3WP4A 2HWE2 4Q8LA 4RHV2 1TME2 1SZBA 3O0WA 1C3HA 5FY5A 3WNLA 3ZYFA 4AI8A 3T2TA 4Y1XA 2UURA 2WUHA 2QTWB 3DYPA 3KVAA 1OFSA 3ECQA 3M4FA 4HPKB 1CAVB 5LATA 4XF0A 1I5PA 3I3QA 1UX7A 4AI0A 1H1MA 4EV0A 1CJPA 5HCFA 5JWPA 2HWF1 2QQKA 1GU3A 3E97A 4XF3A 5F2SA 2DUOA 1TQ5A 2ZGLA 4XUNA 4AGVA 2R32A 4FQ4A 1PX3A 5FYVA 4EZHA 2Y33A 1NXD1 1POV3 5A70A 1G9AA 2HYXA 4N53B 1MZ5A 1VRH3 4LHSA 4U2AA 4Y5TA 3RGBA 4A42A 4BYYA 2ET7A 2VL4A 1YJLA 3FWEA 2CL2A 2AEYA 4OUSA 4CP9B 4E9KA 4E2GA 5EJ1B 5A3NA 1HRI3 1PO12 1D0HA 1PIV1 1UZZA 2XBO1 4GMP1 4LBJA 4AZZA 2VG9A 2ZX4A 2VR4A 4AEDC 4JDNA 5L19A 4V2WA 1PM7A 4MYEA 2W1UA 4BA6A 1QXJA 5C5TA 1E57A 3WDWA 4Y1UA 4CEYC 1NLRA 1X8MA 4GA9A 3IMNA 5D2AA 4GH4C 2UY8A 4NPMA 4LPLA 3LDRA 2P1BA 4FPHA 5AC91 2GMPA 2PHTA 1VB2A 4XQDA 3H0OA 4QGNA 3P3PA 2VY0A 2VCBA 1HX6A 2RS11 1DLLA 4L92A 3CJIC 1RUE1 2X10A 2WAOA 3HVDA 3I59B 3PURA 4HK9A 3ABZA 4NO4A 5BNQA 3ACGA 1COV1 3A4UA 5FZBA 1WA4A 1YUDA 2WWJA 1ZRIA 5B4NA 4M0HA 3USUA 5C71A 5DMYA 4MV2A 4E2SA 3AVSA 5E16A 5ACA2 1CAXA 1QJFA 2XJTA 3EB7A 1SCSA 2WR9A 3GYDA 2QKDA 4N53A 5FZ7A 1FOD3 2WZR2 3PL0A 4MLOA 1KD7A 2D40A 1AX2A 3VDDB 3ZDVA 2WBKA 3IDEA 4L99A 1W6QA 4XFBA 1JZ8A 2YC4A 2ZHMA 3I2GA 2DCJA 2FHRA 3FN9A 3J7HA 3NJVA 1YRZA 2R49A 3M70A 1AX0A 3OYWB 3P1IA 2RR11 2ZMKA 4W50A 4QPIC 1PGSA 2IFWA 2CYFA 4AGGA 4NPRA 2JD9A 2RR13 4IEZA 3MIHA 2GC2A 1FOD2 2WZR3 3F2ZA 3OUJA 4Q5OA 2A71A 4XC9A 4ZS3A 1ZBA3 3WLUA 4AW7A 1LU2A 2JIGA 3POSA 2PAMA 1REDA 5A7WB 1AYM2 5L9RA 3MUZ1 4Y22A 4WM7B 4FPFA 3TRSB 2A7AA 1W8WA 3AZXA 2KM2A 4CDWA 1NZCA 3BU7A 3LQCA 1EPWA 2A6WA 3O14A 1OD3A 3UK9A 4P9WA 4YGDA 3ZOIA 4AQSA 3OY8B 5FYHA 5C3PA 1PGL1 4MHRA 2XVKA 3I8TA 1DIWA 3VBOC 3W9AA 2WQ4A 5DPNA 2RS13 4HG6B 5FR3A 2VZ3A 4JAAA 3VBHC 2TBVA 4IERA 1MEC3 4CCEA 4AG4A 1GWLA 2QDNA 4PBPA 4PF5A 4XUQA 3VBRB 3ZYPA 3KMHA 5FPLA 1MEC1 3ZXEA 4CUGA 2ZOEB 1OOPB 2C5DA 1GZTA 1G9BA 2GMEA 3K3NA 3T1LA 1HKDA 1Q8VA 2ZXQA 4LUKA 2PN5A 4BXSV 3VBRC 2BWCA 2OX0A 1RUNA 4LLFA 2HYKA 2Y38A 3L9JT 5K4LA 3PJQA 4ZU5A 1UAIA 4GWNA 5F3IA 3HQXA 2MHFA 3I7DA 5D1IA 1BVVA 2NPIA 5K0UA 1L7QA 1W05A 3CJIA 3DXUA 4GAZA 1W04A 1ZM1A 1YQ5A 3THDA 4C90A 5FLJA 1FNZA 3TEXA 1GQHA 2P2KA 2VZOA 4D6RA 5JMCA 1HJFA 1VBC2 3ZDSA 1PK6B 2AYHA 3AP5A 4R9DA 2DVDA 2DBNA 4LBQA 4CEYA 3WY6A 3VBUC 5IVJA 1LGCA 2ZAHA 3HN3A 1JHJA 3I2FA 2ARXA 3SH3A 3Q8AA 2ZGMA 3G7DA 4U36A 3NAPC 1NE6A 5BV6A 1AVBA 1GP4A 4P14A 4CEWA 3DKQA 1EY2A 3LCPA 5FY9A 1VBB1 2ZZJA 4P9YA 1DZRA 2WT2A 1RINA 1WA6X 5FYSA 1QOSA 3D82A 2JE8A 3H3UA 5K0UB 2VQUA 1JOBA 3S5AA 5KHGA 1Q43A 3K4ZA 1ZRDA 2Q8EA 4KBZA 4A3XA 2R6QA 1ZX5A 4IEXA 5IATA 1VAMA 1W8FA 2BVBA 3Q8CA 2W08A 1TMF2 1BLZA 1LCLA 4Z07A 4P9JA 3POEA 3OG2A 2ZGSA 1FV3A 1LHNA 1MQTB 3K46A 1LGBA 3VZMA 1ULEA 5KHJA 1MR5A 4PIZA 1CZSA 4YLZA 1GP5A 4D6SA 1XNTA 2Y6LA 4GZ9A 2IXJA 4IE7A 4TN7A 5J36A 1O8SA 3NSTA 1D4VB 3IT8A 3OPZA 3MPPG 2OXBA 4QDQA 2FCUA 2C0ZA 1ASJ2 1FT9A 1H2KA 3E5QA 5FMDA 4FOVA 2WZ8A 4CVUA 1ZBA2 1VRBA 2PHXA 4PHZA 1W0PA 1QGLA 2AUYA 5DUWA 4CU7A 3VHOA 4TXWA 4YM1A 1HRV2 4DUXA 4LK7A 2RMU3 4N43C 1XB9A 4Y3OA 2D98A 2RDQA 2XH6A 4F7ZA 3PVOA 1VBD1 5CA6A 3UETA 2BERA 1NXMA 3R4DB 4WVMA 4FPYA 2OT7A 1MZ6A 5D8AB 5FYIA 4LO7A 2EXJA 2WS92 2YMZA 2WYSA 4JGYA 1ZREA 2GH2A 2BGOA 1NOVA 2WAAA 4PIXA 2BFUS 3FFQA 3GBFA 4E4ZA 5I0SA 2FDFA 4ZY9A 4A4AA 1H4HA 1XNKA 4Q0UA 3FFZA 1LB2A 1S0JA 4AVTA 4CU6A 1V6LA 3B7MA 1RUOA 3NAPB 3SEEA 5IK5A 4RS5C 3CF6E 3OSDA 1AL0G 3WNKA 1EV11 1GZWB 1SG3A 3FHQA 4Q0SA 5FZ1A 2DFBA 2J7MA 2DVGA 4A2UA 2AZ5A 3V0BA 3VBUB 2FDIA 2H6CA 3ZYIB 4WM8B 3AKTA 1CWPA 4KWLA 3SISA 4AAXA 2ERFA 1HLCA 4QHOA 5IVYA 3BPSA 5HXMA 2CTVA 2AH2A 1RUJ1 1LESA 1ND2C 4Y5Z0 5FPZA 1HB4A 4OFGA 4XXPA 3UESA 2HWC1 5FZ4A 1QXPA 3RVHA 4M3CB 1GZCA 2B42B 3AP6A 1LRHA 2Y0IA 1W03A 1POV1 4RR3A 1YQ2A 2O1QA 4X6QB 3ZFGB 3AMPA 1RUD2 1ND3C 2RMU1 2UWCA 1REFA 2HBTA 4JQTA 2A6YA 4FFHA 4XETA 4E4SA 4MUVA 4RA0A 2ZEZA 1KFXL 2SBAA 3NJYA 1W6NB 3IZOA 4EE2A 1QJU3 1SLCA 4XACA 2JE9A 1O4ZA 3BALA 4JRLA 2WA4A 4YW7A 5F6KA 3RS6A 3SCGA 2AENA 1QIQA 2KR2A 2F4LA 1QEXA 3U37A 4OQ8A 3ILFA 1UPSA 1OKOA 4ATFA 4AHXA 3VD5A 1SQ4A 4N9HA 1HB2A 1P8JA 2D6MA 1HN0A 3I3EA 3WF0A 4AXOA 1NLSA 1O3TA 2ETEA 2QZ3A 2RS32 1MS3A 1UNBA 4XTMA 4H14A 1NG0A 5FZAA 5JOXA 4UW3A 1H9WA 4GWIA 2QQWA 3WOGA 5ABJC 1Z0HA 1ZRFA 3NV1A 1BBT3 2VUJA 4FOYA 3OUHA 5EP9A 4HANA 4P9IA 4X6RB 5FXXA 1WW7A 4MX3A 1GV9A 3R05A 4CYDA 3WP3A 1D4M2 1MQTA 4FFIA 2EF6A 2XHNA 4SBVA 3CZUA 5AVPA 5T55A 1XNBA 2ARBA 4IGOA 4DRVA 2ZGRA 2E32A 4ARXA 2RDSA 4IEYA 4D7YA 1HJGA 2XUMA 4QXCA 3BUCA 3N4MA 4CDXB 3ZXJA 1MVQA 4R9AA 4EJRA 1CAWA 1CESA 5J7MA 1WMEA 5T3NA 4ZHNA 3OJBA 2FMYA 5JXHA 1AR92 1F31A 4BJ0A 4PCRA 2OVUA 3CLPA 1QQP1 3MW4A 4FQZA 4LO8A 3OD4A 1H6XA 1TME1 5APAA 3IWZA 3P3NA 1Y9QA 4GWJA 4RN5A 3T0AA 4BK5A 5FLIA 3FZ3A 2BEOA 5IK4A 2GAUA 4YVWB 3WV6A 4BQ4A 2WNVC 2A3XA 4K6BA 1RJ8A 1W90A 3OD0A 1CAVA 2BNMA 2J1UA 3BN6A 1YWKA 3VDAA 4DO0A 1DGWX 4XFFA 2VW1A 4PI2A 4XAAA 2WFF2 5IYYA 1OA2A 1QY4A 1JS9A 4IV1A 1VBA1 2C24A 5A7WA 2VJXA 3NNJA 2W47A 3DYMA 1AR81 1Z78A 1TVGA 4YM2A 1UO9A 3SHRA 3ZFFC 1CZVA 1PO21 2NYYA 1N3PA 2YBKA 1DBNA 1V6MA 1MPXA 2JG9C 4KL1A 5DG2A 1VALA 3FL7A 2F4PA 1LODA 2VPVA 3QLQA 4PLMA 3ZXGA 2IVJA 4DUWA 1OF4A 1Q56A 1OXCA 1N3OA 1H1IA 2EIDA 1UKGA 1JYVA 2PHRA 1QOOA 2D6LX 1O8PA 2A75A 4MHUA 2CGOA 5AVAA 4Q4Y3 3HAGA 3IPVA 3SLIA 5FUNA 1Q3EA 5CB7A 2KA3A 1NY72 3S6PA 3D5OA 3UJOA 3B69A 3H3LA 3UJQA 5J96B 1RUJ2 1LKNA 2XONA 1YI7A 2XWBB 1F9KA 3AL6A 1UWWA 4PQQA 5LA1A 1EYBA 1ZZ6A 1FPN1 4W8JA 1W39A 4TLFA 4UFHA 1CN1A 3AKRA 5FYUA 4PT6A 1C5IA 5A7PA 5LWBA 3O1TA 2CAVA 1FPN2 5BNNB 5BYNA 2JB4A 2R073 3ZFEA 2IXLA 4A6OA 3K3OA 4IESA 4MZUA 5CYYA 1NY71 3LOIA 5FJHA 4XYXA 2CGPA 1EP0A 1DP0A 4XJ8A 3WCRA 3K77A 5A3UA 2DUQA 2D44A 1R1ZA 2O0OA 1VMFA 2DYCA 2CDPA 2E26A 1S2BA 4H7LA 5IVCA 2Z4FA 4I0BA 3C7EA 4WVMB 3MF6A 3TNQA 3LD8A 3RZMA 2VBDA 1UW8A 3OGSA 1NCQA 1BHGA 2WNVB 4QX7A 1EAH3 2VBPA 1A8DA 3MUY1 1W2AX 4QWNA 1ST8A 5DZFA 5A6QA 4GB33 1YQ6A 2R1DA 3GJAA 4ASMB 2LS6A 3DYOA 1C57A 1UZYA 2BGPA 4COVA 5CFCB 3KHCA 2ZABA 2HEVF 1YFUA 2R0HA 4YZ5A 1ODNA 1DLCA 1BQPA 1YIPA 3E1F1 5LRRA 1CIYA 3TN92 4YG6A 1ZBA1 2ZAAA 2VH9A 4RQPA 5KBFA 2WNOA 2R30A 4LO4B 1JOPA 5J98B 5BNNA 1JW6A 4A7ZA 4FPOB 4DEVA 2Q1MA 2BUKA 5T54A 5GKAC 1YI9A 1QJY2 1DG6A 2VE1A 3ITQA 1WBFA 5T52A 2BRTA 5FK8A 4AR2A 5CG9A 4Y1YA 4DXSA 3ZFEC 4KWKA 5EYXA 3UT0A 2W2IA 4MSVA 1HB3A 5FJKA 3ZIWA 4QXBA 3VKLA 5FIXA 4NE9A 1J1TA 3GZTB 1LOGA 2CV6A 4NRPA 5CNAA 1C4RA 1JN2P 3KT7A 4Q1PA 3BU0A 5FZ9A 5FBZA 3FLRA 2UYBA 1C1FA 2G19A 4LEJA 1LOBA 4P9LA 2VNVA 3LDBA 4RL7A 4J6GA 3M2MA 4FVVA 5HBAA 3T1MA 3PUHA 4AQTA 4YW1A 2LTNA 1GNHA 3AJYA 1NQJA 3MW2A 4AFCA 5FZ3A 5AFBA 2ZMNA 4HSLA 3VBSA 1ULCA 3NRUA 1BBT2 1ULDA 5C6CA 2VCCA 2AGSA 3M3OA 4I2OA 3I59A 2WSVA 3KHBA 4AEJA 4FAGA 5FCCA 3LAGA 3FLTA 3I3MA 2DV9A 1KGYA 3L2HA 4H3WA 5FP8A 5DZGA 3ZN5A 1A78A 1UQXA 2RM22 5LBCA 4LLOA 2XHKA 5GZCA 5CKMA 5KHIA 4LULA 4JVAA 5KXEA 1WCUA 1OFNA 2W39A 4YWAA 4IE5A 1UY1A 1AL21 2DVAA 3AP9A 4B7EA 4Q1RA 4A7KA 3I49A 3KV5A 2DCKA 2P5BA 2YG0A 1OURA 4K7JA 1H2MA 3NJZA 4Z1VA 5F3GA 3M3CA 4EYUA 1MQTC 2VMFA 1YO8A 4QU1A 4Q4Y2 3POBA 1HIXA 2YV8A 1LOFA 4AWDA 2XG3A 5C3QA 5EQUA 3GHMA 3U4SA 1SFNA 4B29A 3CMGA 4D7SA 3O1UA 1K12A 1XE0A 1JUIA 2YGMA 3PUAA 5IFTA 3GF6A 1A6CA 1LHOA 4WM8C 2HWD2 1UPIA 3N3HA 4JDMA 4CDWB 1GNYA 3ETPA 1RUH3 3PIGA 2VCAA 5FP7A 4ISRA 2V72A 1X9TA 5KXCA 2RM23 3O1PA 2WN3A 4QKNA 2WJSA 4ZU7A 1CGPA 2CY6A 5C8CA 4NVPA 2JEMA 3ME2A 2W91A 2E6VA 3MZHA 5T50A 1O59A 3P5BA 4I09A 4DXTA 3ACLA 1UYYA 3VDDA 1W2OA 2BZDA 3OBAA 4GKXA 1US3A 3T4HB 1C1LA 3WNXA 1RUE3 3QOPA 2VW2A 4ZS2A 2VO5A 3H1MA 3VZLA 5LY1A 4RR3C 5LCWL 1CR7A 1PO23 1G86A 2TUNA 4CZSA 3BPZA 1V6KA 3NVCA 5BNOB 3RZJA 2WS93 4LJHA 2D6OX 5GALA 4BE3A 4KWJA 2YC0A 2C9AA 1SDDB 1DQ2A 2WS91 2WQ8A 3CJIB 1W9SA 4A45A 4LHNA 4CDXA 5JSPA 2JDUA 3S7EA 4CCMA 4K3UA 5IVBA 3A21A 1HRI1 4NAMA 2CWMA 2WZR1 3FC0A 3KD4A 1HRV3 3RDIA 2ZEYA 1ZZCA 4JGYB 1CIWA 2J1VA 2ZX2A 4OI4A 3TEZA 1N3QA 1H9PA 5IW0A 1DQ5A 4LA2A 5FZGA 3TN93 1QJX2 4BWOA 3RNSA 1ND3A 3U75A 4GIQA 3RZGA 5LB6A 1YFWA 1D2SA 1V70A 4MGYE 3THPA 2XWJB 4KQ7A 1SHWB 1POQA 3MV11 5D8AC 1Q8QA 3JQXA 2ID4A 3T0DA 4O7XA 3JD71 2E33A 5FPVA 2VZUA 1OQ1A 