2GP5A

Crystal structure of catalytic core domain of jmjd2a complexed with alpha-ketoglutarate
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
347
structure length
347
Chain Sequence
ASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into histone demethylation by JMJD2 family members
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Jumonji domain-containing protein 2A
total genus 100
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2gp5A01
2PXJA 4IGPA 4DO0A 5FJKA 5ANQA 2P5BA 5FXZA 5FPUA 3KVBA 4UF0B 5LY1A 5FJHA 5FZOB 5CEHA 5FYVA 3ZPOA 5FWJA 4QX7A 5F5CA 5F2WA 5FPAA 4CCMA 3N9LA 3K3NA 5FP3A 3AVRA 5F32A 5A1LA 4D6QA 5FYTA 5FZBA 2YBKA 4EZ4A 5FYCA 5FZAA 4BXFA 4IGQA 5A3NA 4CCLA 5ISLA 3N9NA 5KR7A 4URAA 5FP4A 2Q8DA 5FZ9A 5FP7A 2YU1A 3LDBA 4CCNA 4LXLA 5A7SA 5IVYA 5LY2A 3AL6A 4XDPA 4AAPA 4ASKA 5FPLA 5A7WA 3K2OA 2XUEA 4E4HA 5FZ8A 5LWBA 3PDQA 3ZLIA 2OX0A 3NJYA 5FUNA 3UYJA 4UF0A 4HOOA 5FY4A 3DXUA 3N9PA 3KV6A 5F5AA 5FY8A 5FYSA 5A7OA 5A3PA 5FZEA 4CCJA 3N9MA 5IVEA 3N9OA 5FUPA 4BISA 3PTRB 4GJYA 5F3GA 5FXXA 4TN7A 5FY9A 5FZ1A 5IWFA 4LIVA 5FP9A 4EZHA 5FY7A 4C8DA 5A7WB 4DIQA 2YBPA 2YU2A 3LD8A 5FYIA 5IW0A 4EYUA 2OT7A 3PURA 2XDVA 5FZ7A 5IVJA 2WWJA 2GP3A 3AVSA 5F2SA 5FZGA 5FXWA 4QWNA 5FYZA 5FY0A 5A7NA 5FY5A 4LITA 5F3EA 5FV3A 2W2IA 3U4SA 3OPWA 4XDOA 4QX8A 3PU3A 5F39A 3KV9A 4CCKA 4QXBA 4QXCA 4D6RA 3OPTA 4HONA 5FZCA 5FZHA 5FBJA 5FYYA 4GAZA 3KV4A 4GJZA 5FZOA 2VD7A 1VRBA 5FWEA 4LIUA 5A3WA 5FZLA 3PUQA 4GD4A 5FZ0A 3U78A 4Y3OA 5A7QA 5FP8A 5F5IA 4D6SA 5FXVA 5FYMA 2Q8CA 5IVVA 5FZ6A 5FZKA 5FZFA 3N9QA 5FYBA 5FZIA 2WWUA 4AI9A 2XXZA 5F3CA 3KVAA 2GP5A 4V2WA 4IGOA 3K3OA 5A7PA 5A1FA 5FZDA 5IVBA 5FZ4A 5FYHA 4CCOA 2XMLA 4V2VA 4BU2A 5FPBA 5FY1A 3PUAA 3AL5A 5FZMA 2Q8EA 5FPVA 3RVHA 3KV5A 4Y33A 3PU8A 4QXHA 5FYUA 2OQ7A 4NUBA 5FZ3A 5IVCA 5LW9A 2YBSA 4QU1A 5A3TA 2OS2A 3DXTA 4CUGA 5IVFA 4Y4RA 5E6HA 4CSWA 5F3IA 2YPDA 5F37A 5K4LA 2OQ6A 5A80A 3PUSA
chains in the Genus database with same CATH superfamily
1AX0A 1J84A 1P8JA 3ELNA 2VY0A 4M3CF 1QGLA 1RVF1 1QJY1 5FYVA 4U2AA 3EJKA 3O14A 2KD7A 1GNYA 4MGSA 4Z1VA 1DP0A 5DQ0A 5DDJ2 3NNMA 1UIJA 1D7PM 1W8FA 3HNMA 4IEVA 4NPRA 4MV2A 4K20A 3MZHA 1PVC2 2EALA 3D0JA 3LIHA 5CIRA 1ND2C 4FPKA 3VBFA 1DZTA 3MEPA 4LLFA 5GALA 4FSJA 3WQ7A 3AL6A 1ALYA 3KHCA 3WW1A 3LEIA 1LECA 3AMHA 4TYSA 4COWA 3SEPA 2D3SA 4CDXC 3VHRA 2JIGA 5FAXA 5FUNA 2I07B 3N3HA 1NY72 3DF0A 3GJBA 3B5LB 4I3GA 4B1MA 5FMDA 1W2UA 5GLZA 4JAAA 4PIYA 1UY1A 5A7OA 2I74A 3ROUA 3SMHA 4P14A 2VW2A 2Y33A 1HDKA 3N9OA 1MS3A 2B42B 3SCFA 4CPBD 5A3UA 2QQNA 2BNOA 1Y3TA 3MW4A 1GSLA 1QDCA 4GWJA 5FY9A 3KT7A 2JDPA 1FPN3 1YQ2A 1VRH2 2OXBA 2P2KA 4O7XA 3CU7A 4XFAA 3BU7A 2A6ZA 4C8DA 2BNNA 3INAA 3B94A 2DFBA 5FPZA 5GLUA 3BTZA 1U5ZA 4XFFA 2GH2A 5GJ6A 1HQNA 1W0NA 2A3YA 3VKOA 4MADA 3O7OA 5IVJA 3AVSA 1VBC2 4LHSA 1YIFA 5FYZA 1S0IA 3SKVA 3JXSA 2W9XA 3A7QA 3MIFA 5IVBA 4FPHA 1A3KA 3PU3A 4W6XA 2CSGA 3KV9A 3J9SA 4CCKA 1IG0A 4QXBA 2ZEZA 3CIHA 4HVQA 4QPIB 4D94A 4QQ2A 3VBHC 3DKWA 3POGA 2VVEA 2E63A 2IXCA 3ZFEA 4AVCA 1K42A 5JSRA 1JOJA 2IXKA 2PA7A 2V5YA 4LJHA 5FO8B 3ECQA 4HBNA 4QB1A 1HRV2 1K3IA 1LU1A 5FZIA 5JIUA 2LS6A 2X10A 1VPHA 4PBPA 4R9AA 3JCIA 4I0AA 1RINA 4IEPA 4LKEA 1CAUB 1Y4WA 2XMLA 1WCKA 1X36A 3H50A 1RVF3 3VLBB 4RL7A 2NMNA 4G9SB 4UAPA 1X8MA 2AEYA 2W87A 4XQDA 2GAUA 1C1LA 2VUDA 3WW4A 1LTEA 3I2DA 2GH8A 2GNMA 3Q8FA 4B7EA 1LOFA 4IE7A 4PDWA 3WF3A 4FFHA 2QZ2A 3VZLA 1KRIA 4GA9A 4WM8A 1QJY2 3VKMA 3J8F1 5C7GA 1VBD1 2XBO3 2WNOA 3O0WA 1ZRIA 2W1UA 5BUVA 1LESA 1UU6A 2BNMA 2ADDA 3VDDC 3FZ3A 4P9LA 1N1TA 4P5HA 3AZVA 1I3HA 2BVVA 3OUHA 3OG2A 2G9GA 4CDQC 1QOSA 1R081 2TUNA 4AL9A 4JDOA 2ARAA 1NG0A 1X50A 1BBT2 2VVDA 4FTEA 3I2FA 1FAYA 5BNOB 1UO9A 5F7UA 4E2QA 2QQMA 1YYNA 4EWEA 2DUPA 3IT8A 3C7OA 1GYKA 3RQ0A 4MYEA 1HXS1 3MF9A 2FHRA 2VQUA 4WVMA 4Y20B 2WA3A 4UBGA 2IZWA 3P3PA 4LBQB 4META 1H1MA 3MYXA 2GC2A 2JB8A 1XB9A 2DVAA 4P5YA 2YG0A 5JUVA 4S2FA 2YGLA 4IE5A 2XKOA 3DL3A 4JCKA 5K0UA 4URTA 3RZGA 1JYIA 1Q8OA 