4IEPA 4BCUA 1EAH2 1RHI1 4ORFA 5GZGA 2RJLA 3K2OA 5JIUA 3UGGA 5DAQA 3LZZA 2WIIB 2XJSA 3AJZA 4XMAA 3WW4A 2PQQA 1UMIA 2ZEWA 3RG0A 3QD6A 4EN9B 2G1MA 5A3WA 4B4QA 3AYAA 1FNYA 1QJU2 1R082 3NQHA 4GMP0 2VMGA 2WABA 4PBOA 4M4RA 2J42A 4ZXKA 3SQOA 4FTEA 1AYN1 2J1RA 2XLAA 4YW3A 4CDQA 4XIOA 5I8TA 2P4EA 4YM0A 1AYN3 2XJUA 4M3CF 1JZ4A 3I2OA 4XJAA 1A3KA 2JG9A 2ZKNA 1W6MB 4Q2FA 3VHRA 1QU0A 4B1MA 4GJZA 1NE4A 2XBO3 1EPZA 4GMP3 4H2AA 1JODA 3WDXA 2QDRA 1QJY1 3K4AA 3V0AB 2A1XA 1F5JA 5H9QA 3EXUA 3MIGA 4PJYA 5SV5A 4RFRB 5FZEA 5FZIA 1H0BA 3TN91 3ATGA 2PA7A 4N43A 3LE0A 1GZ9A 4IEOA 2Q8CA 4LIVA 5DG1A 5FZMA 1SLIA 1IQDC 2RVAA 2D7FA 3VBOB 4E8CA 3RMYA 5FO8B 2HLEA 4HSJA 2OPWA 2BQPA 4E4DX 4AEDB 1ACCA 3NAPA 3W5NA 2E63A 2W68A 2I2SA 3RJRA 4C1XA 1MEC2 1LU1A 5A32A 1QH6A 3FMGA 3MEPA 2GC3A 4WM7C 3ST7A 4FI9A 1GLHA 4GB31 1FI2A 3TWIA 5FZDA 3OUIA 3PVNA 4YVWA 3KT1A 3DEMA 2E51A 5AC93 1O91A 3H50A 3OGVA 4FO9A 4IV3B 4KGGA 3VHPA 3WDYA 2WFF3 2W94A 1B35C 4O9GA 5ERLA 1K3IA 2V5YA 2JB8A 2WNUC 1LJ7A 1NAEA 2W1QA 4Q4X1 3KCYA 4OHVA 4QXKA 3F95A 3AFGA 1DGWA 4FPCA 1VBE2 2GNTA 4J1WA 3POIA 3TOJA 4CEWC 2H0VA 4JHZA 1OOPA 3T2QA 3WF2A 4P02B 2YXSA 5EIYB 1VBE3 5E88A 5FYTA 4A44A 4CRQA 1OMIA 2YFUA 4BHPA 1AR93 1WCSA 2GALA 3PDQA 4AFMA 4JGZC 1RUF2 4DIQA 3VBHA 3WF1A 5JOZA 3BCWA 3HIFA 4XCAA 3S0MA 2B5HA 3WG2A 1FATA 3ZFFB 3KWVA 4MGSA 1NCRA 2AC1A 2DVBA 3BB6A 1QJU1 3PTYA 3C7OA 1OPOA 5J37A 1IG0A 1W6OA 2IC1A 1B09A 1GMMA 1H8TA 1TMF3 2W52A 2XGXA 3DV8A 3LDKA 4S2DA 5EYYA 4ZXEA 5DXDA 5LY2A 1BEV3 4YFZA 2FZ2A 4B7KA 4CP0A 1H2NA 4BDVB 1CJDA 2PYTA 1CPMA 2Z42A 3IPVB 4BZ4A 1KEXA 2Z2SB 3LIGA 4MXWA 3AKQA 3CHXA 1ENXA 3H1WA 2Z69A 1RMU1 1QNWA 4EN0A 3R4UA 2IZWA 1VBA2 5KHHA 4DMIA 2WFF1 4M3CA 1KITA 4BQ5A 2BU9A 4N7IA 4X8PA 1GOFA 1JZ7A 2EALA 4G9SB 4YW5A 5A6XA 4HN0A 1AF9A 4IEQA 4MVTA 1LNSA 2ADDA 4Q0VA 5C4WA 5CKNA 4TTGA 5E8AA 2WO7A 2E7AA 1BKZA 4D0QA 2Q8OA 5FUIA 1HRI2 5IJRA 3WQ0A 4N43B 2HBUA 3BGAA 2XBO2 1CX4A 3LWCA 3ROUA 1F4AA 1AUYA 4HKLA 1R64A 4LITA 1VRH2 3LF7A 4XBNA 3WDUA 3QACA 1QQP2 2VNGA 5D21A 5GLTA 5C9AB 3R6SA 1DFQA 1MZFA 1O5LA 1SFPA 4QKDA 3FX3A 4I0AA 4W6YA 3ZFGA 1STMA 3NMBA 5JMOA 4Y1ZA 4R4XA 4YSFA 3E6DA 1W3VA 1F4HA 3HNYM 4Y4RA 5FZKA 1NT0A 3ZKYA 2ORZA 4CDUB 1S0IA 5A1AA 1J83A 2K46A 3WR0A 3DGTA 3NO8A 5T5PA 4KNCA 4QX1A 1L3JA 4QX8A 5DDJ1 1R093 2B9VA 4NR1A 3BTAA 5ANQA 4PDWC 4K9SA 1ULGA 1O3SA 4P08A 2P3YA 3WG4A 2X09A 1VMHA 1W9WA 2WRAA 3OF1A 5T5LA 3RZKA 4EN8B 1FMD1 1RUG1 2PMWB 3AYDA 2P6HA 3FJSA 1SLLA 4CDQB 2V09A 1MS1A 4BQXA 1KFUL 5L9VA 3VZKA 4JCKA 4DFSA 2R7EB 1DGLA 4XF9A 4OHYA 1CAWB 1UY4A 4NIHA 4XUTA 4MH0E 4K1YA 5HV0A 2PHUA 1UOFA 5KC6A 4Q26A 1W6MA 3EQEA 4CDQC 5HPOA 4CUBA 3IAPA 4JX0A 2GNBA 3UYJA 1W8UA 2QVSB 5F37A 4CE8A 1FAYA 5JVVA 2QQLA 4I0WB 1OC1A 2XR4A 1Y9GA 1DHKB 1W9YA 2BFUL 1EUUA 2BDRA 2QQNA 2QQIA 2HEWF 2IXCA 1ZZBA 1RUD1 2RMU2 5LK5A 4G4FA 4HKWA 1WGPA 4K20A 4NN0A 4YGEA 4L2NA 3N35A 2ZBJA 4W65A 4UW4A 3HPNA 4BQ1A 3VBFB 2RM21 1MS8A 3GALA 3KVBA 3RYRA 1V6JA 1UU4A 3T3YA 5JOWA 5F8PA 4IEWA 4L9BA 2P37A 1QDOA 5EZWA 3DN7A 2D5HA 2JD4A 1RTVA 2OW4A 1DQ4A 2BNOA 2CGNA 2BNNA 2R063 4K1ZA 5EPAA 3ZO0B 3GZUC 1UZ0A 2PHFA 4HBNA 1WKYA 2R061 5FBJA 1H8TC 1C8NA 3RQ0A 5DDJ2 2BJSA 1KJRA 4LBMA 4IE4A 2VOVA 1W0NA 1UY2A 3FBMA 1GP6A 2VUAA 4NJ4A 4HL0A 2XB6C 2NQYA 3PUIA 3M3QA 4YW6A 1RUH2 4PLOA 1LULA 1RUI2 1YQCA 4XFAA 2WT0A 4YRDA 2A73B 4NROA 1ZVFA 3POWA 4UOJA 3ZYRA 2CSGA 2RDNA 3ZXLA 5C3RA 3AZWA 1IZ3A 4D69A 3VB9A 4Z92B 2WL1A 2XJVA 4Q4X3 2D43A 4FPLA 1W8NA 1RXFA 4NHYA 4XVHA 3RWKX 1O7FA 3SITA 5FZ0A 1RYYA 1X9PA 5DAPA 1GYKA 1W06A 5IK7A 1PK6C 2ARAA 2A6VA 3LEKA 2JDHA 2ZGPA 3UNPA 4HPKA 3MIDA 2J1TA 1NCRC 1WWYA 4WM7A 2QNKA 2QQOA 5EJ3A 1OT5A 3LIHA 3ZYHA 4HFSA 3Q9OA 4XJZA 2XMLA 5CEHA 3AP7A 5FP9A 3VKMA 2XL9A 1RMU2 5G04L 1WZXA 3NNMA 1LEMA 1I5ZA 2YZ4A 4IEUA 1QMJA 5JI7A 4OI1A 1X7NA 4AVBA 5JLVA 3O1MA 5A7SA 5C5UA 2YC2A 1I3HA 2MPFA 1NZIA 1NA1C 2UWBA 4FPEA 3SNMA 2NZ9A 3RYPA 1HV1A 4LHKA 2Y60A 1JI6A 1VJ2A 3WHUA 1TMF1 1YCIA 3VDCA 4COUA 4DPNA 3KCCA 1XE8A 4ZPIA 1JYTA 2GDFA 3KGLA 4AHZA 1XE7A 4KBBA 1JZ6A 4OLLA 2ZGTA 2BPA2 1NQDA 2VOXA 1R1A2 3JB4C 4SLIA 2JIJA 3VDBA 3UGHA 2J1AA 2W0XA 2Y0OA 2AEZA 4XJ9A 4JDOA 1BMV1 2EVXA 4PQ9A 1A8MA 2Y6GA 3N7KA 2DURA 1QJY3 4FFGA 2XL7A 4XFHA 4CUCA 4CCJA 3BOPA 4W6WA 1GWKA 5EV7A 2WWUA 3ZN4A 1BVP1 1T2XA 3H7YA 2XPJA 4NMIA 1JYIA 1SBFA 1DQ0A 3RZLA 1VBC1 2DCZA 5KXBA 4XPVA 1IQAA 4XHBA 3PUQA 1DDLA 3N9PA 1LGNA 4MXVA 2RS51 3FHIB 4XILA 2W1WA 3PU8A 4OHXA 3B00A 5FRAA 3ZYJB 2DDUA 3MI8A 2PFWA 2JKBA 4XJWA 2G9GA 4ZKTB 5IFPA 4NIDA 2J1EA 2FBEA 4IE0A 2WDBA 1HQLA 2PQSA 1AR71 2PLV2 3JD73 5JIAA 3BKZA 1O3QA 4UWDA 3WNPA 2HWB2 4P9XA 5H9PA 4GB32 1D7PM 3ZX7A 2GSYA 4K8FA 2FDJA 5JR7B 2DU0A 4YZ2A 3VD3A 2VUCA 1H2LA 2XLFA 2LW8A 2X29A 4IDZA 1V6OA 1PO22 3N9NA 1PIV3 4E27A 1S4CA 2OQ6A 5L73A 5ACA3 1B35B 1R091 5C8CB 5IAXA 1G9CA 2YGLA 4OMDA 4AI3A 2VTXJ 1PNGA 4ASLA 2ORXA 4FOWA 3RI8A 2H6BA 5GZEA 1TNFA 4MO3M 1TE1B 1YEWA 3SCFA 2DCTA 2OKXA 1AJKA 3O5SA 4FP3A 2V5DA 4B4RA 4ZZ5A 2WZPP 4OUMA 4Y22B 2EIGA 1J84A 2Y26A 4DQAA 5KC5A 3HN1A 4XDPA 4UF0B 2GP5A 5FMBA 5JSOA 2WA3A 2JDAA 1VE0A 3UV9A 4DOUA 2MNGA 1UYZA 1TEIA 1O4TA 1QH7A 4DY3A 1COV3 3ZYBA 1LHWA 1V9U3 1XYNA 2VGDA 5KXDA 1DGRA 3LEGA 5DN2A 1CZTA 1U5IA 1DYOA 3CZJA 5FKCA 5D8AA 2B4KA 4WVVA 4QDRA 3WF4A 3NW4A 5I93A 1MS0A 2X53S 3FUQA 3OGJA 4QX0A 5GZDA 2Y6KA 3U0ZA 1X36A 5A1LA 3NV3A 3BODA 4XTPA 3CDZB 5A7NA 2QQVA 2JECA 4AVAA 4Q0QA 3VL9A 1NA1B 2VQTA 3LEIA 1AYN2 4HLTA 4B3NA 3MGUA 2VQ0A 3VDDC 4CXYA 1UIJA 3APBA 2ZA9A 1S0CA 4QKFA 4COZA 2B8MA 4BIOA 5FZHA 5CU1A 1UIKA 2ZKLA 4OI2A 2VVEA 4O65A 4DINB 3BOWA 2ENRA 3RSJA 4QAWA 3OPWA 4XABA 1IG3A 3SH4A 1TME3 2P6CA 3OEAA 1RGSA 1OQDA 1J1LA 1W9FA 3O1VA 1N1SA 1XJAA 2WYFA 2GN3A 2Q30A 3NV2A 5ACA1 2FDKA 4QQHA 1C8M1 4KH9A 2RS31 4GD4A 1JYWA 1F5FA 3N7LA 4IV3A 4MGTA 3M3EA 1DU3D 1KS4A 3WDVA 4GH4B 2XLGA 4AFAA 1RITA 4I30A 1ZBE3 1UY3A 4J1XA 4M01A 1LOFC 1NLQA 3PTRB 4WVWA 3AYEA 4AVVA 5I0DA 2UWAA 1UKRA 1UU5A 4OYUA 2JKXA 3IDBB 2HH9A 2RS53 1OLMA 2TEPA 4EN7B 5FOBB 4OZOA 4S2HA 4AHWA 1DQ1A 2J1SA 1YFXA 4BISA 4LBLA 1UYPA 3FUOA 4QPGA 3I54A 4FPGA 1WW6A 4OUEA 1JU4A 1OSGA 2WO1A 3HR9A 4QQPA 4R9CA 1GR3A 5I91A 2RJKA 4WVZA 1XXNA 1JYNA 3C3VA 2EA7A 4LOTA 1TG7A 5BPXA 2GMMA 2HWF2 3T08A 2ZGKA 2YU1A 4N7UA 1EUTA 3CO2A 3AMNA 3ZM8A 1ND2B 1OA4A 2C6SA 3ILRA 4FXGB 4BK4A 1LENA 1PNFA 5A6YA 2DTYA 2WNVA 4I01A 4AI2A 1ALYA 5F3CA 3LSEA 5DUUA 3MFAA 3V56A 1H6YA 4S2GA 2YFZA 4QHZA 3WT3A 4UFLA 3RZHA 4Q4W3 4NHMA 2ZX1A 2QE3A 2OIIA 1IPJA 2RS33 4XF1A 3THCA 5FP3A 1AR62 4N8MA 1DYPA 1QHDA 2V73A 2ZGNA 3ZKUA 3ZMOA 4QHBA 2DFCA 2XJPA 2FMDA 4CP2A 2HWD1 4YW2A 5FY7A 2WSUA 2D3PA 2HJIA 3V65A 5DQ0A 3OBRA 4XUPA 2W3JA 1LHUA 2CU5A 2C9KA 2HWD3 2XKPA 4LORA 1U0AA 1FX5A 3BIWE 5DAVA 2NMOA 1G7YA 3LSDA 3W59A 1JOJA 4CTEA 1PMHX 2VVFA 5J48A 5F5IA 5F5QA 1IOAA 4RD7A 1S0FA 1VBD2 1MVEA 2BOIA 1IS5A 3N36A 4RQPC 3C2UA 3VZNA 3VBSC 1V0AA 1Z7S1 1UU6A 2HWB1 4JQRA 1XQNA 3D4KA 1HRV1 4IEVA 4BQ3A 4IGPA 5C33A 3NWKA 4Z2AA 3WDTA 5A1FA 2ZHKA 3H8UA 3NV4A 4XOGA 5FPUA 5DUVA 2ES3A 3MF9A 3TB0A 1JHNA 1S0BA 1G9FA 2FCVA 2D6PA 4A3ZA 3VD4A 3ACHA 3MIFA 4UBGA 3TBDA 1ENRA 2YUEA 1N1YA 5FAXA 4GWMA 1E5SA 3H7JA 4XE9A 2YB7A 3ENRA 3USUB 5CFDA 3ZN6B 4BIFA 1HB1A 1PMJX 2Y34A 1OD5A 3BTXA 4FFFA 3KGZA 3IKWA 2PHLA 5GLWA 1I9RA 1MS5A 3SXWA 1VBD3 3POYA 3U14A 1UN1A 2GNMA 5JPMB 1CAUA 4XQWA 1YC61 2FZ1A 5E89A 4OHWA 5IAVA 4Z82A 3GZAA 1LR5A 3HQUA 2O8OA 3OEBA 2I74A 4NRMA 1REEA 4S2FA 1WBLA 3KCXA 4D3WA 5DUXA 3WQ1A 1AR63 3E5XA 1ULPA 3BYWA 1S2KA 2W87A 3NKGA 3NKTA 4QKBA 4BU2A 5I8YA 4BQYA 1F35A 1NCQC 3ON7A 2PLV3 3JD72 4NWVA 3OGRA 1RL3A 3SEPA 3M1HA 1WW4A 5F9TA 5A3OA 1OPMA 2EXKA 5LBFA 3OTFA 4RGKA 1MACA 4QPIB 1AL23 2LUWA 2VBBA 2H0BA 4CXWA 3ZN6A 5CFDB 2ZGUA 4MOAA 1GQPA 3VD7A 2VOTA 3ZLIA 4B1LA 1SCRA 1RXGA 4QGLA 3NL1A 5IVFA 4M3CE 4LO6B 3EHKA 3WW2A 5C3SA 4MGZE 4RS5A 4AOCA 3IIIA 5F1RA 5JSRA 2C4XA 2CWSA 1W6PB 3V0BB 2DBIA 2V4VA 3O7OA 3IMMA 3ZFFA 4IQPA 4BLIA 3H8RA 3ZR5A 4C0HA 1NX9A 1S0DA 5FUPA 4C8DA 1HDKA 4NRQA 2DUPA 1J3RA 3WUDA 1K5MA 4IV1C 2JWPA 5BUVA 3GM8A 4EZ4A 5JCTA 4ONUA 2PAEA 4JTNA 5LEKA 5JXJA 4HZFA 2CAUA 3VD9A 4YVSB 3IAQA 4BXFA 4I02A 1XPWA 1Y4WA 3RJ2X 5JXGA 1RUH1 2Q4SA 2XJRA 2BP6A 5FY0A 5CG8A 3QCWA 1L7RA 2E7TA 2XKOA 3AMQA 4XDOA 4A6SA 4UI9L 5FYBA 1PZ9A 3HJRA 1CAXB 2VVDA 4LIUA 1GFF2 4CU8A 1C28A 2W46A 4JHTA 4LMFA 5JAXA 5HCHA 5L7OC 1LECA 1IKQA 1OVPA 2R041 3AKSA 1W2TA 1W2UA 2Y6JA 2HWC3 4Q4V2 5I0RA 2B39A 1RVF2 5FYMA 4QX2A 4YGBA 1YXWA 2CHHA 2VD7A 1V6NA 4GJYA 2ZHNA 5GZFA 4FSJA 3O12A 4XIKA 2VZTA 1ZZ9A 3AXDA 3MHZA 5FV3A 4JKMA 5FPAA 1APNA 3O1RA 1Y43B 3K48A 3E6BA 3WP5A 1RUD3 1FV2A 2SLIA 4YVSC 1HN1A 2DU1A 3SH5A 3LKJA 4UFIA 4CCOA 1UF2C 5FKBA 4A41A 3I2DA 5CKQA 5ABJA 4GULA 3AM2A 2OUHA 5JXIA 4F83A 3VV1A 3LFIA 1AHSA 1WMXA 2X5IB 1O3RA 5K8SA 1W28A 1COV2 1RUI3 3VBUA 3MO4A 3I2IA 2PXJA 4QD2A 2RS12 1XRUA 2P3IA 1DZQA 2D6KA 2JDMA 4Q0PA 5LASA 1F15A 3OB8A 1C8M3 3DECA 1FMD2 1RUG2 4NIIA 1DQ6A 2E53A 3RI9A 1UOGA 4IXLA 1HW5A 4GKYA 5K0UC 3K51A 4NUBA 2YHJA 3WXPA 2NM1A 2Y8KA 4JTOA 2VZ1A 1GOHA 1OLRA 2VCMA 1AYM3 1PIV2 3MLJA 4EWDA 2X8KA 2ZJCA 1JYCA 2B7YA 3VBRA 3WEZA 5A6ZA 1GWMA 4URAA 2W95A 4R9BA 4GQ7A 3MV01 3N7JA 3C7FA 5ANNA 4EWEA 2VZVA 4HVOA 2MEV3 3TYJA 4L97A 4Y24A 5LEJA 3MFCA 5EFUA 3UKNA 2E7QA 3ZXKA 1Q8SA 4QPGB 2W1SA 1QJEA 2VZPA 4CSWA 5J09A 3VBOA 2NLRA 3T30A 3J8F3 5K7PA 3FE5A 3PUSA 1D4M1 2GNDA 1X33A 3H42B 4P5HA 1XU1A 1QF3A 2XQRA 3Q8EA 1JMUB 2A5ZA 3GGLA 3R4SA 4RHV1 3HT2A 4UFJA 2FDHA 1D4M3 3LA2A 1ASJ3 4C1WA 2A3YA 1CAUB 1URXA 2TNFA 3CEWA 1XSRA 2VQAA 3OOXA 4J25A 4XQ4A 3O1OA 1UMHA 3GBWA 2VOWA 5EXOA 5F2WA 4CEWB 2IXKA 2WQZC 4IW3A 4F3JA 1PVC2 3KM5A 3VZOA 5LA0A 5C9AC 1O5UA 4JGYC 4KG0A 2OQ7A 3EYPA 1AR83 1ND2A 3N9OA 3USSA 4AVCA 2WNUB 4OI0A 3ZSMA 1PK6A 4IUGA 1R092 2PHWA 2QZ2A 1IGOA 1X82A 1I1EA 1UX6A 1BK1A 3ES1A 4GXLA 1YFYA 5CFCC 1W6OB 1UOBA 1BEV1 3QH7A 2EIBA 3SKJE 3ZSJA 5JZGA 2XOMA 2BBVA 2O14A 4LKSA 5FP4A 3KF3A 5FZCA 1XYPA 1G8WA 2GZWA 3VBSB 1MZEA 1YNAA 1KQRA 1UMZA 1WD4A 3H9AA 1RUC3 2B9UA 4QU2A 2JG9B 4N53C 1XNDA 4LQRA 3D3AA 3O0VA 4COWA 5IUQA 2WNEA 3AVRA 5FK7A 2W92A 1AXYA 2KD7A 2Y6HA 3D0JA 1QQP3 4HVRA 1JH5A 1LEDA 2GC0A 2EXIA 3WW3A 4XCBA 2QQJA 4XZPA 1VBC3 5A3PA 3B5LB 3D6EA 3G6JB 2P3KA 2CDOA 4MADA 1XU2A 2OS2A 1YYNA 3I2JA 5JPNB 1X8EA 2UU8A 2XVLA 2D3SA 4CUAA 4EWAA 4PDWA 3MPBA 1UXZA 4LA3A 4XBLA 3J7MA 1AJOA 1W8OA 2Z79A 3CNAA 4W4ZA 3GJBA 4RHV3 3VHNA 3ZXDA 3BTZA 3MIBA 3KZ4C 4JKLA 5FLHA 5IWFA 5CAZA 4AQ2A 4AYUA 4Q4X2 1VBA3 2QQUA 1SMVA 4B8EA 3FHAA 4OHZA 3ACIA 4JGZB 1VBB3 4QB1A 4META 4NOTA 5A80A 4ES9A 5JR2A 1NUKA 4MGKE 2XJQA 4XFIA 1WLDA 1RUC2 4AI1A 1JXNA 2VZSA 4R4ZA 4BOWA 4XURA 2ZGQA 3CBNA 4FBFA 2XVGA 5LA2A 3BTYA 3GCXA 3A0NA 2VECA 2VU9A 4CCKA 4EN6B 3O0XA 4QM9A 4COYA 1ENQA 4FPKA 5DZEA 5FOJB 1BEV2 1QJZA 3HNMA 3KS7A 2LM3A 3AMHA 3GNEA 5FZ8A 1AZDA 3EMRA 5GLUA 3ZYGA 1AR82 3OYWA 4OULA 4UF0A 2F6BA 4X8NA 3Q8FA 4ATEA 4CEYB 2FDGA 1PVC3 2EIEA 3HNBM 3WQ7A 5F39A 4BMBA 1RUF3 5AFEA 1VB4A 1XNAA 4ISQA 3KB5A 5I0UA 4YFWA
chains in the Genus database with same CATH topology
3UYJA 4CCJA 5F37A 4BISA 5A3TA 2YBPA 5IVVA 5ISLA 2WWUA 4HOOA 4QXCA 2XXZA 3ZLIA 2YPDA 5KR7A 1VRBA 5F5CA 5F5AA 3PUQA 4CCMA 3KV6A 3N9PA 5IVFA 5IVBA 4CSWA 5FYTA 3PU8A 5F32A 4Y3OA 3PUSA 3PDQA 2YU1A 4DIQA 5A7SA 5IW0A 2W2IA 5FJKA 2XUEA 5A7WB 5FZGA 5FUPA 4C8DA 2OT7A 3KVBA 4QXBA 5FYIA 4CCNA 5F3CA 5FZ9A 5F2WA 5FY1A 5LY2A 4CCLA 4EZ4A 3LDBA 4DO0A 5FXZA 3N9NA 5FWJA 2OQ6A 5F3EA 5FBJA 5FYCA 2Q8DA 5FYHA 2OQ7A 3N9OA 5FP3A 5FPVA 5FYZA 5FZ3A 5A7WA 4BXFA 2XDVA 5FZOB 3PU3A 5FZ1A 3ZPOA 3KV9A 4LXLA 3K2OA 5FY0A 5A7QA 2YBKA 5FXVA 2YU2A 5FY7A 4XDOA 4CUGA 3N9MA 4AAPA 5FPLA 5FP4A 5FYBA 5FZCA 4LIUA 5FP8A 5FZFA 5A3WA 4XDPA 4UF0B 3K3NA 2GP5A 3OPTA 5IVYA 5FWEA 4IGQA 5F5IA 2OX0A 5FY5A 3U78A 5A7OA 3AVRA 3KVAA 2GP3A 5K4LA 5FYMA 5F3IA 5FZOA 3KV5A 2VD7A 4IGPA 2P5BA 5FUNA 5FZ4A 4GJYA 3RVHA 4GJZA 5A1FA 5FZ0A 5A3PA 3DXTA 3DXUA 4LITA 4GAZA 5F3GA 5FPUA 4EYUA 5FV3A 3KV4A 5A1LA 2OS2A 3AL6A 5F2SA 5FPAA 5A7NA 4QU1A 5FPBA 5FY4A 5FYVA 5FYUA 4EZHA 5LWBA 5A7PA 4CCOA 4D6RA 4Y33A 4E4HA 5FZEA 5FZIA 3NJYA 5A3NA 5IWFA 3U4SA 3K3OA 5CEHA 2XMLA 5FZHA 5IVJA 3PUAA 3N9QA 5FP9A 5FY8A 5FJHA 5IVEA 3N9LA 4V2WA 3OPWA 4Y4RA 5FZKA 2Q8CA 4LIVA 4HONA 5FZMA 4D6QA 5A80A 5FZ6A 5FP7A 2PXJA 5FY9A 4QX8A 5IVCA 4QXHA 4GD4A 5FYSA 5ANQA 4ASKA 3LD8A 4CCKA 2YBSA 2Q8EA 5FZAA 3AL5A 3PURA 4QX7A 5LW9A 3PTRB 4NUBA 5FZDA 5FZBA 5FZ8A 2WWJA 5FZLA 4QWNA 4V2VA 4UF0A 5FXXA 3AVSA 5E6HA 4BU2A 5LY1A 4D6SA 4AI9A 5F39A 5FXWA 5FZ7A 4URAA 4TN7A 4IGOA 5FYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UYJ A;  4CCJ A;  5F37 A;  4BIS A;  5A3T A;  2YBP A;  5IVV A;  5ISL A;  2WWU A;  4HOO A;  4QXC A;  2XXZ A;  3ZLI A;  2YPD A;  5KR7 A;  1VRB A;  5F5C A;  5F5A A;  3PUQ A;  4CCM A;  3KV6 A;  3N9P A;  5IVF A;  5IVB A;  4CSW A;  5FYT A;  3PU8 A;  5F32 A;  4Y3O A;  3PUS A;  3PDQ A;  2YU1 A;  4DIQ A;  5A7S A;  5IW0 A;  2W2I A;  5FJK A;  2XUE A;  5A7W B;  5FZG A;  5FUP A;  4C8D A;  2OT7 A;  3KVB A;  4QXB A;  5FYI A;  4CCN A;  5F3C A;  5FZ9 A;  5F2W A;  5FY1 A;  5LY2 A;  4CCL A;  4EZ4 A;  3LDB A;  4DO0 A;  5FXZ A;  3N9N A;  5FWJ A;  2OQ6 A;  5F3E A;  5FBJ A;  5FYC A;  2Q8D A;  5FYH A;  2OQ7 A;  3N9O A;  5FP3 A;  5FPV A;  5FYZ A;  5FZ3 A;  5A7W A;  4BXF A;  2XDV A;  5FZO B;  3PU3 A;  5FZ1 A;  3ZPO A;  3KV9 A;  4LXL A;  3K2O A;  5FY0 A;  5A7Q A;  2YBK A;  5FXV A;  2YU2 A;  5FY7 A;  4XDO A;  4CUG A;  3N9M A;  4AAP A;  5FPL A;  5FP4 A;  5FYB A;  5FZC A;  4LIU A;  5FP8 A;  5FZF A;  5A3W A;  4XDP A;  4UF0 B;  3K3N A;  2GP5 A;  3OPT A;  5IVY A;  5FWE A;  4IGQ A;  5F5I A;  2OX0 A;  5FY5 A;  3U78 A;  5A7O A;  3AVR A;  3KVA A;  2GP3 A;  5K4L A;  5FYM A;  5F3I A;  5FZO A;  3KV5 A;  2VD7 A;  4IGP A;  2P5B A;  5FUN A;  5FZ4 A;  4GJY A;  3RVH A;  4GJZ A;  5A1F A;  5FZ0 A;  5A3P A;  3DXT A;  3DXU A;  4LIT A;  4GAZ A;  5F3G A;  5FPU A;  4EYU A;  5FV3 A;  3KV4 A;  5A1L A;  2OS2 A;  3AL6 A;  5F2S A;  5FPA A;  5A7N A;  4QU1 A;  5FPB A;  5FY4 A;  5FYV A;  5FYU A;  4EZH A;  5LWB A;  5A7P A;  4CCO A;  4D6R A;  4Y33 A;  4E4H A;  5FZE A;  5FZI A;  3NJY A;  5A3N A;  5IWF A;  3U4S A;  3K3O A;  5CEH A;  2XML A;  5FZH A;  5IVJ A;  3PUA A;  3N9Q A;  5FP9 A;  5FY8 A;  5FJH A;  5IVE A;  3N9L A;  4V2W A;  3OPW A;  4Y4R A;  5FZK A;  2Q8C A;  4LIV A;  4HON A;  5FZM A;  4D6Q A;  5A80 A;  5FZ6 A;  5FP7 A;  2PXJ A;  5FY9 A;  4QX8 A;  5IVC A;  4QXH A;  4GD4 A;  5FYS A;  5ANQ A;  4ASK A;  3LD8 A;  4CCK A;  2YBS A;  2Q8E A;  5FZA A;  3AL5 A;  3PUR A;  4QX7 A;  5LW9 A;  3PTR B;  4NUB A;  5FZD A;  5FZB A;  5FZ8 A;  2WWJ A;  5FZL A;  4QWN A;  4V2V A;  4UF0 A;  5FXX A;  3AVS A;  5E6H A;  4BU2 A;  5LY1 A;  4D6S A;  4AI9 A;  5F39 A;  5FXW A;  5FZ7 A;  4URA A;  4TN7 A;  4IGO A;  5FYY A; 
#chains in the Genus database with same CATH topology
 1UCX A;  5IK8 A;  3T2P A;  3W58 A;  2DCY A;  1L7L A;  1D0G A;  2YBP A;  3V0A A;  3B01 A;  4Q8K A;  1UL9 A;  1KDM A;  4KU8 A;  4LE4 A;  4XFG A;  4LT5 A;  2K0G A;  2RV9 A;  1ENS A;  1PHM A;  2A6Z A;  2VUL A;  4FTB A;  2LAL A;  1W8H A;  2JIC A;  4QB2 A;  4I3G A;  5BNP C;  3GZE A;  3BVC A;  4FTS A;  4LKD A;  3WF3 A;  1RIR A;  3EBR A;  5JZG C;  4JKK A;  3M7A A;  2JDP A;  3AZZ A;  4O9E A;  2J22 A;  5T5J A;  2BW8 A;  3GXU A;  1GAN A;  1H1A A;  2RG4 A;  2OA2 A;  5FMO S;  2MEV 2;  2Z5W A;  1IPK A;  1N1V A;  2D5F A;  3PNA A;  2VUD A;  4TWT A;  4YYO A;  4V1P A;  1UZV A;  4AGR A;  5C4W B;  4M0N A;  3ES4 A;  3A0K A;  4Y1V A;  1SLA A;  5LBE A;  3VGI A;  3VBF C;  3ASI A;  2V4A A;  3DL3 A;  3ZFG C;  1R08 1;  4FOQ A;  3UKT A;  4YG0 A;  5FYC A;  3E5U A;  3AKP A;  4L0P A;  3SCH A;  2R1B A;  1QWR A;  1LAJ A;  1ZZ8 A;  3LGR A;  1BCX A;  4KI5 M;  2JX9 A;  2VZQ A;  4LXL A;  4TSV A;  2UYA A;  3CL1 A;  3DCQ A;  4XMI A;  4LKF A;  3KSC A;  4XHX A;  2IUW A;  3PJY A;  2E31 A;  3GCW A;  2YU2 A;  1FMD 3;  1RUG 3;  4N9I A;  4IL7 A;  1IS6 A;  1GZW A;  1MS9 A;  5HV4 A;  2Q1F A;  5FZF A;  2RDR A;  5C4W C;  3JBG 3;  4AEK A;  2ZHL A;  1QDC A;  2JDK A;  4QPY A;  4LR4 A;  1D2Q A;  1OLM E;  2VAU A;  4AQ6 A;  1S2E A;  2RHP A;  5A3M A;  1SFY A;  2WO2 A;  2RJ2 A;  4LBN A;  4QQ2 A;  4YGC A;  4YVW C;  1SDW A;  4D8M A;  1NKG A;  3AP4 A;  4HET A;  1VMJ A;  2A3W A;  3GDB A;  