3J4UH 1RUJ2 4CPBA 2OIIA 3IPVB 1WLTA 4XTPA 1I6XA 1UYPA 4Q8LA 4E8CA 5EPAA 3GALA 4LBQD 5CB7A 2YHJA 1SBDA 3N36A 4NRPA 4LO4B 4JKLA 3ZN6B 1JZ8A 2OUJA 3CNAA 4IV1B 2GN7A 4HMZA 5B4XA 5K7PA 1W2TA 1N1SA 1WLCA 4S2DA 1UKGA 4IE6A 1C5HA 1WCDJ 4TXWA 4E4SA 2WA4A 1G7YA 2VPVA 3ON7A 3BTAA 4AYUA 2PHFA 4H55A 3I2HA 4YW7A 1BEV1 2AEZA 3PNAA 4M0NA 4M3CA 5FXWA 1QXRA 1ZRCA 4N53A 1REEA 4BPZA 5F5QA 3HQUA 5A3OA 3RYKA 3TNPB 4B4QA 5CFDC 4OUEA 5LZ6A 2W2IA 2VXJA 3NJVA 3D5OA 3TN93 4XFGA 4HPKA 3NO8A 1GV9A 1SPPA 1EV13 3FX3A 4XHBA 1TEIA 4JVAA 4CTEA 5CKQA 4LO8A 1PK6B 4LO6B 5JVVA 5CISA 3ZFGB 3OSDA 1HRI1 1VBE3 3EHKA 3T30A 2VAUA 1PGL2 4CDQA 2D44A 5FZFA 1I5PA 1US3A 2XXZA 3H7YA 5H9PA 4XTMA 3PIJA 2QQWA 3THDA 2P1BA 3OGGA 4HK8A 4Q4V3 4XFBA 4PIZA 5FYHA 4Z2WA 3BOWA 5CA6A 1NA1C 3P6BA 5D1IA 1D4M3 2KXLA 5CG8A 5FPXA 3DPRA 5DMYA 1DQ5A 4AHWA 4MHUA 4Q4Y2 1RIRA 1WUVA 1GQGA 2VCAA 2WDBA 4Y33A 5CZKA 1OF3A 4L11A 4KBBA 2HWC3 5AVPA 4CRQA 5F1RA 2PHRA 3HQRA 5J36A 5CBLA 3LOBA 2C1FA 2HWD3 1RUJ1 2WO7A 4I0BA 4TLGA 1OXCA 5DZGA 1W3XA 1T6BX 1ND2B 2YPDA 5LK5A 1ZVFA 4IEYA 4JC1A 1OURA 3QH6A 1LOCA 1AYN1 1SCSA 1GOGA 1GNZA 4UF0B 3ZYFA 1RJ7A 1ULGA 3BOPA 2BBVA 3DECA 2IXLA 1LHWA 4N90A 3Q9OA 1H6YA 1S0BA 3LA3A 4COUA 2ILMA 1QJU2 3IDEA 3K77A 2IVIB 1BBT3 1CGPA 1IGOA 2W39A 3ES4A 3KCCA 3P5BA 2J1TA 2ENRA 3POEA 4CP9B 3VB9A 4Q1RA 2R32A 4KQ7A 1JODA 1RUH2 4AEKA 2GC3A 3V0AA 2CGNA 2TEPA 2VULA 3DYMA 1X9TA 5IVYA 5CKNA 1RUF2 2B5HA 3SQOA 4BK5A 3FMGA 3FE5A 1ZYBA 2W1SA 2NZ9A 2N7GA 3LFIA 2F4PA 5FZ8A 1PHMA 1OT5A 1R083 5ANNA 1FOD1 4NRQA 1POV3 1TMF1 2RDNA 2Y0OA 2VBDA 3KMHA 2ZX4A 4D69A 1C3HA 2X5IC 2ZBJA 4LOSA 1OOPB 1RUJ3 3HT2A 4HKWA 5FYSA 5ACA3 1OA3A 2WFF1 3MUZ1 1JZ4A 1DYOA 5CG9A 3IKWA 1CAXA 2BEOA 3CZJA 3N9MA 1JTZX 4ATFA 3V64A 3MLJA 1OF4A 1RL3A 2VMHA 2WZEA 2Z5WA 4RFT0 1W2NA 3OOXA 2Y26A 3DN7A 3T4HB 2ZEYA 3SXWA 3T1MA 2Y6HA 5FY7A 4MXWB 3WD5A 2DFCA 2VCMA 1UZVA 4XCAA 1CAVA 1ASJ1 3I2OA 4ZKTB 4P9XA 4HETA 5IW0A 1GZWB 3I59A 4RS5C 1MEC3 3PURA 4XDQA 4Y22B 4EYUA 1L3JA 4QKNA 1OH3A 4ZHNA 1GUIA 2JG8A 2KM2A 4LT5A 1PO23 4Y1XA 1B35B 3T2QA 3KHBA 1NKGA 4RSUA 4OI0A 2CWSA 3AM2A 4IV3C 1SLCA 3OPWA 4UWDA 5F39A 1FV2A 1POV0 2GZWA 4QXCA 1SBEA 4AK3A 2RS33 3T0DA 3IZOA 5C9AB 4XJWA 4XXAA 5DZEA 2O14A 3TAYA 5C71A 3IMMA 2JDHA 1RITA 4HXCA 4LIUA 2HJIA 5JR2A 2GDFA 3ZYPA 4HANA 5AFEA 3WDUA 2DYCA 3AP4A 3AX4A 3I7DA 5FZ6A 2HYKA 4FPEA 4AGVA 4A6SA 1S0EA 2R7EB 2GP5A 1YQCA 2DVBA 5I0TA 1US2A 4ZS2A 5FZ4A 1FT9A 2C4XA 3GZAA 4HG6B 3PMSA 2QQVA 5T54A 1H6XA 3LQCA 1UY2A 2VUCA 1AZDA 2C6SA 1H8TA 1ZM1A 2Y6LA 2YFUA 1H1AA 3E5XA 5CVRA 3ACHA 3ZXGA 5FPVA 4CCCA 4WBBA 4NIIA 3V0AB 2E7QA 4Y1UA 1CAWB 4XJAA 3B9CA 1MZEA 3WDTA 2R30A 1MQTC 5JXJA 1BBT1 4OQ8A 5D8AC 4P9JA 2W1QA 3MICA 2WNVB 2RS51 5T50A 4LE3A 1CVNA 1W28A 5T5OA 4F83A 5CFCB 2C5DA 3ZR6A 2OA2A 5BV6A 4MGKE 4DO0A 2D5FA 3WQBA 1OKQA 3J7HA 3PMEA 5C3QA 3O1TA 2VCBA 5FJHA 1VR3A 4QQOA 5FZOB 4AR2A 3MPBA 1W6OB 2UYBA 2UY8A 3GGLA 4F8AA 3TNQA 5A1LA 1RUH1 3I54A 4P9GA 3O1UA 3H3UA 2VBPA 2FQPA 4EZ4A 2ZKNA 1PZ9A 4OZOA 4PF5A 1W2OA 4K21A 2CU5A 3KF5A 1C28A 5A1AA 2EIDA 5FZ9A 3UL2A 1IS6A 4NIHA 3POBA 1HKDA 3AZWA 2WZPP 2VZTA 2Z2SB 4LXLA 4NIGA 4OUSA 1KJLA 4PBOA 1W6QA 1ZZ6A 4IE4A 4E9KA 1QOOA 3AB0A 1AR73 3QCWA 2A71A 1UXXX 1QKQA 1N3PA 1VAVA 2RS13 3VBSC 3IDAA 4JV4A 4BDVB 2DURA 1WZXA 4CUCA 2VG9A 2Y6KA 3IB3A 3KV6A 4WVVA 5FY8A 1TME3 3VBHA 3BALA 5FZEA 2WN3A 1CIWA 2HWE2 5CFDB 4QKDA 5KHIA 2PYTA 5BYNA 2ZMLA 3I2GA 3PIGA 1NY71 1AUYA 1Q8PA 5FZ1A 4NIDA 4LHLA 1JZ3A 4HVRA 2XWBB 1XSRA 4AFMA 2FMYA 2D6KA 3VHPA 2YU2A 1GU3A 2P6CA 1RJ8A 3HR9A 4FFFA 4KU7A 3ZFGC 4AGRA 1BEV3 1LR5A 1AR93 4XHXA 4A6OA 5FZ7A 3MV11 4JGYA 2QQJA 4QGNA 1W9FA 5I93A 2XJPA 5F8PA 4KI5M 1SLIA 4XBLA 2H6CA 1UW8A 5FIXA 1SMVA 1HQWA 1SQ4A 4DXSA 1F4HA 4LKDA 4ZZ8A 1LGBA 5ABJA 1JYTA 3VBUC 3ZFFA 3HAGA 3FJSA 3HOBA 4X6QB 1IS5A 2WWSA 4H14A 4YRDA 3W9AA 3ZFGA 2RR13 5L73A 4PLOA 3NNLA 3WDYA 1QJX1 1HRV3 5BNNA 4HFSA 5FOBB 1PK6A 3ZYRA 2WQZC 1HB1A 1OLMA 3ZYBA 1ZA4A 2ZPXA 3PUQA 1H4HA 2JDZA 2YY1A 4QPWA 1RHI3 4CDWB 2G9FA 3ZSLA 4D3WA 5AC92 2WT1A 3H7JA 2O0OA 3RWKX 2Q8CA 4LO7A 4PQ9A 3BODA 2ET1A 1J1LA 4GWIA 4DB5A 1UZWA 1O4YA 4FPFA 5FYBA 1WW5A 3U10A 2JKXA 2F17A 5L9VA 4BLJA 3RGBA 5BXXA 5A1FA 4CU6A 3W5MA 4W6YA 2E7AA 3WCSA 2ZHKA 5FREA 3ST7A 1AR62 1UOJA 3H8XA 1TMF2 5FOJB 2ZAHA 3PUAA 5JXIA 3SCHA 3OEBA 4DY5A 3CJXA 5T52A 1QHDA 1W3VA 1TNRA 4JGZB 4KMQA 3KV5A 5AVAA 1AL0G 2RR12 4YW2A 3VZJA 1MZ6A 4A7YA 1ZZ8A 4CP0A 4CVUA 2XVKA 3NNGA 5EQUA 3F2ZA 3TB0A 3L9JT 1W2AX 2E6VA 4DNYA 1WBFA 4JQTA 2R062 1W8OA 2XOMA 1YNAA 2ZZQA 4MSVA 4AQSA 5C33A 2RS31 2JWPA 2PXJA 3WF2A 4IGPA 3O0XA 2ZGQA 3WG2A 3U37A 2WC2A 4LBKA 5FPUA 4BCUA 5J7MA 5K0UB 4XAEA 4NHKA 2MNGA 1DCSA 2JG9A 1GZWA 4I0WB 3U0ZA 3WV6A 3WCRA 5I0DA 1QWRA 1DG6A 1PM7A 3SHRA 4AFDA 1EY2A 5E8AA 3AMMA 4BJ0A 1GZCA 2RMU1 3FLPA 2PHXA 3T4VA 5A3NA 3IAQA 4C1XA 1TME1 5EJZB 5JLVA 4URAA 2WZR3 1JZ2A 2OPWA 2E33A 2JG9C 4D0QA 2FZ2A 2QQUA 4WM7B 2H6BA 2PELA 2PHWA 3LA2A 1MQTA 1N1YA 1ULFA 3NW4A 1VBB3 3KSCA 2QQLA 4JTOA 1AR71 4R9BA 5FQ0A 1L7RA 2Z69A 5FMCA 1O3TA 2UWAA 3VDBA 2VNOA 2OX0A 4AXOA 3RDIA 3D4KA 1RUH3 2QUOA 4RS5B 1WW6A 3I59B 4Y22A 4Q26A 4ZPIA 3RYRA 4YGCA 1RVF2 1PMIA 3VKNA 2WO1A 1Z0HA 3NMBA 1N3OA 4KU8A 3ZXDA 4CCJA 1LENA 1U12A 1O91A 2JX9A 4IESA 4Y1VA 5IVEA 1ZX5A 2C0ZA 3IAPA 1TG7A 1QJEA 2UY9A 3ZKUA 5FXXA 3WDWA 4Q0PA 5IWFA 5F6LB 5B2GB 4LIVA 3ZXJA 1QJY3 1S0CA 4OUMA 2ETEA 1F5FA 3FLRA 4X8NA 3UKVA 1VBB2 4QX1A 2E32A 1NE6A 2TNFA 3I2JA 3GHNA 5EIYB 2OT7A 4MGZE 3VDDA 1LB2A 3VZMA 3W21A 2OZJA 4K3UA 3UESA 3HWJA 3J7MA 4JRLA 2Q4SA 1WLDA 4CUBA 3RZKA 1VP6A 2K46A 3EYPA 4CU9A 2HYXA 5A3LA 4E2SA 1HXS3 1ENRA 4XDOA 2QTWB 5FR3A 2A3XA 2A1XA 4EN0A 3FWEA 5JSPA 3UKTA 4D6RA 4GWMA 4PI0A 4DPNA 4AEDB 3N7KA 4GAZA 4IXLA 1UAIA 1VRBA 5A3WA 2VL4A 3U14A 4INDA 2Q30A 3FUOA 4GD4A 4BYYA 2XHNA 3LFMA 3DPRB 2RM23 4NROA 4QXKA 2UURA 2EVXA 2D43A 2HWC1 4RR3B 5GKAC 2VMDA 4AQ2A 2DTYA 5FZKA 4AI9A 3N9QA 4XZPA 1BK0A 4YG6A 1O8SA 2BERA 4B7KA 2GNBA 4LR4A 4AHXA 5JI7A 5CFCC 1QXJA 1YO8A 3ASIA 4RN5A 2B4KA 3CLPA 2XJVA 5FY1A 4Y5TA 2W3JA 1CZVA 1OLQA 1QXPA 1C5IA 1YFYA 4LORA 4YG0A 1QNWA 4GZ9A 5E16A 5GZFA 3WF1A 1WA4A 2EF6A 4BQYA 4XF9A 1CX1A 2ID4A 3BVCA 4SBVA 3VBUA 3ZFFC 1H0BA 1ZBE3 2WYFA 3HT1A 3OD4A 5KHKA 4YM2A 3VBFC 1JI6A 1OD3A 1PK6C 4O9GA 1QH6A 4NE9A 3ZIWA 1JN2P 2XVLA 4EN9B 1KITA 3IMNA 4KL1A 4R4ZA 4DEQA 2RDQA 2VQTA 1IHMA 3C7HA 1KS4A 2RHPA 2EXHA 3PTYA 5ANQA 3WHTA 4GH4A 4QKFA 3DUIA 3B02A 3MW3A 1D2SA 3M1HA 5KC5A 3N9LA 4AHYA 1O59A 1OQDA 5F32A 1MS5A 2P6HA 1CJPA 2NN8A 4CP2A 4XUQA 4HLTA 2WNUA 3ZDVA 1FI2A 4O65A 1XNKA 3MIBA 1Q3EA 4P00B 1CAWA 1C8M1 3D8CA 4XF3A 5CFDA 1E5SA 3I3BA 3TEXA 4OULA 2BJSA 1OLME 2Q8DA 3VZOA 4CZSA 3LSDA 1VBE2 4QDSA 3ME2A 3USSA 4YVWC 4M4PA 3USUA 2ES3A 4XEZA 4ONUA 1O5LA 4AI2A 4RFRB 5LWBA 3NV4A 1ULPA 5HV4A 4CUAA 1H8TC 4CU8A 4CEWC 1RMU3 3ZXLA 5JCTA 1RUE2 5IK4A 2BGOA 4HOOA 3WNOA 3ZO0B 3DXUA 5K9YA 3FC0A 3T2OA 3N9PA 2Y6FA 3MDPA 3AC0A 1F2NA 2C9AA 4EROA 3OGJA 1ZZ7A 1V6JA 4IV1A 1YC61 1HQLA 3OJBA 1SFYA 4BLIA 5C9AA 4XUPA 1VBB1 1EP0A 2BFUS 2RS12 3ZVXA 1HN1A 3OUIA 4GXLA 2AENA 1JS9A 4QM8A 3UKNA 1BMV1 1ULOA 3ZMOA 2HEVF 2QFEA 4Y4YA 4Q4X2 4RD7A 2D40A 1SLTA 4KH9A 4HT1T 2YGMA 5IK5A 2BQPA 1ZZCA 1NXMA 2HKXA 2R061 1COV1 1JYVA 1ONAA 2RG4A 1PIV1 2GP3A 2MHFA 3K75B 4FO9A 1RMU2 3IIAA 5LA9A 4AWDA 3SC7X 1IZ3A 5DUVA 1EUUA 3U4SA 4Y20A 4XABA 1CPNA 2X5IB 2MEV2 1EAH1 5IT6A 4XURA 2DCKA 1XNAA 4M4RA 3CHXA 1O3SA 4QX0A 2VGDA 1POQA 4ZXEA 2PHUA 3KQ4B 3NSTA 3WP5A 4JGZA 2PQSA 4AQTA 3EB7A 4Y3OA 1O8PA 1LOFC 5A3MA 2J42A 4FOVA 1SLBA 3A4UA 4MGYE 2F6BA 1VE0A 2FCTA 4GKYA 5FYMA 5C70A 5IK8A 4DINB 2DCJA 1AYM1 1QOTA 1U0AA 4RQPC 4J1XA 4A44A 4DXZA 4HSLA 5J1XA 2V5DA 3WNXA 2XWJB 4PDWC 3U11A 4TWTA 4XVHA 2P37A 3S5QA 1O3QA 1XU2A 5FPBA 4OI2A 4ES8A 4BZ4A 1NLSA 5FZMA 2XR4A 4LUMA 3GCWA 4UBHA 4OVEA 2XL7A 2Y0IA 4BQXA 4FBFA 3NVCA 1UNBA 2SBAA 5LW9A 4COVA 2ZGSA 3S7IA 1GZTA 1RUNA 1RUOA 4YZ2A 4Z92B 1UD1A 5A3TA 2OS2A 4OHZA 3AK0A 2VVFA 2FDFA 2WSUA 2VUJA 4Z07A 4CDWA 3NWKA 4S2GA 4XUOA 3V56A 5JOXA 4CSWA 2WLPA 4O9EA 4C0BA 2MPFA 