3ZPY A;  4CDW C;  5DAX A;  3DXT A;  2BV4 A;  4CPB D;  1ZRR A;  5C8W A;  5I8S A;  1K5J A;  2D6N A;  3KV4 A;  1PZ8 A;  4QQL A;  4AFB A;  3LFM A;  4QM8 A;  4ZZ8 A;  2Y64 A;  4ET7 A;  1U5X A;  3INA A;  4QQO A;  3W21 A;  4LBO A;  3WCS A;  1GIC A;  2NP0 A;  5A33 A;  1W8T A;  1R08 3;  1PMI A;  2GH8 A;  4XAE A;  1RVF 3;  1GNZ A;  3J8F 1;  4NIG A;  3C7G A;  2HWC 2;  3JB8 A;  4QPI A;  5FQ0 B;  4HON A;  4GH4 A;  2HWE 3;  1EV1 3;  3A23 A;  3EO6 A;  4JGZ A;  1POV 0;  1OI6 A;  3K4D A;  2VMC A;  4Q4V 1;  4RGG A;  4CCD A;  5J1X A;  4PIY A;  1AR6 1;  3CIH A;  1ZA4 A;  2RE9 A;  5A3L A;  1PGL 2;  3J4U H;  5M0T A;  4AED A;  3LOB A;  3WX5 A;  1PX4 A;  3NNF A;  5B2G B;  2PTM A;  1OOP C;  2UY9 A;  3D0S A;  1CON A;  4Q27 A;  1WLC A;  2GU9 A;  2FD8 A;  4XDQ A;  3T2O A;  1N1T A;  2PAK A;  5CVR A;  5CAD A;  1Y3T A;  4OZX A;  3SKV A;  4AHY A;  1AYM 1;  4TYS A;  5FZL A;  1XSQ A;  3C8X A;  3SC7 X;  1FYU A;  1S0G A;  4FT8 A;  1WLW A;  2WNU A;  4CXX A;  3NNL A;  1B35 A;  4AL9 A;  4LKE A;  4LNV A;  1Y9M A;  5FXW A;  2G9F A;  4UYB A;  4MG2 A;  4LHL A;  2P3J A;  1SPP A;  4K21 A;  2BBA A;  2GN7 A;  3J8F 2;  3WZ1 A;  1W0O A;  2RR1 2;  3J7L A;  2VC9 A;  4AF9 A;  3A22 A;  5K9Y A;  1AR7 3;  1GBG A;  1JU3 A;  3IM0 A;  5KR7 A;  4PI0 A;  2FQP A;  4UW6 A;  4AE2 A;  1W3X A;  2BOJ A;  2B45 X;  5CBL A;  1OUX A;  2YRO A;  4Q4Y 1;  3UL2 A;  2VTX A;  3AC0 A;  3JCI A;  4YG3 A;  1WD3 A;  1Q5O A;  3AMM A;  3ZVX A;  2ATF A;  4XUO A;  3TAY A;  3B02 A;  1HQW A;  2QUO A;  5BY5 A;  2KXL A;  3U07 A;  4YVS A;  3VN4 A;  5IT6 A;  1AL2 2;  3HOB A;  4UAP A;  3BI3 A;  1RUE 2;  3HT1 A;  3ZIX A;  2F17 A;  2OUJ A;  4HKO A;  4PDW B;  3AK0 A;  4ZU4 A;  2VW0 A;  5CIR A;  3P6B A;  4AFD A;  5LRS A;  5FO7 B;  1UOJ A;  1NYW A;  1YQ8 A;  2JG8 B;  5FXZ A;  3ZMN A;  4ARY A;  5F3E A;  5LBB A;  1C8M 2;  4NPL A;  1NCR B;  1W9T A;  5SV8 A;  3U78 A;  5AC9 2;  1PVX A;  3OY8 A;  2ZGO A;  4CDU C;  2VZR A;  4RFT 0;  3AFK A;  5FZO B;  3I3D A;  2JDY A;  2P17 A;  2YDE A;  3KT4 A;  1OBN A;  3U10 A;  3J7N A;  1OH3 A;  4JV4 A;  5FMC A;  4DXR A;  4CDX C;  4Z8B A;  1J59 A;  2ZAC A;  2ARE A;  1OKQ A;  1YIF A;  5B4X A;  4AAP A;  3DKW A;  3PVB B;  1M4W A;  3MIE A;  2W9X A;  4CCC A;  1PO1 3;  5ABJ B;  4QGM A;  4HXC A;  3VZJ A;  1JBC A;  1ULF A;  4E2Q A;  4F8A A;  5KWR A;  2A6X A;  1RUF 1;  1VBB 2;  4D7T A;  3I2K A;  1H4G A;  1ULO A;  1ZYB A;  3IN9 A;  3DPR C;  1K5M B;  1WCD J;  2WC2 A;  4BB3 A;  1O6U A;  5GM0 A;  4E8D A;  1H30 A;  5JOY A;  5BNP B;  3TNP B;  2EXH A;  5DAW A;  4C0B A;  1Y7B A;  3KQ4 B;  4M00 A;  5C3O A;  2OZ6 A;  1WMF A;  2HEY F;  2R16 A;  2VNO A;  3WVJ A;  5JDB A;  1ZA7 A;  1AXZ A;  4G3Y C;  4YM3 A;  1K5M C;  1VBE 1;  2VXR A;  5FPB A;  2AAC A;  5C8C C;  2X5I A;  3AZY A;  4Q4V 3;  5C9A A;  4YAR A;  3U4X A;  4OVE A;  4Y33 A;  3MLL A;  3TEY A;  2BWA A;  3T0B A;  5FPX A;  1VLN A;  3PIJ A;  4KWU A;  1J58 A;  1F2N A;  3B94 A;  1HV0 A;  1OHF A;  2ADE A;  2IXI A;  2DTW A;  4LE3 A;  5IVE A;  3H8O A;  1PGW 1;  4WM8 A;  2VXJ A;  3X29 B;  4YW4 A;  4DEQ A;  1Z7S 2;  5BNO A;  3WD5 A;  5FFO C;  2G4I A;  4LTA A;  2JJ6 A;  4QXH A;  4GAL A;  3TEW A;  4XEZ A;  4LUM A;  3SMH A;  5DAB A;  1PM4 A;  3ZSK A;  1RHI 3;  3LA7 A;  4LK6 A;  3B9I A;  1YLL A;  2WO3 A;  1SBE A;  2QQM A;  2YBS A;  2OZJ A;  3RRD A;  3ETQ A;  1K45 A;  2WLP A;  1RJ7 A;  1PGW 2;  4V2V A;  3HBZ A;  2DWR A;  2PLV 1;  3S5Q A;  3LPF A;  2E9Q A;  2WIN B;  3AYC A;  4R8H A;  4WBB A;  4ZON A;  1OH4 A;  1RC6 A;  2NMN A;  4YNI A;  4RS5 B;  2B46 X;  4K40 A;  4XW3 A;  4IND A;  4AEM A;  1GUI A;  1XYO A;  4C91 A;  1QJX 3;  3CKH A;  1JZ5 A;  5L36 A;  5HXV A;  4Y26 A;  1UD1 A;  2D3R A;  1K42 A;  5F5C A;  2HWF 3;  1O4Y A;  1C5H A;  2W5F A;  3RZZ A;  3WP6 A;  2JG8 A;  1IPS A;  4DNY A;  4LBQ D;  1FOD 1;  2R0F A;  3L2Y A;  1NCQ B;  3ZSL A;  1BMV 2;  4Q4W 1;  4QX5 A;  3VKN A;  4MXW B;  1TNR A;  2WKK A;  2WT1 A;  3I4I A;  2VM9 A;  5KHK A;  1S1A A;  3U1X A;  3M8L A;  4CCN A;  3DUI A;  4HMZ A;  1QXR A;  4EQV A;  2NN8 A;  4CCL A;  2WN2 A;  5FDB A;  4UT5 A;  1HXS 3;  3C7H A;  1RB8 G;  4LO5 B;  4YZ4 A;  1U5Y A;  2D97 A;  4MGI E;  4QMA A;  2VMD A;  4WV8 A;  1YHF A;  4P00 B;  1EAH 1;  1RHI 2;  5FYZ A;  4FAH A;  4XZU G;  1OLQ A;  3ZFE B;  3PVE A;  3PU3 A;  4JC1 A;  3KV9 A;  3OGG A;  2ZZQ A;  3JXS A;  2ZX3 A;  4RSU A;  1Z7S 3;  4PLN A;  2XQX A;  5LK7 B;  2PHD A;  3AZV A;  1W99 A;  1VAK A;  4ERO A;  3N9M A;  4QT6 A;  1WCK A;  1KDK A;  2ZEX A;  1QJX 1;  1WW5 A;  1GOG A;  4CA9 A;  1PVC 1;  1QNY A;  1W2N A;  3JU9 A;  4TLG A;  1U5Z A;  5L7O A;  5FWE A;  3AXE A;  1UZW A;  1FPN 3;  4OCT A;  4QPG C;  1BK0 A;  4DRR A;  5A7O A;  2GP3 A;  2LRO A;  4RR3 B;  3B93 A;  2R07 1;  2JDZ A;  3I3B A;  3H8X A;  1RUJ 3;  5EJZ B;  4YPJ A;  1PO1 1;  3LA3 A;  4N90 A;  4NHK A;  4DXZ A;  2JE7 A;  1LHV A;  3CQO A;  3POJ A;  1X50 A;  1H8T B;  4WZF A;  1AR9 1;  3WUC A;  4BQ2 A;  4NHX A;  5HCA A;  3RFR A;  3AB0 A;  5CZK A;  4E4H A;  3GHN A;  2WZE A;  1H8V A;  3KLS A;  3IDA A;  1Q8O A;  3LB9 A;  3W20 A;  5CIS A;  2PEL A;  1OVS A;  2IFR A;  3J9S A;  5FY8 A;  5IHR A;  1RUI 1;  1E5I A;  2ZPX A;  3ACF A;  1W6P A;  1CQ9 A;  3J26 N;  2BTV C;  4RGA A;  1V9U 2;  3THT A;  4O61 A;  4P5Y A;  3T4V A;  1DZT A;  2N7G A;  5T5O A;  1UY0 A;  1OA3 A;  2AR6 A;  4NWW A;  4XBQ A;  2ET1 A;  2HWE 1;  2IVI B;  3EJK A;  4W6X A;  3WQB A;  5CFC A;  5L7O B;  1HQN A;  2X5I C;  1SEF A;  2VOK A;  2QCS B;  4ASK A;  3LPG A;  3W5M A;  5BNN C;  1JUH A;  4M4P A;  3JQW A;  3WHT A;  3MIC A;  3ALQ A;  5FMO L;  5GLV A;  2ZCW A;  4HVQ A;  3JUU A;  3CU7 A;  1G9D A;  1JTZ X;  1QOT A;  1V00 A;  3AL5 A;  1IS4 A;  4KG8 A;  5LW9 A;  4HN1 A;  2R04 3;  3VLB B;  3OBT A;  5LZ6 A;  1DCS A;  4FP2 A;  2K2S A;  1AX1 A;  4XJU A;  4BM8 A;  4DB5 A;  3VKO A;  2K9Z A;  3WNN A;  3A7Q A;  3VBH B;  3VUO A;  1S0E A;  1TZO A;  1GQG A;  4QB6 A;  4DZG A;  1HXS 2;  3B3Q E;  3WNM A;  3MDP A;  5FYY A;  4QX3 A;  1OF3 A;  4IV3 C;  3OCP A;  2HKX A;  5E1R A;  5ISL A;  4Y4Y A;  3MW3 A;  3JZV A;  5IVV A;  4HOO A;  4P9G A;  1VAV A;  3V64 A;  1LOC A;  5G05 L;  3NJX A;  5C70 A;  2YPD A;  3HQR A;  3N7M A;  5F6L B;  5F5A A;  4AVS A;  5TSW A;  1WUV A;  3FLP A;  4UW5 A;  4UXA A;  1AR7 2;  2G9Z A;  3ILN A;  1PZ7 A;  3HMY A;  3POF A;  4ITC A;  5HI0 A;  2VME A;  5F32 A;  4CDU A;  1VR3 A;  3PLQ A;  5F7U A;  1ONA A;  4IE6 A;  1E5R A;  1MS4 A;  3ZXF A;  4HT1 T;  5J3U A;  5FTT C;  4JRA A;  2VTF A;  2RS5 2;  4TZD A;  2XUE A;  1W6N A;  4I3P A;  1Q8P A;  1RVF 1;  1WCQ A;  2BVV A;  3KF5 A;  3B9C A;  5CFD C;  4CPB A;  3RWN A;  1T6G C;  2R04 2;  2ARC A;  4Q29 A;  1DF0 A;  5FY1 A;  4BPZ A;  1ZBE 2;  4KU7 A;  1S55 A;  4MGQ A;  4XFC A;  4K8R B;  3I97 A;  4YZ1 A;  5JUV A;  3MYX A;  1UXX X;  1ND3 B;  5FWJ A;  1CPN A;  5HCB A;  2Q8D A;  2JDN A;  1FXZ A;  1R1A 3;  1BBT 1;  1VPH A;  2BYV E;  3GBG A;  4IV1 B;  4UFK A;  5FO9 B;  1R1A 1;  2OYZ A;  3VL8 A;  4D94 A;  1V9U 1;  2L9L A;  4UFM A;  4KGQ A;  1EV1 2;  3H3Z A;  1A34 A;  3M3I A;  1XOY A;  2C1F A;  1SAC A;  3VKF C;  3IDC B;  1WLT A;  2JG8 C;  3RYK A;  2MEV 1;  3ZXA C;  1GSL A;  1SLT A;  1V6I A;  5GJ6 A;  2VMI A;  2ZX0 A;  3POG A;  4IGQ A;  1BYH A;  1CX1 A;  1YJK A;  4QPW A;  3RPQ A;  1LTE A;  4Y5S A;  1G6N A;  1VRH 1;  2JXA A;  4HK8 A;  2VNR A;  4XXA A;  3U11 A;  3WG3 A;  4FPJ A;  4JZR A;  5FZO A;  5FQ0 A;  5H9S A;  3JBG 1;  1BXH A;  2R07 2;  2LRP A;  2I45 A;  4LBQ B;  4YZ3 A;  3MBW A;  3WW1 A;  1KJL A;  2Y6F A;  2FCT A;  5EHD A;  4CP1 A;  2A70 A;  3IIA A;  4NAO A;  1UYX A;  4Y20 A;  5FY4 A;  2YPJ A;  2ZTN A;  4ES8 A;  2EAA A;  3T09 A;  3S57 A;  4KMQ A;  3OBZ A;  4R52 A;  4BH9 A;  1JZ2 A;  3BIE A;  4CU9 A;  2EIC A;  2P34 A;  1U12 A;  3PME A;  1ASJ 1;  2QQP A;  2ILM A;  3N9Q A;  1SBD A;  3JBG 2;  2BGC A;  3N9L A;  1XNC A;  3S7I A;  1ZNP A;  1NA1 A;  1OUS A;  4XF4 A;  1J3P A;  3HWJ A;  3E6C C;  4D6Q A;  4NHL A;  4H7M A;  5FZ6 A;  4B4P A;  1VP6 A;  1AXK A;  2VMH A;  2O8Q A;  3IBM A;  4LOS A;  3O1S A;  1OQE A;  