4ZU7A 4RQPA 3K51A 1D2QA 1CONA 1XE8A 1OFNA 1UOBA 4EN8B 1W04A 2R1BA 2P5BA 3JBG3 2A7AA 2VR4A 1VALA 1BMV2 4CCMA 5FPAA 3UNPA 1S0FA 1LKNA 1VBC1 3AXEA 5BNNC 2P34A 5GZEA 5L19A 2XJRA 4LUKA 1QJZA 5FYCA 2YXSA 3ZFEB 1QIQA 2Z42A 3RJRA 3QH7A 3HD8B 5ISLA 4FQ4A 2Y60A 2YUEA 4Q1PA 1V6IA 3UV9A 2X5IA 2K0GA 4XILA 3A22A 2HLEA 1A8DA 1HLCA 4NRMA 3JQXA 3K2OA 2XUEA 1Y9GA 2D98A 3BB6A 5I0RA 4HKOA 5C8CB 3NJYA 4L9BA 1UIKA 3WHUA 4UF0A 3MHZA 4B8EA 3LSEA 1HJFA 2JENA 1QQP2 1JUHA 1ZBA3 2O8QA 3VBOB 3WNKA 1X33A 4CEWA 3JU9A 2X05A 2ZABA 5A70A 5ABJB 3AZXA 3IDBB 4WVWA 4YSFA 1UXZA 3DYOA 4XFHA 4GH4B 3HN3A 4OQ9A 3TEYA 1CN1A 4N43B 3WF0A 4CCDA 3PL0A 2AZ5A 1CPMA 3G6JB 3RSJA 3NV2A 2ZX2A 4A41A 2VMCA 1AF9A 1WLWA 2W95A 4LNVA 2YBPA 5FYIA 1OVSA 1UU5A 3UJOA 4DIQA 4WV8A 4FPLA 1M06G 4ASLA 1ASJ3 3DPRC 5JMOA 2XDVA 4YVWA 4Q0SA 4CEYC 4COYA 4PHZA 5JXHA 1H2KA 5FZGA 1CZSA 5FY0A 5I8SA 5L7OA 2XL9A 2XJQA 3T0BA 1S1AA 1NX9A 2JDAA 2UWBA 4GIQA 4DQAA 4NN0A 4XPVA 5L7OC 3OUJA 2BGCA 3USUB 3A0NA 5HXVA 2DVGA 2HEYF 2XB6C 3WG3A 3B01A 3ZPYA 2CV6A 1K5JA 1LCLA 5FZCA 5A6QA 4RHV2 2MEV3 3I4IA 4TLFA 4XF0A 1J59A 3H0OA 3P3NA 2RJKA 2G1MA 4IERA 3JQWA 4FAGA 1BKZA 3U78A 3E6BA 3IPVA 2O8OA 4QHBA 3KT1A 4IDZA 1GKBA 2ZGLA 3FLTA 4D6SA 2XLGA 1H2NA 1LEDA 2WWUA 3E6DA 4UOJA 5JI9A 3KVAA 2P3YA 1ST8A 2ZOEB 3AKRA 4I02A 3KGLA 2RVAA 3T2PA 4QHOA 2IXIA 4HN0A 4CCOA 3EO6A 4NWWA 3AYEA 4QKBA 4WVMB 2BGPA 1E5HA 2XUMA 2D93A 5J98B 3WP4A 4JQRA 1G9AA 3GBGA 2R063 3ZXAC 1QNYA 2JD4A 4C91A 2ZHNA 4XETA 2E9QA 3VBUB 4XQ4A 4BXSV 3M3CA 1UCXA 3GZTB 5D8AA 3VD7A 4XBQA 3OB8A 1A8MA 4JZRA 4AI1A 1RUG2 4N9HA 2HBUA 1KXGA 4QX5A 4QX3A 4CDXB 2QZ3A 3VKFC 2ZEXA 5F3IA 1YEWA 2DCZA 5F37A 5K4LA 1JHJA 4RR3A 3OGVA 5A80A 3VD3A 4LHKA 3PUSA 4BH9A 1GANA 2RDSA 3AKPA 1GZ9A 3HBKA 3JBG1 5KXCA 2CDOA 3B7MA 4IE0A 2W08A 1XSQA 1VBC3 1RUI2 1JH5A 1JUIA 1QJFA 1V6LA 2W1WA 3ZIXA 2D3PA 4MOAA 4SLIA 1RMU1 4XMAA 2XPJA 4DUVA 3R0RA 1VBA3 3MIDA 4YLZA 4LBQA 4YVSA 1WMEA 2HH9A 1AXYA 5T5PA 3AFGA 3RMYA 3VUOA 4YVSC 2HWD1 1CD3G 3I3EA 1UKRA 1UF2C 4W8JA 5FP7A 1OUXA 1DZQA 2GMEA 3FHQA 5FQ0B 4BQ2A 1WCQA 5LY2A 1RUD1 2ARXA 3I49A 4HZFA 1PZ8A 1DHKB 2BW8A 5T3NA 4YW6A 1EV11 3S5AA 1W9YA 1ZNPA 2BU9A 3OD0A 2R0HA 3S7EA 3OY8B 4WM8C 4LMFA 2PAEA 4H2AA 2AR6A 3BPZA 5TSWA 5JZGB 2JDKA 2BUKA 4I3PA 1ULDA 3ATGA 2V4VA 4BB3A 2DUOA 1QMJA 4AFCA 1GR3A 2YYOA 1LU2A 5K0UC 2JECA 5A33B 3RFRA 1W8NA 2P3JA 3BI3A 3WZ1A 2D6LX 1UPIA 2XVGA 5FUPA 3THTA 4CDUB 5F3GA 4ET7A 1EAH3 3J8F2 2L9LA 2AGSA 3E5UA 1KDMA 2W5FA 3KT4A 4XW3A 1OPOA 4FFIA 4CE8A 1J83A 5DAQA 5E89A 4ASMB 4NMIA 1YLLA 3PJYA 4KG8A 2B8MA 5IFPA 4DXTA 1YQ5A 4FPYA 4ARXA 2HWB1 1S2EA 1U5IA 2PLV3 3E97A 3ETQA 3WNPA 1ZBE1 4E27A 3AYAA 5KHGA 4LITA 1BVP1 2IWGB 1D4M2 2HEWF 4ISRA 1JU4A 4FCAA 4MHRA 5HCBA 4A4AA 1LOGA 1NE4A 5CNAA 4CDXA 4UFLA 2D97A 5BNOA 4Z2AA 4IL7A 3VBRB 4HONA 3CZUA 1PNGA 1YCIA 3DEMA 4GJZA 4ATEA 2D6OX 2QCSB 4UYBA 1ND2A 1JZ5A 3BPSA 5A7QA 1LULA 1TNFA 5FP8A 2BFUL 4XFCA 1BVVA 1PNFA 4IEQA 1FX5A 5IVVA 3R6SA 1VMHA 1V70A 1FNYA 5DAVA 3ZXEA 1PX3A 5T5LA 1XC6A 4CDQB 3H9AA 1G9DA 4YGDA 2WZ8A 1FPN1 4Q2FA 2IC1A 3VHOA 3FFQA 1AYN3 2LRPA 2ZGOA 2PHLA 3PVOA 1FNZA 1FOD2 1JZ6A 4CEYA 1V9U1 1MACA 4FP3A 1UY4A 1IPSA 4RGKA 4K6BA 4FXKB 2WAOA 2VQAA 1YUDA 3X29B 1BXHA 4UFIA 3JD72 1A6CA 2E31A 1GP5A 3AXDA 2CWMA 1OPMA 1Y9QA 3SKJE 4L92A 2OQ7A 5LASA 1YJKA 1YFWA 1XPWA 2A75A 4ZU4A 5JPMB 3OPZA 4K8FA 1KGYA 4Q4W1 2J1AA 2FDJA 3NV1A 2ZACA 1W0PA 4AAXA 1GP6A 3B00A 3AP5A 4GMP3 3TN91 5KWRA 4TZDA 2ZHLA 1BQPA 4RR3C 1BJQA 2OVUA 1NA1A 4AG4A 2WL1A 1X7NA 2WZR2 4MXVA 5FWJA 4Y1ZA 4Q5OA 1JW6A 2VUAA 3K3NA 4V1PA 4D6QA 5ACA2 4ZXKA 2XLAA 3O0VA 4BXFA 4FVVA 1K5MC 1UMIA 4P9YA 3CJIA 2VOKA 5FP4A 1RB8G 3LF7A 2YU1A 3OEAA 4S2HA 1H1IA 3CQOA 4HL0A 4N8MA 4AVTA 5LATA 5HBAA 4AAPA 4GMP1 3E1F1 4Y5Z0 2VOWA 3WXPA 1W9WA 3VBFB 4E4HA 2WIIB 2XONA 1XQNA 4R8HA 1OUSA 5AFBA 4A2UA 1DQ6A 4K1YA 3MLKA 1ODMA 5DDJ3 4BA6A 4RA0A 4Z8BA 2VZOA 5SV8A 4LA3A 4C1WA 3VBSA 3GBFA 4A3ZA 4XJ9A 1E5RA 2ZXQA 3LOIA 1RUD3 1SDWA 3C2UA 1GQHA 1F31A 4CXWA 1G9FA 2JEMA 5EXOA 3VBRA 3M4FA 3TRSB 5C3SA 1DGRA 4AE2A 2ZGMA 3LAGA 1SLAA 4AFBA 1XOYA 2HWB2 1W8WA 1UY0A 1X8EA 4Y5SA 1R1ZA 2WNVA 1OFSA 2B9VA 3AMPA 4OFGA 1NQJA 1QY4A 1WW4A 2EXIA 3LD8A 4WVZA 3ZMNA 4AFAA 5H9RA 2PQQA 3JD71 4E8DA 3T3YA 5C8CA 2BOJA 1H9WA 1RC6A 2K9ZA 1LNSA 2PLV2 4KGGA 3OF1A 1DGWX 4NHMA 3E6CC 1E5IA 3C7FA 1C8NA 2FZ1A 2XLFA 4AVBA 1AXKA 1OMIA 1COV2 2EXJA 4JKMA 4FTBA 1HB4A 4Q0QA 1QJX3 1AL22 4EN6B 4XMIA 4KWKA 1OD5A 5FZOA 2JDNA 2WNEA 1RUC3 1OVPA 1RUE1 2F4LA 3B9IA 3M3IA 4AQ6A 2VTFA 1ZREA 4P9WA 2HWB3 4OHWA 2RV9A 1FV3A 2VQ0A 3HN1A 2HWE3 5A6XA 4COZA 4B29A 3BCWA 1CAUA 3ZSKA 2YDEA 2NYYA 3MI8A 5L9RA 2W47A 4A7ZA 1GQPA 4V2WA 3KQRA 2ZGKA 5HCHA 1AR83 2P3IA 1YQ6A 2RS52 1KQRA 4YARA 1OI6A 1SEFA 2J1EA 2BZDA 3VZKA 3MFAA 3FUQA 5JOWA 5J37A 3LZZA 5IATA 4LA2A 4MGIE 1WBLA 2BP6A 1MR5A 4J6GA 1R1A3 4AOCA 4NJ4A 4QM9A 2JE9A 4Q4Y3 1U5XA 4FP2A 5BNOC 3VD4A 1XYPA 4YVSB 1H2LA 4GKXA 3DXTA 3AKTA 1FATA 2DBIA 2H0VA 4LKSA 4Y26A 2YB7A 3U1XA 2WZR1 2HWD2 2ZMNA 1ENSA 2CGPA 2UWCA 1DZRA 1YWKA 4QPGC 1N3QA 1V00A 3CBNA 2R042 2HWC2 3IWZA 4K7JA 3HPNA 5C5TA 2FDKA 2VE1A 4QPGA 5FJKA 4IV3A 5J48A 1LHVA 5FTTC 1JYWA 1OOPC 3T0AA 5CEHA 3T08A 2X29A 4Q27A 5CKMA 3IIIA 3WDVA 3ZPOA 1IPJA 1HRI3 2ZX3A 4MUVA 4QQPA 5FP3A 3ES1A 3JZVA 2LTNA 3K4ZA 3UK9A 2QBXA 1F15A 3ALQA 1Q56A 2P4EA 4JHZA 4AEJA 2GALA 4OMCA 5KHJA 2GNTA 4W50A 1W6MB 3WW2A 4LBNA 4E4ZA 4LO5B 1RUG3 1SACA 2WLQA 5HXMA 4XYXA 2VTXJ 2XH6A 4FAHA 1HXS2 1DGWA 1DLLA 1FMD1 1SBFA 2XBO2 2ZMKA 3LDBA 4LOTA 4QDRA 4CCNA 3PUHA 5A7SA 2XG3A 3QACA 2P3KA 4JDNA 2VO5A 2WJSA 3OGSA 1B35A 4FXGB 5FMOL 2DU0A 5LK7B 4BQ3A 5EWSA 1B35C 1ZRDA 2D3RA 1XNTA 2DBNA 2WUHA 3Q8BA 3KGZA 1GOHA 1RUF3 1UQXA 2J22A 4BQ1A 2XJTA 1CAXB 1FPN2 3MBWA 5I0SA 3Q8CA 1Z78A 4L99A 1GFF2 1JXNA 1UPSA 4PLMA 1CESA 2QJVA 3I3DA 3PJQA 1OKOA 3POYA 1BYHA 3ZYIB 4GJYA 3NJZA 3FBMA 4GWNA 3ZN5A 4KNCA 1GBGA 2IFRA 2WN2A 4XACA 4NHXA 4DFSA 4A7KA 1LAJA 1W39A 1WA6X 3HVDA 3GJAA 3WP3A 3E5QA 3NAPC 4LKFA 1D0HA 3BN6A 4GALA 3V0BA 3D3AA 4JGYC 2OUHA 4AZZA 1SFNA 4FTSA 3AZYA 2ZTNA 5KHHA 4YW3A 3ZYHA 4BMBA 2I45A 1UMZA 2W92A 1CJDA 1ULEA 2NQYA 3CMGA 3S57A 2ZA9A 4MG2A 3AJZA 3AYCA 1EAH2 1V6OA 3J8F3 4KBZA 3W58A 1MVEA 1PVC3 4Q0VA 5ABJC 3KCYA 2QQIA 4ITCA 3RZJA 1YI7A 1PGW1 3QD6A 4UFMA 4UW3A 2BWAA 2YFZA 3DCQA 2DU1A 2WFF3 4W65A 4XOGA 5CU1A 2WINB 1GWKA 2ORXA 4LK6A 1CWPA 3W59A 2W91A 3R4UA 1AR72 1WCSA 1G86A 4PIXA 1QQP3 1LGCA 1Z7S2 2LUWA 5IYYA 2R0FA 2FDIA 4HPKB 3LEKA 1FMD2 1VBD3 2XBO1 1YQ8A 2GN3A 4CEYB 5H9SA 1JMUB 2QKDA 5C4WB 4U36A 1XRUA 1XU1A 1W06A 4QAWA 3N35A 3OBZA 5FLIA 5L7OB 3OGRA 2OW4A 5LRSA 3BYWA 4Q4Y1 2ZZJA 5JR7B 3UGFA 1DFQA 2RM21 2YBSA 1IS4A 4A42A 5CFCA 3G7DA 2VMEA 4N53C 1RUI3 1O4ZA 2WFPA 3I2KA 3SH4A 2QDRA 3ZM8A 1I9RA 1AR81 1DYPA 3J7NA 2YPJA 2FDGA 4ZY9A 1S4CA 5FXZA 4YW4A 1MS1A 4OLLA 3KF3A 4NPMA 4QX7A 3HBZA 1HW5A 2VCCA 4P08A 1YRZA 1SPPB 4JX0A 5DUXA 5C8WA 4RGAA 1RUC2 3AMQA 3ZXFA 2YBKA 1W6PA 3LIGA 4YZ3A 5FZAA 1WD3A 1VLNA 4IGQA 4CCLA 1DLCA 1HJGA 3FHAA 3H8UA 3KZ4C 4A3XA 3PUIA 3C7GA 1O3RA 3ACFA 2BPA2 3Q8AA 2CGOA 4ASKA 2D5HA 1XNBA 1CIYA 2GMMA 3C7EA 2ZS6B 2JJ6A 3D6EA 4LBJA 3S30A 1GOFA 4QU2A 4R9CA 4YFZA 5DDJ1 1J3QA 1RHI1 2ZEWA 3OTFA 5A33A 3WUCA 1J1TA 1OQEA 3VDDB 3ZR5A 3LWCA 3OBAA 1H2MA 1NOVA 1AR63 4MLOA 5E88A 1GLHA 2VZPA 3ABZA 4YWAA 4GB31 1UY3A 1W9SA 5DG1A 5KXBA 2WS93 3ZN6A 1QJU1 4C90A 4IV3B 3DV8A 1ULCA 4BISA 2BWCA 5DXDA 3B69A 4NAOA 4PCRA 2Y6GA 4TSVA 2XQRA 1J58A 5A6YA 3BU0A 2WO2A 1S55A 1CAVB 3THPA 1QF3A 2K2SA 2OZ6A 4UFJA 3DYPA 2IXHA 4KWLA 3VDCA 5D21A 2V72A 3WP6A 3ZSMA 2A3WA 2VMGA 4PT6A 4QWNA 4B4RA 4EE2A 3ETPA 3BUCA 1DF0A 5E1RA 2PAKA 2ZCWA 2VW1A 5FY5A 4LE4A 2A5ZA 2GNDA 3H42B 2CHHA 5LEJA 4QX8A 3MLLA 3NRUA 2KA3A 1YFUA 1Q8QA 1PM4A 1RUE3 1D4M1 2JB4A 3HNBM 2VD7A 1ZBE2 5FWEA 2ZX1A 4ARYA 1SLLA 1NQDA 2R073 3WR0A 4XJUA 5LEKA 2UYAA 2NP0A 1C8M2 5HCAA 1UYXA 1MS9A 1WKYA 5FXVA 1HX6A 4N7UA 5D8AB 4H7MA 4FOWA 1G6NA 1L7LA 3MGUA 5FO9B 3ENRA 4GB33 1F4AA 2EA7A 2JG8B 1T6GC 3PHMA 4X6RB 1PMHX 3WNMA 4R4XA 1H30A 2X09A 5A32A 5EZWA 