3ZSE A;  1IS3 A;  1KS5 A;  1XBF A;  3Q8B A;  2Q1Z B;  4OMC A;  3URF A;  4L8Q A;  3WIN E;  4CP9 A;  1GKB A;  4URT A;  1CD3 G;  2DVF A;  1N47 A;  1RUC 1;  4DS0 A;  1SLB A;  4Y20 B;  1SPP B;  2JEN A;  3H1Y A;  4A7Y A;  3WG1 A;  2QFE A;  5JI9 A;  1KXG A;  1IKP A;  5DDJ 3;  2WFP A;  3RMX A;  1ZRC A;  2HWB 3;  5E6H A;  2YYO A;  1CVN A;  4FXK B;  1E5H A;  2QBX A;  1W8Z A;  5GLZ A;  4Q4W 2;  4AI9 A;  3HEI A;  4WZC A;  5JZG B;  2R06 2;  1BZW A;  1W6Q B;  3IB3 A;  5I0T A;  3DPR A;  3S30 A;  1ZBE 1;  3R0R A;  3WNO A;  2YY1 A;  5A3T A;  3ORJ A;  1JZ3 A;  4BQW A;  2XXZ A;  2ZML A;  3QBQ A;  3QH6 A;  4RQP B;  5BNO C;  1XC6 A;  3KV6 A;  3ELN A;  2Q0A A;  2WLQ A;  5C7G A;  5A32 B;  1M06 G;  4H55 A;  3D8C A;  2D93 A;  5LA9 A;  3WSO A;  2GC1 A;  1LOA A;  1LOE A;  3NNG A;  5L9B A;  3VBF A;  5A33 B;  3UGF A;  4DY5 A;  1ZZ7 A;  1WMD A;  4BLJ A;  3CJX A;  4IET A;  4PF1 A;  5BXX A;  4UBH A;  1VIW B;  1ODM A;  2QJV A;  3KQR A;  4BME A;  2DF7 A;  4LBK A;  1IHM A;  2CNA A;  2OPK A;  3AX4 A;  4NIA A;  3UKV A;  2WWS A;  5EWS A;  1HXS 1;  3MLK A;  1US2 A;  3PMS A;  1BJQ A;  4L11 A;  5BNP A;  2XDV A;  2ZS6 B;  5FRE A;  1JYX A;  2IWG B;  3DPR B;  3K75 B;  3ZPO A;  2I07 B;  5H9R A;  5A7Q A;  1DGR N;  1QKQ A;  3FBY A;  4FCA A;  5FXV A;  3I2H A;  4OQ9 A;  4DUV A;  1J3Q A;  1KRI A;  4QDS A;  1RMU 3;  1DYK A;  3LEM A;  3HD8 B;  3ZR6 A;  1F8V A;  2IXH A;  2EAK A;  1I6X A;  3DF0 A;  3OPT A;  4RYD A;  2X05 A;  4AK3 A;  4Z2W A;  2C26 A;  3HBK A;  3PHM A;  2Q5T A;  1T6B X;  3WP4 A;  2HWE 2;  4Q8L A;  4RHV 2;  1TME 2;  1SZB A;  3O0W A;  1C3H A;  5FY5 A;  3WNL A;  3ZYF A;  4AI8 A;  3T2T A;  4Y1X A;  2UUR A;  2WUH A;  2QTW B;  3DYP A;  3KVA A;  1OFS A;  3ECQ A;  3M4F A;  4HPK B;  1CAV B;  5LAT A;  4XF0 A;  1I5P A;  3I3Q A;  1UX7 A;  4AI0 A;  1H1M A;  4EV0 A;  1CJP A;  5HCF A;  5JWP A;  2HWF 1;  2QQK A;  1GU3 A;  3E97 A;  4XF3 A;  5F2S A;  2DUO A;  1TQ5 A;  2ZGL A;  4XUN A;  4AGV A;  2R32 A;  4FQ4 A;  1PX3 A;  5FYV A;  4EZH A;  2Y33 A;  1NXD 1;  1POV 3;  5A70 A;  1G9A A;  2HYX A;  4N53 B;  1MZ5 A;  1VRH 3;  4LHS A;  4U2A A;  4Y5T A;  3RGB A;  4A42 A;  4BYY A;  2ET7 A;  2VL4 A;  1YJL A;  3FWE A;  2CL2 A;  2AEY A;  4OUS A;  4CP9 B;  4E9K A;  4E2G A;  5EJ1 B;  5A3N A;  1HRI 3;  1PO1 2;  1D0H A;  1PIV 1;  1UZZ A;  2XBO 1;  4GMP 1;  4LBJ A;  4AZZ A;  2VG9 A;  2ZX4 A;  2VR4 A;  4AED C;  4JDN A;  5L19 A;  4V2W A;  1PM7 A;  4MYE A;  2W1U A;  4BA6 A;  1QXJ A;  5C5T A;  1E57 A;  3WDW A;  4Y1U A;  4CEY C;  1NLR A;  1X8M A;  4GA9 A;  3IMN A;  5D2A A;  4GH4 C;  2UY8 A;  4NPM A;  4LPL A;  3LDR A;  2P1B A;  4FPH A;  5AC9 1;  2GMP A;  2PHT A;  1VB2 A;  4XQD A;  3H0O A;  4QGN A;  3P3P A;  2VY0 A;  2VCB A;  1HX6 A;  2RS1 1;  1DLL A;  4L92 A;  3CJI C;  1RUE 1;  2X10 A;  2WAO A;  3HVD A;  3I59 B;  3PUR A;  4HK9 A;  3ABZ A;  4NO4 A;  5BNQ A;  3ACG A;  1COV 1;  3A4U A;  5FZB A;  1WA4 A;  1YUD A;  2WWJ A;  1ZRI A;  5B4N A;  4M0H A;  3USU A;  5C71 A;  5DMY A;  4MV2 A;  4E2S A;  3AVS A;  5E16 A;  5ACA 2;  1CAX A;  1QJF A;  2XJT A;  3EB7 A;  1SCS A;  2WR9 A;  3GYD A;  2QKD A;  4N53 A;  5FZ7 A;  1FOD 3;  2WZR 2;  3PL0 A;  4MLO A;  1KD7 A;  2D40 A;  1AX2 A;  3VDD B;  3ZDV A;  2WBK A;  3IDE A;  4L99 A;  1W6Q A;  4XFB A;  1JZ8 A;  2YC4 A;  2ZHM A;  3I2G A;  2DCJ A;  2FHR A;  3FN9 A;  3J7H A;  3NJV A;  1YRZ A;  2R49 A;  3M70 A;  1AX0 A;  3OYW B;  3P1I A;  2RR1 1;  2ZMK A;  4W50 A;  4QPI C;  1PGS A;  2IFW A;  2CYF A;  4AGG A;  4NPR A;  2JD9 A;  2RR1 3;  4IEZ A;  3MIH A;  2GC2 A;  1FOD 2;  2WZR 3;  3F2Z A;  3OUJ A;  4Q5O A;  2A71 A;  4XC9 A;  4ZS3 A;  1ZBA 3;  3WLU A;  4AW7 A;  1LU2 A;  2JIG A;  3POS A;  2PAM A;  1RED A;  5A7W B;  1AYM 2;  5L9R A;  3MUZ 1;  4Y22 A;  4WM7 B;  4FPF A;  3TRS B;  2A7A A;  1W8W A;  3AZX A;  2KM2 A;  4CDW A;  1NZC A;  3BU7 A;  3LQC A;  1EPW A;  2A6W A;  3O14 A;  1OD3 A;  3UK9 A;  4P9W A;  4YGD A;  3ZOI A;  4AQS A;  3OY8 B;  5FYH A;  5C3P A;  1PGL 1;  4MHR A;  2XVK A;  3I8T A;  1DIW A;  3VBO C;  3W9A A;  2WQ4 A;  5DPN A;  2RS1 3;  4HG6 B;  5FR3 A;  2VZ3 A;  4JAA A;  3VBH C;  2TBV A;  4IER A;  1MEC 3;  4CCE A;  4AG4 A;  1GWL A;  2QDN A;  4PBP A;  4PF5 A;  4XUQ A;  3VBR B;  3ZYP A;  3KMH A;  5FPL A;  1MEC 1;  3ZXE A;  4CUG A;  2ZOE B;  1OOP B;  2C5D A;  1GZT A;  1G9B A;  2GME A;  3K3N A;  3T1L A;  1HKD A;  1Q8V A;  2ZXQ A;  4LUK A;  2PN5 A;  4BXS V;  3VBR C;  2BWC A;  2OX0 A;  1RUN A;  4LLF A;  2HYK A;  2Y38 A;  3L9J T;  5K4L A;  3PJQ A;  4ZU5 A;  1UAI A;  4GWN A;  5F3I A;  3HQX A;  2MHF A;  3I7D A;  5D1I A;  1BVV A;  2NPI A;  5K0U A;  1L7Q A;  1W05 A;  3CJI A;  3DXU A;  4GAZ A;  1W04 A;  1ZM1 A;  1YQ5 A;  3THD A;  4C90 A;  5FLJ A;  1FNZ A;  3TEX A;  1GQH A;  2P2K A;  2VZO A;  4D6R A;  5JMC A;  1HJF A;  1VBC 2;  3ZDS A;  1PK6 B;  2AYH A;  3AP5 A;  4R9D A;  2DVD A;  2DBN A;  4LBQ A;  4CEY A;  3WY6 A;  3VBU C;  5IVJ A;  1LGC A;  2ZAH A;  3HN3 A;  1JHJ A;  3I2F A;  2ARX A;  3SH3 A;  3Q8A A;  2ZGM A;  3G7D A;  4U36 A;  3NAP C;  1NE6 A;  5BV6 A;  1AVB A;  1GP4 A;  4P14 A;  4CEW A;  3DKQ A;  1EY2 A;  3LCP A;  5FY9 A;  1VBB 1;  2ZZJ A;  4P9Y A;  1DZR A;  2WT2 A;  1RIN A;  1WA6 X;  5FYS A;  1QOS A;  3D82 A;  2JE8 A;  3H3U A;  5K0U B;  2VQU A;  1JOB A;  3S5A A;  5KHG A;  1Q43 A;  3K4Z A;  1ZRD A;  2Q8E A;  4KBZ A;  4A3X A;  2R6Q A;  1ZX5 A;  4IEX A;  5IAT A;  1VAM A;  1W8F A;  2BVB A;  3Q8C A;  2W08 A;  1TMF 2;  1BLZ A;  1LCL A;  4Z07 A;  4P9J A;  3POE A;  3OG2 A;  2ZGS A;  1FV3 A;  1LHN A;  1MQT B;  3K46 A;  1LGB A;  3VZM A;  1ULE A;  5KHJ A;  1MR5 A;  4PIZ A;  1CZS A;  4YLZ A;  1GP5 A;  4D6S A;  1XNT A;  2Y6L A;  4GZ9 A;  2IXJ A;  4IE7 A;  4TN7 A;  5J36 A;  1O8S A;  3NST A;  1D4V B;  3IT8 A;  3OPZ A;  3MPP G;  2OXB A;  4QDQ A;  2FCU A;  2C0Z A;  1ASJ 2;  1FT9 A;  1H2K A;  3E5Q A;  5FMD A;  4FOV A;  2WZ8 A;  4CVU A;  1ZBA 2;  1VRB A;  2PHX A;  4PHZ A;  1W0P A;  1QGL A;  2AUY A;  5DUW A;  4CU7 A;  3VHO A;  4TXW A;  4YM1 A;  1HRV 2;  4DUX A;  4LK7 A;  2RMU 3;  4N43 C;  1XB9 A;  4Y3O A;  2D98 A;  2RDQ A;  2XH6 A;  4F7Z A;  3PVO A;  1VBD 1;  5CA6 A;  3UET A;  2BER A;  1NXM A;  3R4D B;  4WVM A;  4FPY A;  2OT7 A;  1MZ6 A;  5D8A B;  5FYI A;  4LO7 A;  2EXJ A;  2WS9 2;  2YMZ A;  2WYS A;  4JGY A;  1ZRE A;  2GH2 A;  2BGO A;  1NOV A;  2WAA A;  4PIX A;  2BFU S;  3FFQ A;  3GBF A;  4E4Z A;  5I0S A;  2FDF A;  4ZY9 A;  4A4A A;  1H4H A;  1XNK A;  4Q0U A;  3FFZ A;  1LB2 A;  1S0J A;  4AVT A;  4CU6 A;  1V6L A;  3B7M A;  1RUO A;  3NAP B;  3SEE A;  5IK5 A;  4RS5 C;  3CF6 E;  3OSD A;  1AL0 G;  3WNK A;  1EV1 1;  1GZW B;  1SG3 A;  3FHQ A;  4Q0S A;  5FZ1 A;  2DFB A;  2J7M A;  2DVG A;  4A2U A;  2AZ5 A;  3V0B A;  3VBU B;  2FDI A;  2H6C A;  3ZYI B;  4WM8 B;  3AKT A;  1CWP A;  4KWL A;  3SIS A;  4AAX A;  2ERF A;  1HLC A;  4QHO A;  5IVY A;  3BPS A;  5HXM A;  2CTV A;  2AH2 A;  1RUJ 1;  1LES A;  1ND2 C;  4Y5Z 0;  5FPZ A;  1HB4 A;  4OFG A;  4XXP A;  3UES A;  2HWC 1;  5FZ4 A;  1QXP A;  3RVH A;  4M3C B;  1GZC A;  2B42 B;  3AP6 A;  1LRH A;  2Y0I A;  1W03 A;  1POV 1;  4RR3 A;  1YQ2 A;  2O1Q A;  4X6Q B;  3ZFG B;  3AMP A;  1RUD 2;  1ND3 C;  2RMU 1;  2UWC A;  1REF A;  2HBT A;  4JQT A;  2A6Y A;  4FFH A;  4XET A;  4E4S A;  4MUV A;  4RA0 A;  2ZEZ A;  1KFX L;  2SBA A;  3NJY A;  1W6N B;  3IZO A;  4EE2 A;  1QJU 3;  1SLC A;  4XAC A;  2JE9 A;  1O4Z A;  3BAL A;  4JRL A;  2WA4 A;  4YW7 A;  5F6K A;  3RS6 A;  3SCG A;  2AEN A;  1QIQ A;  2KR2 A;  2F4L A;  1QEX A;  3U37 A;  4OQ8 A;  3ILF A;  1UPS A;  1OKO A;  4ATF A;  4AHX A;  3VD5 A;  1SQ4 A;  4N9H A;  1HB2 A;  1P8J A;  2D6M A;  1HN0 A;  3I3E A;  3WF0 A;  4AXO A;  1NLS A;  1O3T A;  2ETE A;  2QZ3 A;  2RS3 2;  1MS3 A;  1UNB A;  4XTM A;  4H14 A;  1NG0 A;  5FZA A;  5JOX A;  4UW3 A;  1H9W A;  4GWI A;  2QQW A;  3WOG A;  5ABJ C;  1Z0H A;  1ZRF A;  3NV1 A;  1BBT 3;  2VUJ A;  4FOY A;  3OUH A;  5EP9 A;  4HAN A;  4P9I A;  4X6R B;  5FXX A;  1WW7 A;  4MX3 A;  1GV9 A;  3R05 A;  4CYD A;  3WP3 A;  1D4M 2;  1MQT A;  4FFI A;  2EF6 A;  2XHN A;  4SBV A;  3CZU A;  5AVP A;  5T55 A;  1XNB A;  2ARB A;  4IGO A;  4DRV A;  2ZGR A;  2E32 A;  4ARX A;  2RDS A;  4IEY A;  4D7Y A;  1HJG A;  2XUM A;  4QXC A;  3BUC A;  3N4M A;  4CDX B;  3ZXJ A;  1MVQ A;  4R9A A;  4EJR A;  1CAW A;  1CES A;  5J7M A;  1WME A;  5T3N A;  4ZHN A;  3OJB A;  2FMY A;  5JXH A;  1AR9 2;  1F31 A;  4BJ0 A;  4PCR A;  2OVU A;  3CLP A;  1QQP 1;  3MW4 A;  4FQZ A;  4LO8 A;  3OD4 A;  1H6X A;  1TME 1;  5APA A;  3IWZ A;  3P3N A;  1Y9Q A;  4GWJ A;  4RN5 A;  3T0A A;  4BK5 A;  5FLI A;  3FZ3 A;  2BEO A;  5IK4 A;  2GAU A;  4YVW B;  3WV6 A;  4BQ4 A;  2WNV C;  2A3X A;  4K6B A;  1RJ8 A;  1W90 A;  3OD0 A;  1CAV A;  2BNM A;  2J1U A;  3BN6 A;  1YWK A;  3VDA A;  4DO0 A;  1DGW X;  4XFF A;  2VW1 A;  4PI2 A;  4XAA A;  2WFF 2;  5IYY A;  1OA2 A;  1QY4 A;  1JS9 A;  4IV1 A;  1VBA 1;  2C24 A;  5A7W A;  2VJX A;  3NNJ A;  2W47 A;  3DYM A;  1AR8 1;  1Z78 A;  1TVG A;  4YM2 A;  1UO9 A;  3SHR A;  3ZFF C;  1CZV A;  1PO2 1;  2NYY A;  1N3P A;  2YBK A;  1DBN A;  1V6M A;  1MPX A;  2JG9 C;  4KL1 A;  5DG2 A;  1VAL A;  3FL7 A;  2F4P A;  1LOD A;  2VPV A;  3QLQ A;  4PLM A;  3ZXG A;  2IVJ A;  4DUW A;  1OF4 A;  1Q56 A;  1OXC A;  1N3O A;  1H1I A;  2EID A;  1UKG A;  1JYV A;  2PHR A;  1QOO A;  2D6L X;  1O8P A;  2A75 A;  4MHU A;  2CGO A;  5AVA A;  4Q4Y 3;  3HAG A;  3IPV A;  3SLI A;  5FUN A;  1Q3E A;  5CB7 A;  2KA3 A;  1NY7 2;  3S6P A;  3D5O A;  3UJO A;  3B69 A;  3H3L A;  3UJQ A;  5J96 B;  1RUJ 2;  1LKN A;  2XON A;  1YI7 A;  2XWB B;  1F9K A;  3AL6 A;  1UWW A;  4PQQ A;  5LA1 A;  1EYB A;  1ZZ6 A;  1FPN 1;  4W8J A;  1W39 A;  4TLF A;  4UFH A;  1CN1 A;  3AKR A;  5FYU A;  4PT6 A;  1C5I A;  5A7P A;  5LWB A;  3O1T A;  2CAV A;  1FPN 2;  5BNN B;  5BYN A;  2JB4 A;  2R07 3;  3ZFE A;  2IXL A;  4A6O A;  3K3O A;  4IES A;  4MZU A;  5CYY A;  1NY7 1;  3LOI A;  5FJH A;  4XYX A;  2CGP A;  1EP0 A;  1DP0 A;  4XJ8 A;  3WCR A;  3K77 A;  5A3U A;  2DUQ A;  2D44 A;  1R1Z A;  2O0O A;  1VMF A;  2DYC A;  2CDP A;  2E26 A;  1S2B A;  4H7L A;  5IVC A;  2Z4F A;  4I0B A;  3C7E A;  4WVM B;  3MF6 A;  3TNQ A;  3LD8 A;  3RZM A;  2VBD A;  1UW8 A;  3OGS A;  1NCQ A;  1BHG A;  2WNV B;  4QX7 A;  1EAH 3;  2VBP A;  1A8D A;  3MUY 1;  1W2A X;  4QWN A;  1ST8 A;  5DZF A;  5A6Q A;  4GB3 3;  1YQ6 A;  2R1D A;  3GJA A;  4ASM B;  2LS6 A;  3DYO A;  1C57 A;  1UZY A;  2BGP A;  4COV A;  5CFC B;  3KHC A;  2ZAB A;  2HEV F;  1YFU A;  2R0H A;  4YZ5 A;  1ODN A;  1DLC A;  1BQP A;  1YIP A;  3E1F 1;  5LRR A;  1CIY A;  3TN9 2;  4YG6 A;  1ZBA 1;  2ZAA A;  2VH9 A;  4RQP A;  5KBF A;  2WNO A;  2R30 A;  4LO4 B;  1JOP A;  5J98 B;  5BNN A;  1JW6 A;  4A7Z A;  4FPO B;  4DEV A;  2Q1M A;  2BUK A;  5T54 A;  5GKA C;  1YI9 A;  1QJY 2;  1DG6 A;  2VE1 A;  3ITQ A;  1WBF A;  5T52 A;  2BRT A;  5FK8 A;  4AR2 A;  5CG9 A;  4Y1Y A;  4DXS A;  3ZFE C;  4KWK A;  5EYX A;  3UT0 A;  2W2I A;  4MSV A;  1HB3 A;  5FJK A;  3ZIW A;  4QXB A;  3VKL A;  5FIX A;  4NE9 A;  1J1T A;  3GZT B;  1LOG A;  2CV6 A;  4NRP A;  5CNA A;  1C4R A;  1JN2 P;  3KT7 A;  4Q1P A;  3BU0 A;  5FZ9 A;  5FBZ A;  3FLR A;  2UYB A;  1C1F A;  2G19 A;  4LEJ A;  1LOB A;  4P9L A;  2VNV A;  3LDB A;  4RL7 A;  4J6G A;  3M2M A;  4FVV A;  5HBA A;  3T1M A;  3PUH A;  4AQT A;  4YW1 A;  2LTN A;  1GNH A;  3AJY A;  1NQJ A;  3MW2 A;  4AFC A;  5FZ3 A;  5AFB A;  2ZMN A;  4HSL A;  3VBS A;  1ULC A;  3NRU A;  1BBT 2;  1ULD A;  5C6C A;  2VCC A;  2AGS A;  3M3O A;  4I2O A;  3I59 A;  2WSV A;  3KHB A;  4AEJ A;  4FAG A;  5FCC A;  3LAG A;  3FLT A;  3I3M A;  2DV9 A;  1KGY A;  3L2H A;  4H3W A;  5FP8 A;  5DZG A;  3ZN5 A;  1A78 A;  1UQX A;  2RM2 2;  5LBC A;  4LLO A;  2XHK A;  5GZC A;  5CKM A;  5KHI A;  4LUL A;  4JVA A;  5KXE A;  1WCU A;  1OFN A;  2W39 A;  4YWA A;  4IE5 A;  1UY1 A;  1AL2 1;  2DVA A;  3AP9 A;  4B7E A;  4Q1R A;  4A7K A;  3I49 A;  3KV5 A;  2DCK A;  2P5B A;  2YG0 A;  1OUR A;  4K7J A;  1H2M A;  3NJZ A;  4Z1V A;  5F3G A;  3M3C A;  4EYU A;  1MQT C;  2VMF A;  1YO8 A;  4QU1 A;  4Q4Y 2;  3POB A;  1HIX A;  2YV8 A;  1LOF A;  4AWD A;  2XG3 A;  5C3Q A;  5EQU A;  3GHM A;  3U4S A;  1SFN A;  4B29 A;  3CMG A;  4D7S A;  3O1U A;  1K12 A;  1XE0 A;  1JUI A;  2YGM A;  3PUA A;  5IFT A;  3GF6 A;  1A6C A;  1LHO A;  4WM8 C;  2HWD 2;  1UPI A;  3N3H A;  4JDM A;  4CDW B;  1GNY A;  3ETP A;  1RUH 3;  3PIG A;  2VCA A;  5FP7 A;  4ISR A;  2V72 A;  1X9T A;  5KXC A;  2RM2 3;  3O1P A;  2WN3 A;  4QKN A;  2WJS A;  4ZU7 A;  1CGP A;  2CY6 A;  5C8C A;  4NVP A;  2JEM A;  3ME2 A;  2W91 A;  2E6V A;  3MZH A;  5T50 A;  1O59 A;  3P5B A;  4I09 A;  4DXT A;  3ACL A;  1UYY A;  3VDD A;  1W2O A;  2BZD A;  3OBA A;  4GKX A;  1US3 A;  3T4H B;  1C1L A;  3WNX A;  1RUE 3;  3QOP A;  2VW2 A;  4ZS2 A;  2VO5 A;  3H1M A;  3VZL A;  5LY1 A;  4RR3 C;  5LCW L;  1CR7 A;  1PO2 3;  1G86 A;  2TUN A;  4CZS A;  3BPZ A;  1V6K A;  3NVC A;  5BNO B;  3RZJ A;  2WS9 3;  4LJH A;  2D6O X;  5GAL A;  4BE3 A;  4KWJ A;  2YC0 A;  2C9A A;  1SDD B;  1DQ2 A;  2WS9 1;  2WQ8 A;  3CJI B;  1W9S A;  4A45 A;  4LHN A;  4CDX A;  5JSP A;  2JDU A;  3S7E A;  4CCM A;  4K3U A;  5IVB A;  3A21 A;  1HRI 1;  4NAM A;  2CWM A;  2WZR 1;  3FC0 A;  3KD4 A;  1HRV 3;  3RDI A;  2ZEY A;  1ZZC A;  4JGY B;  1CIW A;  2J1V A;  2ZX2 A;  4OI4 A;  3TEZ A;  1N3Q A;  1H9P A;  5IW0 A;  1DQ5 A;  4LA2 A;  5FZG A;  3TN9 3;  1QJX 2;  4BWO A;  3RNS A;  1ND3 A;  3U75 A;  4GIQ A;  3RZG A;  5LB6 A;  1YFW A;  1D2S A;  1V70 A;  4MGY E;  3THP A;  2XWJ B;  4KQ7 A;  1SHW B;  1POQ A;  3MV1 1;  5D8A C;  1Q8Q A;  3JQX A;  2ID4 A;  3T0D A;  4O7X A;  3JD7 1;  2E33 A;  5FPV A;  2VZU A;  1OQ1 A;  4IEP A;  4BCU A;  1EAH 2;  1RHI 1;  4ORF A;  5GZG A;  2RJL A;  3K2O A;  5JIU A;  3UGG A;  5DAQ A;  3LZZ A;  2WII B;  2XJS A;  3AJZ A;  4XMA A;  3WW4 A;  2PQQ A;  1UMI A;  2ZEW A;  3RG0 A;  3QD6 A;  4EN9 B;  2G1M A;  5A3W A;  4B4Q A;  3AYA A;  1FNY A;  1QJU 2;  1R08 2;  3NQH A;  4GMP 0;  2VMG A;  2WAB A;  4PBO A;  4M4R A;  2J42 A;  4ZXK A;  3SQO A;  4FTE A;  1AYN 1;  2J1R A;  2XLA A;  4YW3 A;  4CDQ A;  4XIO A;  5I8T A;  2P4E A;  4YM0 A;  1AYN 3;  2XJU A;  4M3C F;  1JZ4 A;  3I2O A;  4XJA A;  1A3K A;  2JG9 A;  2ZKN A;  1W6M B;  4Q2F A;  3VHR A;  1QU0 A;  4B1M A;  4GJZ A;  1NE4 A;  2XBO 3;  1EPZ A;  4GMP 3;  4H2A A;  1JOD A;  3WDX A;  2QDR A;  1QJY 1;  3K4A A;  3V0A B;  2A1X A;  1F5J A;  5H9Q A;  3EXU A;  3MIG A;  4PJY A;  5SV5 A;  4RFR B;  5FZE A;  5FZI A;  1H0B A;  3TN9 1;  3ATG A;  2PA7 A;  4N43 A;  3LE0 A;  1GZ9 A;  4IEO A;  2Q8C A;  4LIV A;  5DG1 A;  5FZM A;  1SLI A;  1IQD C;  2RVA A;  2D7F A;  3VBO B;  4E8C A;  3RMY A;  5FO8 B;  2HLE A;  4HSJ A;  2OPW A;  2BQP A;  4E4D X;  4AED B;  1ACC A;  3NAP A;  3W5N A;  2E63 A;  2W68 A;  2I2S A;  3RJR A;  4C1X A;  1MEC 2;  1LU1 A;  5A32 A;  1QH6 A;  3FMG A;  3MEP A;  2GC3 A;  4WM7 C;  3ST7 A;  4FI9 A;  1GLH A;  4GB3 1;  1FI2 A;  3TWI A;  5FZD A;  3OUI A;  3PVN A;  4YVW A;  3KT1 A;  3DEM A;  2E51 A;  5AC9 3;  1O91 A;  3H50 A;  3OGV A;  4FO9 A;  4IV3 B;  4KGG A;  3VHP A;  3WDY A;  2WFF 3;  2W94 A;  1B35 C;  4O9G A;  5ERL A;  1K3I A;  2V5Y A;  2JB8 A;  2WNU C;  1LJ7 A;  1NAE A;  2W1Q A;  4Q4X 1;  3KCY A;  4OHV A;  4QXK A;  3F95 A;  3AFG A;  1DGW A;  4FPC A;  1VBE 2;  2GNT A;  4J1W A;  3POI A;  3TOJ A;  4CEW C;  2H0V A;  4JHZ A;  1OOP A;  3T2Q A;  3WF2 A;  4P02 B;  2YXS A;  5EIY B;  1VBE 3;  5E88 A;  5FYT A;  4A44 A;  4CRQ A;  1OMI A;  2YFU A;  4BHP A;  1AR9 3;  1WCS A;  2GAL A;  3PDQ A;  4AFM A;  4JGZ C;  1RUF 2;  4DIQ A;  3VBH A;  3WF1 A;  5JOZ A;  3BCW A;  3HIF A;  4XCA A;  3S0M A;  2B5H A;  3WG2 A;  1FAT A;  3ZFF B;  3KWV A;  4MGS A;  1NCR A;  2AC1 A;  2DVB A;  3BB6 A;  1QJU 1;  3PTY A;  3C7O A;  1OPO A;  5J37 A;  1IG0 A;  1W6O A;  2IC1 A;  1B09 A;  1GMM A;  1H8T A;  1TMF 3;  2W52 A;  2XGX A;  3DV8 A;  3LDK A;  4S2D A;  5EYY A;  4ZXE A;  5DXD A;  5LY2 A;  1BEV 3;  4YFZ A;  2FZ2 A;  4B7K A;  4CP0 A;  1H2N A;  4BDV B;  1CJD A;  2PYT A;  1CPM A;  2Z42 A;  3IPV B;  4BZ4 A;  1KEX A;  2Z2S B;  3LIG A;  4MXW A;  3AKQ A;  3CHX A;  1ENX A;  3H1W A;  2Z69 A;  1RMU 1;  1QNW A;  