4CXXA 3VD5A 5DPNA 2J7MA 1VAMA 4I09A 2WKKA 2HWF1 4K1ZA 3DGTA 3CKHA 1KJRA 2E26A 4QXHA 4XJZA 3LB9A 1D4VB 3FBYA 2DV9A 1OH4A 4QU1A 1NCQA 5J3UA 1RUG1 1POV1 1TMF3 4OZXA 2G4IA 2RDRA 5IVFA 1KD7A 1W03A 2AREA 4FOQA 3N4MA 1IQDC 3WINE 1J3PA 2X53S 3QOPA 1PVXA 5EJ1B 1TE1B 2RR11 1G9BA 1G9CA 2ARBA 2CL2A 1ZA7A 2Q5TA 4BIOA 1HB3A 3H1WA 4NHLA 3KVBA 2BRTA 4Q4W2 3S0MA 1Y43B 2XHKA 1WD4A 1GMMA 4XCBA 5CAZA 2ZGUA 1PGSA 1X82A 1NXD1 2GMPA 2VZUA 3AVRA 1B09A 3VBSB 3TN92 2WO3A 3GYDA 4B1LA 5FYTA 5FZBA 2W94A 2FBEA 1ENXA 1MZ5A 4F7ZA 1PMJX 4I2OA 1VIWB 3N9NA 2WNVC 5L36A 4YM1A 1W9TA 4L0PA 1S0JA 5EV7A 3UETA 1MZFA 4AW7A 1JZ7A 5LB6A 2FMDA 2JKBA 2XJUA 2R043 1X9PA 5G05L 1BK1A 4H3WA 1ND3B 4LLOA 4PQQA 2WSVA 5IUQA 5DZFA 4FPJA 1JOBA 2DVDA 1NCRC 2ZJCA 3S6PA 4M3CE 2XJSA 1HRI2 2KR2A 4JGYB 2VXRA 2B7YA 4XJ8A 3RI9A 3UYJA 2HBTA 2D6PA 2FD8A 1DQ4A 1K12A 1Q43A 1W6QB 2VC9A 2ZAAA 5GLTA 3BTXA 4YGBA 2HWE1 4IEWA 3WG4A 3ORJA 2E7TA 4KWJA 1V6KA 1MEC2 2O1QA 3MIEA 2AACA 1OSGA 3LDRA 4IW3A 1VB4A 2RJLA 4CU7A 1QDOA 3RI8A 2Q0AA 2ZKLA 5BY5A 1DIWA 5KC6A 3BIWE 3M3EA 1XYNA 1TVGA 2R1DA 3WOGA 2ZGNA 2BOIA 4B4PA 1XBFA 1ZBA1 3M2MA 4FOYA 4HN1A 5C3RA 1AYM3 3SEEA 1AR61 2SLIA 5CADA 2EIGA 4DS0A 3AJYA 2WAAA 3UT0A 1JYCA 4AVAA 2WNUB 5C3OA 2Y8KA 1J3RA 4IQPA 5EP9A 1GNHA 2A6XA 5FZHA 3WT3A 2EXKA 3KV4A 4LK7A 4NWVA 5JAXA 3U75A 1PO13 3NNJA 1YHFA 5FZLA 2Z79A 2Q1ZB 3WSOA 5AC91 2B39A 1FOD3 1BEV2 3KD4A 2E53A 1AL21 3K4AA 2A6YA 1H9PA 1JBCA 4LQRA 4BOWA 1C1FA 1GP4A 4NO4A 3M70A 3I8TA 3CEWA 1VBA2 3AP6A 2DVFA 1TQ5A 2JE8A 4AI3A 4M01A 3M7AA 5FZDA 3O1PA 1Q5OA 4QB6A 4QX2A 4AI8A 2XKPA 2PN5A 3L2YA 4LTAA 2FDHA 4EQVA 4L8QA 1UOFA 3PVNA 1V0AA 2YROA 1HIXA 3AL5A 3QLQA 2CY6A 2R49A 1AJOA 4K9SA 1FYUA 1LEMA 5IVCA 1KEXA 1OQ1A 4NUBA 5FZ3A 4CDWC 1EPZA 3VL9A 3TBDA 5AC93 1RGSA 1QH7A 3MFCA 3URFA 1OC1A 2C26A 5C6CA 1IQAA 3GXUA 2QQOA 5E6HA 4UT5A 4R52A 5LBFA 2JG9B 3HMYA 3EXUA 3SLIA 5GLVA 4WM7C 3GM8A 4BHPA 4LPLA 5LCWL 1DQ0A 1XJAA 1I1EA 1WWYA 1PO22 2R071 3VDAA 1DQ1A 2CDPA 3WW3A 1MS4A 2VZQA 4XUTA 2PMWB 3PVEA 4NPLA 3IDCB 1MVQA 3UJQA 1UWWA 3KM5A 3R05A 3H1MA 3H3ZA 3L2HA 3TEZA 4WM7A 1C8M3 3U4XA 1O6UA 1NYWA 2A6WA 5GLWA 2VMIA 3W20A 2J1RA 2EIEA 2Y6JA 3V65A 2GU9A 3BGAA 4IEOA 2I2SA 2VOVA 2YV8A 3C3VA 1W90A 1W6MA 1XYOA 2CAUA 5JIAA 2QQKA 1MQTB 3TWIA 1DU3D 4RYDA 2VNRA 5FPLA 3H3LA 1DBNA 4NVPA 1OA2A 4P02B 5D2AA 1OA4A 2OYZA 5KBFA 4YG3A 3IN9A 4QHZA 4EWDA 1NAEA 1AX2A 4KGQA 4FT8A 1MPXA 4AVVA 4LEJA 5LBCA 5C3PA 1QJU3 4LHNA 3RJ2X 1Q8VA 5SV5A 5FLJA 4C0HA 4HK9A 2R041 5ACA1 4MZUA 4AI0A 1F35A 1IG3A 1XNCA 4DUXA 3I3MA 3NQHA 3ILFA 4D7TA 1K45A 1PX4A 1BZWA 4JTNA 1NLQA 5FP9A 5EJ3A 4AF9A 3MPPG 1AYN2 1PO11 3WDXA 2WR9A 4MVTA 4A45A 5FFOC 4OCTA 1HRV1 2A73B 1WCUA 2DUQA 2Z4FA 3R4DB 4FPCA 4QQHA 2DCTA 5IJRA 2IVJA 4R9DA 2OKXA 1AL23 1RTVA 2JDMA 3RRDA 3ZXKA 3JD73 2WWJA 4E4DX 1ZZ9A 3WNLA 1T2XA 1V6NA 2W52A 1M4WA 1VB2A 2PLV1 2FCUA 3N7LA 4QQLA 4Q4X3 5A7NA 5B4NA 3ILRA 2V09A 4LBOA 2JG8C 2JDYA 4XIKA 4Z82A 3UGGA 2ARCA 3ILNA 3LA7A 4FFGA 4J25A 2QNKA 2EAKA 2VZ1A 5FYYA 1S2KA 1V9U3 4XXPA 3AYDA 4JDMA 4OYUA 1JYXA 1RUF1 5FZ0A 3H8OA 3D82A 4Y1YA 4AEMA 5FO7B 4WZFA 1R092 1CX4A 2ET7A 4IETA 4QT6A 3BKZA 1UOGA 3VD9A 2RMU3 2C24A 3NAPB 3RS6A 3KS7A 5H9QA 3ZSJA 4YZ5A 1NT0A 3CJIB 1H4GA 4MH0E 5DABA 4BIFA 4BQ5A 4D7SA 4DEVA 4DMIA 5BNPA 3RZLA 3POIA 1YIPA 3ZFEC 5BNPC 2R16A 2H0BA 1WMXA 2XGXA 1LHUA 4DXRA 3M3QA 4K8RB 1W8TA 2Y38A 4MX3A 1ZRRA 4GULA 2NM1A 4OHXA 2RS32 3PU8A 4OHVA 3ACIA 2VH9A 3NJXA 4AEDA 1VBE1 2EAAA 2IFWA 2WQ4A 2ZGPA 3MV01 3I97A 4W6WA 3POSA 1CR7A 4TTGA 4CUGA 5JXGA 4YW5A 5FUIA 1ENQA 1F5JA 1SDDB 1GWMA 2DWRA 2VZSA 3LDKA 5FK7A 4BE3A 5GZCA 1I5ZA 4XUNA 3AMNA 2RMU2 3SH3A 3LE0A 3VBOC 1W8UA 4NIAA 1LRHA 1RUD2 1U5YA 3HNYM 3UGHA 5LY1A 4RGGA 4X8PA 1NCRB 5F2WA 4DOUA 3GHMA 3POFA 1QEXA 3A0KA 1C4RA 4RHV1 3WF4A 3KB5A 4BMEA 4CEWB 1AXZA 3AKQA 1ND3A 3GZEA 3ZDSA 3ZFFB 2QQPA 1UZYA 4MGQA 1W05A 1Y9MA 1BLZA 5C4WC 1SZBA 3PLQA 4ZONA 1UYYA 5FKBA 5L9BA 3SH5A 5IFTA 4Q4W3 1S0DA 5JMCA 3TEWA 4JGZC 2VOXA 2DCYA 3FL7A 1REFA 3NKTA 