4EN0 A;  3R4U A;  2IZW A;  1VBA 2;  5KHH A;  4DMI A;  2WFF 1;  4M3C A;  1KIT A;  4BQ5 A;  2BU9 A;  4N7I A;  4X8P A;  1GOF A;  1JZ7 A;  2EAL A;  4G9S B;  4YW5 A;  5A6X A;  4HN0 A;  1AF9 A;  4IEQ A;  4MVT A;  1LNS A;  2ADD A;  4Q0V A;  5C4W A;  5CKN A;  4TTG A;  5E8A A;  2WO7 A;  2E7A A;  1BKZ A;  4D0Q A;  2Q8O A;  5FUI A;  1HRI 2;  5IJR A;  3WQ0 A;  4N43 B;  2HBU A;  3BGA A;  2XBO 2;  1CX4 A;  3LWC A;  3ROU A;  1F4A A;  1AUY A;  4HKL A;  1R64 A;  4LIT A;  1VRH 2;  3LF7 A;  4XBN A;  3WDU A;  3QAC A;  1QQP 2;  2VNG A;  5D21 A;  5GLT A;  5C9A B;  3R6S A;  1DFQ A;  1MZF A;  1O5L A;  1SFP A;  4QKD A;  3FX3 A;  4I0A A;  4W6Y A;  3ZFG A;  1STM A;  3NMB A;  5JMO A;  4Y1Z A;  4R4X A;  4YSF A;  3E6D A;  1W3V A;  1F4H A;  3HNY M;  4Y4R A;  5FZK A;  1NT0 A;  3ZKY A;  2ORZ A;  4CDU B;  1S0I A;  5A1A A;  1J83 A;  2K46 A;  3WR0 A;  3DGT A;  3NO8 A;  5T5P A;  4KNC A;  4QX1 A;  1L3J A;  4QX8 A;  5DDJ 1;  1R09 3;  2B9V A;  4NR1 A;  3BTA A;  5ANQ A;  4PDW C;  4K9S A;  1ULG A;  1O3S A;  4P08 A;  2P3Y A;  3WG4 A;  2X09 A;  1VMH A;  1W9W A;  2WRA A;  3OF1 A;  5T5L A;  3RZK A;  4EN8 B;  1FMD 1;  1RUG 1;  2PMW B;  3AYD A;  2P6H A;  3FJS A;  1SLL A;  4CDQ B;  2V09 A;  1MS1 A;  4BQX A;  1KFU L;  5L9V A;  3VZK A;  4JCK A;  4DFS A;  2R7E B;  1DGL A;  4XF9 A;  4OHY A;  1CAW B;  1UY4 A;  4NIH A;  4XUT A;  4MH0 E;  4K1Y A;  5HV0 A;  2PHU A;  1UOF A;  5KC6 A;  4Q26 A;  1W6M A;  3EQE A;  4CDQ C;  5HPO A;  4CUB A;  3IAP A;  4JX0 A;  2GNB A;  3UYJ A;  1W8U A;  2QVS B;  5F37 A;  4CE8 A;  1FAY A;  5JVV A;  2QQL A;  4I0W B;  1OC1 A;  2XR4 A;  1Y9G A;  1DHK B;  1W9Y A;  2BFU L;  1EUU A;  2BDR A;  2QQN A;  2QQI A;  2HEW F;  2IXC A;  1ZZB A;  1RUD 1;  2RMU 2;  5LK5 A;  4G4F A;  4HKW A;  1WGP A;  4K20 A;  4NN0 A;  4YGE A;  4L2N A;  3N35 A;  2ZBJ A;  4W65 A;  4UW4 A;  3HPN A;  4BQ1 A;  3VBF B;  2RM2 1;  1MS8 A;  3GAL A;  3KVB A;  3RYR A;  1V6J A;  1UU4 A;  3T3Y A;  5JOW A;  5F8P A;  4IEW A;  4L9B A;  2P37 A;  1QDO A;  5EZW A;  3DN7 A;  2D5H A;  2JD4 A;  1RTV A;  2OW4 A;  1DQ4 A;  2BNO A;  2CGN A;  2BNN A;  2R06 3;  4K1Z A;  5EPA A;  3ZO0 B;  3GZU C;  1UZ0 A;  2PHF A;  4HBN A;  1WKY A;  2R06 1;  5FBJ A;  1H8T C;  1C8N A;  3RQ0 A;  5DDJ 2;  2BJS A;  1KJR A;  4LBM A;  4IE4 A;  2VOV A;  1W0N A;  1UY2 A;  3FBM A;  1GP6 A;  2VUA A;  4NJ4 A;  4HL0 A;  2XB6 C;  2NQY A;  3PUI A;  3M3Q A;  4YW6 A;  1RUH 2;  4PLO A;  1LUL A;  1RUI 2;  1YQC A;  4XFA A;  2WT0 A;  4YRD A;  2A73 B;  4NRO A;  1ZVF A;  3POW A;  4UOJ A;  3ZYR A;  2CSG A;  2RDN A;  3ZXL A;  5C3R A;  3AZW A;  1IZ3 A;  4D69 A;  3VB9 A;  4Z92 B;  2WL1 A;  2XJV A;  4Q4X 3;  2D43 A;  4FPL A;  1W8N A;  1RXF A;  4NHY A;  4XVH A;  3RWK X;  1O7F A;  3SIT A;  5FZ0 A;  1RYY A;  1X9P A;  5DAP A;  1GYK A;  1W06 A;  5IK7 A;  1PK6 C;  2ARA A;  2A6V A;  3LEK A;  2JDH A;  2ZGP A;  3UNP A;  4HPK A;  3MID A;  2J1T A;  1NCR C;  1WWY A;  4WM7 A;  2QNK A;  2QQO A;  5EJ3 A;  1OT5 A;  3LIH A;  3ZYH A;  4HFS A;  3Q9O A;  4XJZ A;  2XML A;  5CEH A;  3AP7 A;  5FP9 A;  3VKM A;  2XL9 A;  1RMU 2;  5G04 L;  1WZX A;  3NNM A;  1LEM A;  1I5Z A;  2YZ4 A;  4IEU A;  1QMJ A;  5JI7 A;  4OI1 A;  1X7N A;  4AVB A;  5JLV A;  3O1M A;  5A7S A;  5C5U A;  2YC2 A;  1I3H A;  2MPF A;  1NZI A;  1NA1 C;  2UWB A;  4FPE A;  3SNM A;  2NZ9 A;  3RYP A;  1HV1 A;  4LHK A;  2Y60 A;  1JI6 A;  1VJ2 A;  3WHU A;  1TMF 1;  1YCI A;  3VDC A;  4COU A;  4DPN A;  3KCC A;  1XE8 A;  4ZPI A;  1JYT A;  2GDF A;  3KGL A;  4AHZ A;  1XE7 A;  4KBB A;  1JZ6 A;  4OLL A;  2ZGT A;  2BPA 2;  1NQD A;  2VOX A;  1R1A 2;  3JB4 C;  4SLI A;  2JIJ A;  3VDB A;  3UGH A;  2J1A A;  2W0X A;  2Y0O A;  2AEZ A;  4XJ9 A;  4JDO A;  1BMV 1;  2EVX A;  4PQ9 A;  1A8M A;  2Y6G A;  3N7K A;  2DUR A;  1QJY 3;  4FFG A;  2XL7 A;  4XFH A;  4CUC A;  4CCJ A;  3BOP A;  4W6W A;  1GWK A;  5EV7 A;  2WWU A;  3ZN4 A;  1BVP 1;  1T2X A;  3H7Y A;  2XPJ A;  4NMI A;  1JYI A;  1SBF A;  1DQ0 A;  3RZL A;  1VBC 1;  2DCZ A;  5KXB A;  4XPV A;  1IQA A;  4XHB A;  3PUQ A;  1DDL A;  3N9P A;  1LGN A;  4MXV A;  2RS5 1;  3FHI B;  4XIL A;  2W1W A;  3PU8 A;  4OHX A;  3B00 A;  5FRA A;  3ZYJ B;  2DDU A;  3MI8 A;  2PFW A;  2JKB A;  4XJW A;  2G9G A;  4ZKT B;  5IFP A;  4NID A;  2J1E A;  2FBE A;  4IE0 A;  2WDB A;  1HQL A;  2PQS A;  1AR7 1;  2PLV 2;  3JD7 3;  5JIA A;  3BKZ A;  1O3Q A;  4UWD A;  3WNP A;  2HWB 2;  4P9X A;  5H9P A;  4GB3 2;  1D7P M;  3ZX7 A;  2GSY A;  4K8F A;  2FDJ A;  5JR7 B;  2DU0 A;  4YZ2 A;  3VD3 A;  2VUC A;  1H2L A;  2XLF A;  2LW8 A;  2X29 A;  4IDZ A;  1V6O A;  1PO2 2;  3N9N A;  1PIV 3;  4E27 A;  1S4C A;  2OQ6 A;  5L73 A;  5ACA 3;  1B35 B;  1R09 1;  5C8C B;  5IAX A;  1G9C A;  2YGL A;  4OMD A;  4AI3 A;  2VTX J;  1PNG A;  4ASL A;  2ORX A;  4FOW A;  3RI8 A;  2H6B A;  5GZE A;  1TNF A;  4MO3 M;  1TE1 B;  1YEW A;  3SCF A;  2DCT A;  2OKX A;  1AJK A;  3O5S A;  4FP3 A;  2V5D A;  4B4R A;  4ZZ5 A;  2WZP P;  4OUM A;  4Y22 B;  2EIG A;  1J84 A;  2Y26 A;  4DQA A;  5KC5 A;  3HN1 A;  4XDP A;  4UF0 B;  2GP5 A;  5FMB A;  5JSO A;  2WA3 A;  2JDA A;  1VE0 A;  3UV9 A;  4DOU A;  2MNG A;  1UYZ A;  1TEI A;  1O4T A;  1QH7 A;  4DY3 A;  1COV 3;  3ZYB A;  1LHW A;  1V9U 3;  1XYN A;  2VGD A;  5KXD A;  1DGR A;  3LEG A;  5DN2 A;  1CZT A;  1U5I A;  1DYO A;  3CZJ A;  5FKC A;  5D8A A;  2B4K A;  4WVV A;  4QDR A;  3WF4 A;  3NW4 A;  5I93 A;  1MS0 A;  2X53 S;  3FUQ A;  3OGJ A;  4QX0 A;  5GZD A;  2Y6K A;  3U0Z A;  1X36 A;  5A1L A;  3NV3 A;  3BOD A;  4XTP A;  3CDZ B;  5A7N A;  2QQV A;  2JEC A;  4AVA A;  4Q0Q A;  3VL9 A;  1NA1 B;  2VQT A;  3LEI A;  1AYN 2;  4HLT A;  4B3N A;  3MGU A;  2VQ0 A;  3VDD C;  4CXY A;  1UIJ A;  3APB A;  2ZA9 A;  1S0C A;  4QKF A;  4COZ A;  2B8M A;  4BIO A;  5FZH A;  5CU1 A;  1UIK A;  2ZKL A;  4OI2 A;  2VVE A;  4O65 A;  4DIN B;  3BOW A;  2ENR A;  3RSJ A;  4QAW A;  3OPW A;  4XAB A;  1IG3 A;  3SH4 A;  1TME 3;  2P6C A;  3OEA A;  1RGS A;  1OQD A;  1J1L A;  1W9F A;  3O1V A;  1N1S A;  1XJA A;  2WYF A;  2GN3 A;  2Q30 A;  3NV2 A;  5ACA 1;  2FDK A;  4QQH A;  1C8M 1;  4KH9 A;  2RS3 1;  4GD4 A;  1JYW A;  1F5F A;  3N7L A;  4IV3 A;  4MGT A;  3M3E A;  1DU3 D;  1KS4 A;  3WDV A;  4GH4 B;  2XLG A;  4AFA A;  1RIT A;  4I30 A;  1ZBE 3;  1UY3 A;  4J1X A;  4M01 A;  1LOF C;  1NLQ A;  3PTR B;  4WVW A;  3AYE A;  4AVV A;  5I0D A;  2UWA A;  1UKR A;  1UU5 A;  4OYU A;  2JKX A;  3IDB B;  2HH9 A;  2RS5 3;  1OLM A;  2TEP A;  4EN7 B;  5FOB B;  4OZO A;  4S2H A;  4AHW A;  1DQ1 A;  2J1S A;  1YFX A;  4BIS A;  4LBL A;  1UYP A;  3FUO A;  4QPG A;  3I54 A;  4FPG A;  1WW6 A;  4OUE A;  1JU4 A;  1OSG A;  2WO1 A;  3HR9 A;  4QQP A;  4R9C A;  1GR3 A;  5I91 A;  2RJK A;  4WVZ A;  1XXN A;  1JYN A;  3C3V A;  2EA7 A;  4LOT A;  1TG7 A;  5BPX A;  2GMM A;  2HWF 2;  3T08 A;  2ZGK A;  2YU1 A;  4N7U A;  1EUT A;  3CO2 A;  3AMN A;  3ZM8 A;  1ND2 B;  1OA4 A;  2C6S A;  3ILR A;  4FXG B;  4BK4 A;  1LEN A;  1PNF A;  5A6Y A;  2DTY A;  2WNV A;  4I01 A;  4AI2 A;  1ALY A;  5F3C A;  3LSE A;  5DUU A;  3MFA A;  3V56 A;  1H6Y A;  4S2G A;  2YFZ A;  4QHZ A;  3WT3 A;  4UFL A;  3RZH A;  4Q4W 3;  4NHM A;  2ZX1 A;  2QE3 A;  2OII A;  1IPJ A;  2RS3 3;  4XF1 A;  3THC A;  5FP3 A;  1AR6 2;  4N8M A;  1DYP A;  1QHD A;  2V73 A;  2ZGN A;  3ZKU A;  3ZMO A;  4QHB A;  2DFC A;  2XJP A;  2FMD A;  4CP2 A;  2HWD 1;  4YW2 A;  5FY7 A;  2WSU A;  2D3P A;  2HJI A;  3V65 A;  5DQ0 A;  3OBR A;  4XUP A;  2W3J A;  1LHU A;  2CU5 A;  2C9K A;  2HWD 3;  2XKP A;  4LOR A;  1U0A A;  1FX5 A;  3BIW E;  5DAV A;  2NMO A;  1G7Y A;  3LSD A;  3W59 A;  1JOJ A;  4CTE A;  1PMH X;  2VVF A;  5J48 A;  5F5I A;  5F5Q A;  1IOA A;  4RD7 A;  1S0F A;  1VBD 2;  1MVE A;  2BOI A;  1IS5 A;  3N36 A;  4RQP C;  3C2U A;  3VZN A;  3VBS C;  1V0A A;  1Z7S 1;  1UU6 A;  2HWB 1;  4JQR A;  1XQN A;  3D4K A;  1HRV 1;  4IEV A;  4BQ3 A;  4IGP A;  5C33 A;  3NWK A;  4Z2A A;  3WDT A;  5A1F A;  2ZHK A;  3H8U A;  3NV4 A;  4XOG A;  5FPU A;  5DUV A;  2ES3 A;  3MF9 A;  3TB0 A;  1JHN A;  1S0B A;  1G9F A;  2FCV A;  2D6P A;  4A3Z A;  3VD4 A;  3ACH A;  3MIF A;  4UBG A;  3TBD A;  1ENR A;  2YUE A;  1N1Y A;  5FAX A;  4GWM A;  1E5S A;  3H7J A;  4XE9 A;  2YB7 A;  3ENR A;  3USU B;  5CFD A;  3ZN6 B;  4BIF A;  1HB1 A;  1PMJ X;  2Y34 A;  1OD5 A;  3BTX A;  4FFF A;  3KGZ A;  3IKW A;  2PHL A;  5GLW A;  1I9R A;  1MS5 A;  3SXW A;  1VBD 3;  3POY A;  3U14 A;  1UN1 A;  2GNM A;  5JPM B;  1CAU A;  4XQW A;  1YC6 1;  2FZ1 A;  5E89 A;  4OHW A;  5IAV A;  4Z82 A;  3GZA A;  1LR5 A;  3HQU A;  2O8O A;  3OEB A;  2I74 A;  4NRM A;  1REE A;  4S2F A;  1WBL A;  3KCX A;  4D3W A;  5DUX A;  3WQ1 A;  1AR6 3;  3E5X A;  1ULP A;  3BYW A;  1S2K A;  2W87 A;  3NKG A;  3NKT A;  4QKB A;  4BU2 A;  5I8Y A;  4BQY A;  1F35 A;  1NCQ C;  3ON7 A;  2PLV 3;  3JD7 2;  4NWV A;  3OGR A;  1RL3 A;  3SEP A;  3M1H A;  1WW4 A;  5F9T A;  5A3O A;  1OPM A;  2EXK A;  5LBF A;  3OTF A;  4RGK A;  1MAC A;  4QPI B;  1AL2 3;  2LUW A;  2VBB A;  2H0B A;  4CXW A;  3ZN6 A;  5CFD B;  2ZGU A;  4MOA A;  1GQP A;  3VD7 A;  2VOT A;  3ZLI A;  4B1L A;  1SCR A;  1RXG A;  4QGL A;  3NL1 A;  5IVF A;  4M3C E;  4LO6 B;  3EHK A;  3WW2 A;  5C3S A;  4MGZ E;  4RS5 A;  4AOC A;  3III A;  5F1R A;  5JSR A;  2C4X A;  2CWS A;  1W6P B;  3V0B B;  2DBI A;  2V4V A;  3O7O A;  3IMM A;  3ZFF A;  4IQP A;  4BLI A;  3H8R A;  3ZR5 A;  4C0H A;  1NX9 A;  1S0D A;  5FUP A;  4C8D A;  1HDK A;  4NRQ A;  2DUP A;  1J3R A;  3WUD A;  1K5M A;  4IV1 C;  2JWP A;  5BUV A;  3GM8 A;  4EZ4 A;  5JCT A;  4ONU A;  2PAE A;  4JTN A;  5LEK A;  5JXJ A;  4HZF A;  2CAU A;  3VD9 A;  4YVS B;  3IAQ A;  4BXF A;  4I02 A;  1XPW A;  1Y4W A;  3RJ2 X;  5JXG A;  1RUH 1;  2Q4S A;  2XJR A;  2BP6 A;  5FY0 A;  5CG8 A;  3QCW A;  1L7R A;  2E7T A;  2XKO A;  3AMQ A;  4XDO A;  4A6S A;  4UI9 L;  5FYB A;  1PZ9 A;  3HJR A;  1CAX B;  2VVD A;  4LIU A;  1GFF 2;  4CU8 A;  1C28 A;  2W46 A;  4JHT A;  4LMF A;  5JAX A;  5HCH A;  5L7O C;  1LEC A;  1IKQ A;  1OVP A;  2R04 1;  3AKS A;  1W2T A;  1W2U A;  2Y6J A;  2HWC 3;  4Q4V 2;  5I0R A;  2B39 A;  1RVF 2;  5FYM A;  4QX2 A;  4YGB A;  1YXW A;  2CHH A;  2VD7 A;  1V6N A;  4GJY A;  2ZHN A;  5GZF A;  4FSJ A;  3O12 A;  4XIK A;  2VZT A;  1ZZ9 A;  3AXD A;  3MHZ A;  5FV3 A;  4JKM A;  5FPA A;  1APN A;  3O1R A;  1Y43 B;  3K48 A;  3E6B A;  3WP5 A;  1RUD 3;  1FV2 A;  2SLI A;  4YVS C;  1HN1 A;  2DU1 A;  3SH5 A;  3LKJ A;  4UFI A;  4CCO A;  1UF2 C;  5FKB A;  4A41 A;  3I2D A;  5CKQ A;  5ABJ A;  4GUL A;  3AM2 A;  2OUH A;  5JXI A;  4F83 A;  3VV1 A;  3LFI A;  1AHS A;  1WMX A;  2X5I B;  1O3R A;  5K8S A;  1W28 A;  1COV 2;  1RUI 3;  3VBU A;  3MO4 A;  3I2I A;  2PXJ A;  4QD2 A;  2RS1 2;  1XRU A;  2P3I A;  1DZQ A;  2D6K A;  2JDM A;  4Q0P A;  5LAS A;  1F15 A;  3OB8 A;  1C8M 3;  3DEC A;  1FMD 2;  1RUG 2;  4NII A;  1DQ6 A;  2E53 A;  3RI9 A;  1UOG A;  4IXL A;  1HW5 A;  4GKY A;  5K0U C;  3K51 A;  4NUB A;  2YHJ A;  3WXP A;  2NM1 A;  2Y8K A;  4JTO A;  2VZ1 A;  1GOH A;  1OLR A;  2VCM A;  1AYM 3;  1PIV 2;  3MLJ A;  4EWD A;  2X8K A;  2ZJC A;  1JYC A;  2B7Y A;  3VBR A;  3WEZ A;  5A6Z A;  1GWM A;  4URA A;  2W95 A;  4R9B A;  4GQ7 A;  3MV0 1;  3N7J A;  3C7F A;  5ANN A;  4EWE A;  2VZV A;  4HVO A;  2MEV 3;  3TYJ A;  4L97 A;  4Y24 A;  5LEJ A;  3MFC A;  5EFU A;  3UKN A;  2E7Q A;  3ZXK A;  1Q8S A;  4QPG B;  2W1S A;  1QJE A;  2VZP A;  4CSW A;  5J09 A;  3VBO A;  2NLR A;  3T30 A;  3J8F 3;  5K7P A;  3FE5 A;  3PUS A;  1D4M 1;  2GND A;  1X33 A;  3H42 B;  4P5H A;  1XU1 A;  1QF3 A;  2XQR A;  3Q8E A;  1JMU B;  2A5Z A;  3GGL A;  3R4S A;  4RHV 1;  3HT2 A;  4UFJ A;  2FDH A;  1D4M 3;  3LA2 A;  1ASJ 3;  4C1W A;  2A3Y A;  1CAU B;  1URX A;  2TNF A;  3CEW A;  1XSR A;  2VQA A;  3OOX A;  4J25 A;  4XQ4 A;  3O1O A;  1UMH A;  3GBW A;  2VOW A;  5EXO A;  5F2W A;  4CEW B;  2IXK A;  2WQZ C;  4IW3 A;  4F3J A;  1PVC 2;  3KM5 A;  3VZO A;  5LA0 A;  5C9A C;  1O5U A;  4JGY C;  4KG0 A;  2OQ7 A;  3EYP A;  1AR8 3;  1ND2 A;  3N9O A;  3USS A;  4AVC A;  2WNU B;  4OI0 A;  3ZSM A;  1PK6 A;  4IUG A;  1R09 2;  2PHW A;  2QZ2 A;  1IGO A;  1X82 A;  1I1E A;  1UX6 A;  1BK1 A;  3ES1 A;  4GXL A;  1YFY A;  5CFC C;  1W6O B;  1UOB A;  1BEV 1;  3QH7 A;  2EIB A;  3SKJ E;  3ZSJ A;  5JZG A;  2XOM A;  2BBV A;  2O14 A;  4LKS A;  5FP4 A;  3KF3 A;  5FZC A;  1XYP A;  1G8W A;  2GZW A;  3VBS B;  1MZE A;  1YNA A;  1KQR A;  1UMZ A;  1WD4 A;  3H9A A;  1RUC 3;  2B9U A;  4QU2 A;  2JG9 B;  4N53 C;  1XND A;  4LQR A;  3D3A A;  3O0V A;  4COW A;  5IUQ A;  2WNE A;  3AVR A;  5FK7 A;  2W92 A;  1AXY A;  2KD7 A;  2Y6H A;  3D0J A;  1QQP 3;  4HVR A;  1JH5 A;  1LED A;  2GC0 A;  2EXI A;  3WW3 A;  4XCB A;  2QQJ A;  4XZP A;  1VBC 3;  5A3P A;  3B5L B;  3D6E A;  3G6J B;  2P3K A;  2CDO A;  4MAD A;  1XU2 A;  2OS2 A;  1YYN A;  3I2J A;  5JPN B;  1X8E A;  2UU8 A;  2XVL A;  2D3S A;  4CUA A;  4EWA A;  4PDW A;  3MPB A;  1UXZ A;  4LA3 A;  4XBL A;  3J7M A;  1AJO A;  1W8O A;  2Z79 A;  3CNA A;  4W4Z A;  3GJB A;  4RHV 3;  3VHN A;  3ZXD A;  3BTZ A;  3MIB A;  3KZ4 C;  4JKL A;  5FLH A;  5IWF A;  5CAZ A;  4AQ2 A;  4AYU A;  4Q4X 2;  1VBA 3;  2QQU A;  1SMV A;  4B8E A;  3FHA A;  4OHZ A;  3ACI A;  4JGZ B;  1VBB 3;  4QB1 A;  4MET A;  4NOT A;  5A80 A;  4ES9 A;  5JR2 A;  1NUK A;  4MGK E;  2XJQ A;  4XFI A;  1WLD A;  1RUC 2;  4AI1 A;  1JXN A;  2VZS A;  4R4Z A;  4BOW A;  4XUR A;  2ZGQ A;  3CBN A;  4FBF A;  2XVG A;  5LA2 A;  3BTY A;  3GCX A;  3A0N A;  2VEC A;  2VU9 A;  4CCK A;  4EN6 B;  3O0X A;  4QM9 A;  4COY A;  1ENQ A;  4FPK A;  5DZE A;  5FOJ B;  1BEV 2;  1QJZ A;  3HNM A;  3KS7 A;  2LM3 A;  3AMH A;  3GNE A;  5FZ8 A;  1AZD A;  3EMR A;  5GLU A;  3ZYG A;  1AR8 2;  3OYW A;  4OUL A;  4UF0 A;  2F6B A;  4X8N A;  3Q8F A;  4ATE A;  4CEY B;  2FDG A;  1PVC 3;  2EIE A;  3HNB M;  3WQ7 A;  5F39 A;  4BMB A;  1RUF 3;  5AFE A;  1VB4 A;  1XNA A;  4ISQ A;  3KB5 A;  5I0U A;  4YFW A; 
#chains in the Genus database with same CATH homology
 3UYJ A;  4CCJ A;  5F37 A;  4BIS A;  5A3T A;  2YBP A;  5IVV A;  5ISL A;  2WWU A;  4HOO A;  4QXC A;  2XXZ A;  3ZLI A;  2YPD A;  5KR7 A;  1VRB A;  5F5C A;  5F5A A;  3PUQ A;  4CCM A;  3KV6 A;  3N9P A;  5IVF A;  5IVB A;  4CSW A;  5FYT A;  3PU8 A;  5F32 A;  4Y3O A;  3PUS A;  3PDQ A;  2YU1 A;  4DIQ A;  5A7S A;  5IW0 A;  2W2I A;  5FJK A;  2XUE A;  5A7W B;  5FZG A;  5FUP A;  4C8D A;  2OT7 A;  3KVB A;  4QXB A;  5FYI A;  4CCN A;  5F3C A;  5FZ9 A;  5F2W A;  5FY1 A;  5LY2 A;  4CCL A;  4EZ4 A;  3LDB A;  4DO0 A;  5FXZ A;  3N9N A;  5FWJ A;  2OQ6 A;  5F3E A;  5FBJ A;  5FYC A;  2Q8D A;  5FYH A;  2OQ7 A;  3N9O A;  5FP3 A;  5FPV A;  5FYZ A;  5FZ3 A;  5A7W A;  4BXF A;  2XDV A;  5FZO B;  3PU3 A;  5FZ1 A;  3ZPO A;  3KV9 A;  4LXL A;  3K2O A;  5FY0 A;  5A7Q A;  2YBK A;  5FXV A;  2YU2 A;  5FY7 A;  4XDO A;  4CUG A;  3N9M A;  4AAP A;  5FPL A;  5FP4 A;  5FYB A;  5FZC A;  4LIU A;  5FP8 A;  5FZF A;  5A3W A;  4XDP A;  4UF0 B;  3K3N A;  2GP5 A;  3OPT A;  5IVY A;  5FWE A;  4IGQ A;  5F5I A;  2OX0 A;  5FY5 A;  3U78 A;  5A7O A;  3AVR A;  3KVA A;  2GP3 A;  5K4L A;  5FYM A;  5F3I A;  5FZO A;  3KV5 A;  2VD7 A;  4IGP A;  2P5B A;  5FUN A;  5FZ4 A;  4GJY A;  3RVH A;  4GJZ A;  5A1F A;  5FZ0 A;  5A3P A;  3DXT A;  3DXU A;  4LIT A;  4GAZ A;  5F3G A;  5FPU A;  4EYU A;  5FV3 A;  3KV4 A;  5A1L A;  2OS2 A;  3AL6 A;  5F2S A;  5FPA A;  5A7N A;  4QU1 A;  5FPB A;  5FY4 A;  5FYV A;  5FYU A;  4EZH A;  5LWB A;  5A7P A;  4CCO A;  4D6R A;  4Y33 A;  4E4H A;  5FZE A;  5FZI A;  3NJY A;  5A3N A;  5IWF A;  3U4S A;  3K3O A;  5CEH A;  2XML A;  5FZH A;  5IVJ A;  3PUA A;  3N9Q A;  5FP9 A;  5FY8 A;  5FJH A;  5IVE A;  3N9L A;  4V2W A;  3OPW A;  4Y4R A;  5FZK A;  2Q8C A;  4LIV A;  4HON A;  5FZM A;  4D6Q A;  5A80 A;  5FZ6 A;  5FP7 A;  2PXJ A;  5FY9 A;  4QX8 A;  5IVC A;  4QXH A;  4GD4 A;  5FYS A;  5ANQ A;  4ASK A;  3LD8 A;  4CCK A;  2YBS A;  2Q8E A;  5FZA A;  3AL5 A;  3PUR A;  4QX7 A;  5LW9 A;  3PTR B;  4NUB A;  5FZD A;  5FZB A;  5FZ8 A;  2WWJ A;  5FZL A;  4QWN A;  4V2V A;  4UF0 A;  5FXX A;  3AVS A;  5E6H A;  4BU2 A;  5LY1 A;  4D6S A;  4AI9 A;  5F39 A;  5FXW A;  5FZ7 A;  4URA A;  4TN7 A;  4IGO A;  5FYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...