4B3NA 2WS91 3NKGA 1QJX2 3HJRA 4XDPA 3AFKA 4IEZA 1XNDA 3CDZB 2JDUA 3EMRA 4N53B 5CYYA 3ZLIA 2RE9A 4M3CB 4QGLA 2ZHMA 4Q0UA 2D6NA 4XQWA 3ACGA 4N43A 1DQ2A 5M0TA 1BHGA 3PVBB 4ZS3A 4BWOA 5DAXA 2EICA 5BPXA 2Y34A 1ZBA2 5ERLA 1REDA 4QPIC 4RS5A 1G8WA 3VBHB 1W6OA 1AR82 2CYFA 2RS53 3ITQA 5A3PA 2C9KA 4CCEA 1UX7A 1TZOA 2PFWA 2DDUA 2LM3A 5HPOA 3WUDA 4ZU5A 4TN7A 4BQ4A 5LA1A 1UYZA 3LEMA 1R64A 5LA2A 2BTVC 4KG0A 3SNMA 1LOAA 1IOAA 1H8TB 1WGPA 5A7WB 2Q1FA 3RNSA 4YGEA 5EYYA 4OI1A 1FXZA 4I01A 3DKQA 3RWNA 4Q8KA 3SCGA 4PI2A 2BVBA 2VMFA 3LPGA 3MW2A 2WYSA 4IUGA 3OYWA 1PO21 2LW8A 2W46A 4QPYA 3RZZA 5FV3A 2R072 1OHFA 4ZZ5A 5IK7A 2VZ3A 5A32B 4D7YA 1WMDA 4EJRA 1N47A 1HV1A 3FN9A 2AC1A 1NZIA 4PJYA 3VV1A 4QMAA 4EV0A 2MEV1 3OPTA 1SCRA 1O7FA 2B9UA 4XBNA 2PHTA 3OY8A 1Z7S3 1A34A 2WBKA 4YM0A 3U07A 1RYYA 1R082 2RS11 3WG1A 2J1SA 3LKJA 4BQWA 4UW6A 3AP9A 1XE7A 3Q8EA 4QGMA 2EIBA 5HCFA 2IXJA 1AYM2 3APBA 3JB8A 1R093 3SITA 2Q8OA 5F3CA 1HN0A 3QBQA 2LROA 3JUUA 3M3OA 4IGOA 3T2TA 5A7PA 1NCQB 3POWA 5JSOA 1ACCA 1S0GA 4YYOA 2WABA 4AHZA 2VU9A 4XC9A 4V2VA 5I8YA 3IBMA 5EFUA 4DRRA 5J09A 2WT0A 1SFPA 1R1A1 3I2IA 5JDBA 4UW4A 3OBTA 4CP9A 1MS8A 1LJ7A 4XF4A 3ZOIA 2JIJA 1O4TA 1NLRA 4JRAA 3MUY1 1ZZBA 3POJA 1Y7BA 4AEDC 2VM9A 2ERFA 2YZ4A 4N9IA 3AZZA 1UMHA 1STMA 4MXWA 4CP1A 1H8VA 5IAXA 4W4ZA 4BK4A 4YM3A 4AGGA 4K40A 2QE3A 4MGTA 4L2NA 2VNGA 1UZ0A 2D6MA 1UN1A 3KWVA 2J1VA 3LCPA 5JZGA 4CXYA 3EQEA 3GCXA 4LBMA 1UL9A 2JE7A 2NLRA 2BBAA 1Z7S1 2VOTA 1N1VA 4PF1A 1OOPA 1EUTA 3KLSA 1K5MA 1KFXL 4ISQA 3RMXA 4CDUC 5T55A 5IAVA 1NUKA 3MIGA 2Q1MA 2R6QA 3GNEA 4XF1A 5DAPA 2VZVA 4DY3A 4IV1C 4NR1A 1RUI1 5IHRA 5KXDA 1AX1A 2RM22 3P1IA 4NHYA 1HV0A 2XQXA 3OBRA 5A7WA 1AHSA 1LOEA 3PDQA 5APAA 2AYHA 5BNNB 3WNNA 1YFXA 2CTVA 3ZX7A 1W6PB 2LALA 5FY4A 1AR91 4EWAA 3VBOA 1DGLA 1DYKA 2B46X 1LODA 2JXAA 3K4DA 3VBRC 3H8RA 5FK8A 2VJXA 1GICA 1RXFA 3GBWA 1PGL1 1MS0A 2WFF2 3J7LA 2VNVA 3PTRB 4D8MA 1JYNA 1OLRA 4ORFA 4Q29A 1XXNA 5JOZA 4YZ1A 2BV4A 4RHV3 4EZHA 4DZGA 2E51A 3TYJA 2Y64A 5C8CC 1MEC1 2AUYA 5J96B 4FI9A 4MO3M 5T5JA 5LBEA 2PTMA 1S2BA 4YVWB 1JOPA 4GMP0 1ND3C 5LA0A 1NA1B 3VN4A 3KCXA 2DTWA 1R091 3N7MA 1PIV3 4JHTA 3ZKYA 5F6KA 4XZUG 4NAMA 3CJIC 2V73A 4GH4C 4L97A 2VECA 4N7IA 1PVC1 3FFZA 1ODNA 5BNPB 3O1SA 2G9ZA 3M8LA 4GB32 4QB2A 5DG2A 4HSJA 1GWLA 1E57A 1YJLA 2V4AA 1PZ7A 3GF6A 3FHIB 3NL1A 2BYVE 1KFUL 2D7FA 2QDNA 5GM0A 3WQ1A 5A6ZA 2DF7A 4CYDA 1NCRA 4UXAA 3W5NA 4GQ7A 2ZGRA 2VBBA 3CL1A 5KXEA 1V6MA 3AP7A 4HKLA 4QDQA 4YNIA 4BU2A 3VKLA 2VZRA 1K5MB 5DUWA 3O1RA 3HEIA 2HWF2 3AKSA 3K48A 5DUUA 2QVSB 2WQ8A 5FYUA 2AH2A 2WNUC 4Q4V2 3CF6E 1O5UA 1VJ2A 2GC0A 5G04L 5FBZA 4EN7B 1AR92 3I3QA 4Y4RA 1XE0A 3B93A 2CAVA 3V0BB 1YI9A 4UFHA 2NMOA 2ORZA 5FMBA 1ZRFA 1JU3A 3JBG2 2YC0A 3IM0A 4XIOA 1OBNA 5FKCA 5LBBA 1VRH3 5JPNB 3D0SA 3B3QE 1WW7A 2WS92 3TOJA 5F9TA 4FQZA 5I8TA 4RQPB 5FLHA 1LOBA 5F5CA 3VHNA 3WQ0A 2W0XA 1EPWA 4LULA 1F9KA 4UFKA 4WM8B 5JZGC 3WEZA 3ZYGA 4QD2A 1AJKA 2YC2A 1LHOA 1RXGA 1VMFA 2CNAA 4PDWB 3VL8A 1HB2A 4M00A 5I91A 4WZCA 4UW5A 3A21A 1FMD3 1VBD2 2JICA 2WT2A 3ZYJB 5KR7A 4KWUA 5JWPA 4Y24A 5FCCA 2YMZA 5DAWA 3VGIA 4E2GA 3OCPA 4OI4A 5HV0A 3RZMA 1QQP1 2GC1A 2OPKA 3C8XA 1PGW2 3THCA 2P17A 3HQXA 3BTYA 1IKPA 2A70A 3WY6A 3ZN4A 1W6NA 3NNFA 5K8SA 3K46A 4YW1A 1L7QA 2X8KA 1IS3A 5I0UA 1KS5A 3JB4C 3WLUA 3LGRA 1IKQA 2VW0A 4LBLA 3MO4A 4XFIA 1JHNA 4YZ4A 5F5AA 5C9AC 3BIEA 2WRAA 1WMFA 1SHWB 3O1VA 2TBVA 3OYWB 5FDBA 3CO2A 2W68A 3A23A 3O12A 1R1A2 5DN2A 1ASJ2 4OHYA 4CDUA 3J26N 1CZTA 1D0GA 1KDKA 4IEUA 4J1WA 1F8VA 4O61A 1VAKA 4G4FA 4IEXA 2NPIA 4XAAA 4YPJA 3RYPA 2PHDA 1LGNA 3NV3A 2ZX0A 2RJ2A 1EV12 2IUWA 5EHDA 2BDRA 5F2SA 2ATFA 5GZGA 5FMOS 1PO12 1W8ZA 4UI9L 3WX5A 1V9U2 2ZGTA 1W6NB 2UU8A 3O1OA 5F3EA 3O1MA 5JOYA 1NCQC 4FPGA 4PLNA 3RPQA 1W0OA 3VZNA 3RG0A 4DUWA 1IPKA 2FCVA 5FBJA 1RUC1 1Q8SA 3RZHA 4CA9A 1C57A 3N7JA 2G19A 1W8HA 4OMDA 5LRRA 1DDLA 3HIFA 4QPGB 4ES9A 1UX6A 3MF6A 5F5IA 4N43C 5C4WA 1COV3 3LEGA 1AVBA 1DGRN 1VBA1 4F3JA 3ACLA 3F95A 3T1LA 1APNA 2VTXA 4NOTA 4QPIA 3K3OA 5FRAA 1W99A 1VRH1 1LHNA 1VMJA 1RHI2 1SG3A 2YC4A 4I30A 3R4SA 4Q4V1 3ZSEA 4M0HA 1BCXA 4BM8A 2JD9A 5HI0A 3MIHA 1EYBA 2Q8EA 3EBRA 1URXA 1TME2 4G3YC 3H1YA 1CQ9A 4FPOB 3RVHA 3GDBA 3SISA 5C5UA 3NAPA 5GZDA 2HWF3 4AVSA 3O5SA 2B45X 4HVOA 1A78A 1NZCA 4Q4X1 5BNQA 3WVJA 2GSYA 2PAMA 4P9IA 2A6VA 1UU4A 1YXWA 4JKKA 5EYXA 1PIV2 2ADEA 4H7LA 4DRVA 1QU0A 1UZZA 2J1UA 2OQ6A 3LPFA 4YFWA 3T09A 3GZUC 4XE9A
chains in the Genus database with same CATH topology
2PXJA 4IGPA 4DO0A 5FJKA 5ANQA 2P5BA 5FXZA 5FPUA 3KVBA 4UF0B 5LY1A 5FJHA 5FZOB 5CEHA 5FYVA 3ZPOA 5FWJA 4QX7A 5F5CA 5F2WA 5FPAA 4CCMA 3N9LA 3K3NA 5FP3A 3AVRA 5F32A 5A1LA 4D6QA 5FYTA 5FZBA 2YBKA 4EZ4A 5FYCA 5FZAA 4BXFA 4IGQA 5A3NA 4CCLA 5ISLA 3N9NA 5KR7A 4URAA 5FP4A 2Q8DA 5FZ9A 5FP7A 2YU1A 3LDBA 4CCNA 4LXLA 5A7SA 5IVYA 5LY2A 3AL6A 4XDPA 4AAPA 4ASKA 5FPLA 5A7WA 3K2OA 2XUEA 4E4HA 5FZ8A 5LWBA 3PDQA 3ZLIA 2OX0A 3NJYA 5FUNA 3UYJA 4UF0A 4HOOA 5FY4A 3DXUA 3N9PA 3KV6A 5F5AA 5FY8A 5FYSA 5A7OA 5A3PA 5FZEA 4CCJA 3N9MA 5IVEA 3N9OA 5FUPA 4BISA 3PTRB 4GJYA 5F3GA 5FXXA 4TN7A 5FY9A 5FZ1A 5IWFA 4LIVA 5FP9A 4EZHA 5FY7A 4C8DA 5A7WB 4DIQA 2YBPA 2YU2A 3LD8A 5FYIA 5IW0A 4EYUA 2OT7A 3PURA 2XDVA 5FZ7A 5IVJA 2WWJA 2GP3A 3AVSA 5F2SA 5FZGA 5FXWA 4QWNA 5FYZA 5FY0A 5A7NA 5FY5A 4LITA 5F3EA 5FV3A 2W2IA 3U4SA 3OPWA 4XDOA 4QX8A 3PU3A 5F39A 3KV9A 4CCKA 4QXBA 4QXCA 4D6RA 3OPTA 4HONA 5FZCA 5FZHA 5FBJA 5FYYA 4GAZA 3KV4A 4GJZA 5FZOA 2VD7A 1VRBA 5FWEA 4LIUA 5A3WA 5FZLA 3PUQA 4GD4A 5FZ0A 3U78A 4Y3OA 5A7QA 5FP8A 5F5IA 4D6SA 5FXVA 5FYMA 2Q8CA 5IVVA 5FZ6A 5FZKA 5FZFA 3N9QA 5FYBA 5FZIA 2WWUA 4AI9A 2XXZA 5F3CA 3KVAA 2GP5A 4V2WA 4IGOA 3K3OA 5A7PA 5A1FA 5FZDA 5IVBA 5FZ4A 5FYHA 4CCOA 2XMLA 4V2VA 4BU2A 5FPBA 5FY1A 3PUAA 3AL5A 5FZMA 2Q8EA 5FPVA 3RVHA 3KV5A 4Y33A 3PU8A 4QXHA 5FYUA 2OQ7A 4NUBA 5FZ3A 5IVCA 5LW9A 2YBSA 4QU1A 5A3TA 2OS2A 3DXTA 4CUGA 5IVFA 4Y4RA 5E6HA 4CSWA 5F3IA 2YPDA 5F37A 5K4LA 2OQ6A 5A80A 3PUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PXJ A;  4IGP A;  4DO0 A;  5FJK A;  5ANQ A;  2P5B A;  5FXZ A;  5FPU A;  3KVB A;  4UF0 B;  5LY1 A;  5FJH A;  5FZO B;  5CEH A;  5FYV A;  3ZPO A;  5FWJ A;  4QX7 A;  5F5C A;  5F2W A;  5FPA A;  4CCM A;  3N9L A;  3K3N A;  5FP3 A;  3AVR A;  5F32 A;  5A1L A;  4D6Q A;  5FYT A;  5FZB A;  2YBK A;  4EZ4 A;  5FYC A;  5FZA A;  4BXF A;  4IGQ A;  5A3N A;  4CCL A;  5ISL A;  3N9N A;  5KR7 A;  4URA A;  5FP4 A;  2Q8D A;  5FZ9 A;  5FP7 A;  2YU1 A;  3LDB A;  4CCN A;  4LXL A;  5A7S A;  5IVY A;  5LY2 A;  3AL6 A;  4XDP A;  4AAP A;  4ASK A;  5FPL A;  5A7W A;  3K2O A;  2XUE A;  4E4H A;  5FZ8 A;  5LWB A;  3PDQ A;  3ZLI A;  2OX0 A;  3NJY A;  5FUN A;  3UYJ A;  4UF0 A;  4HOO A;  5FY4 A;  3DXU A;  3N9P A;  3KV6 A;  5F5A A;  5FY8 A;  5FYS A;  5A7O A;  5A3P A;  5FZE A;  4CCJ A;  3N9M A;  5IVE A;  3N9O A;  5FUP A;  4BIS A;  3PTR B;  4GJY A;  5F3G A;  5FXX A;  4TN7 A;  5FY9 A;  5FZ1 A;  5IWF A;  4LIV A;  5FP9 A;  4EZH A;  5FY7 A;  4C8D A;  5A7W B;  4DIQ A;  2YBP A;  2YU2 A;  3LD8 A;  5FYI A;  5IW0 A;  4EYU A;  2OT7 A;  3PUR A;  2XDV A;  5FZ7 A;  5IVJ A;  2WWJ A;  2GP3 A;  3AVS A;  5F2S A;  5FZG A;  5FXW A;  4QWN A;  5FYZ A;  5FY0 A;  5A7N A;  5FY5 A;  4LIT A;  5F3E A;  5FV3 A;  2W2I A;  3U4S A;  3OPW A;  4XDO A;  4QX8 A;  3PU3 A;  5F39 A;  3KV9 A;  4CCK A;  4QXB A;  4QXC A;  4D6R A;  3OPT A;  4HON A;  5FZC A;  5FZH A;  5FBJ A;  5FYY A;  4GAZ A;  3KV4 A;  4GJZ A;  5FZO A;  2VD7 A;  1VRB A;  5FWE A;  4LIU A;  5A3W A;  5FZL A;  3PUQ A;  4GD4 A;  5FZ0 A;  3U78 A;  4Y3O A;  5A7Q A;  5FP8 A;  5F5I A;  4D6S A;  5FXV A;  5FYM A;  2Q8C A;  5IVV A;  5FZ6 A;  5FZK A;  5FZF A;  3N9Q A;  5FYB A;  5FZI A;  2WWU A;  4AI9 A;  2XXZ A;  5F3C A;  3KVA A;  2GP5 A;  4V2W A;  4IGO A;  3K3O A;  5A7P A;  5A1F A;  5FZD A;  5IVB A;  5FZ4 A;  5FYH A;  4CCO A;  2XML A;  4V2V A;  4BU2 A;  5FPB A;  5FY1 A;  3PUA A;  3AL5 A;  5FZM A;  2Q8E A;  5FPV A;  3RVH A;  3KV5 A;  4Y33 A;  3PU8 A;  4QXH A;  5FYU A;  2OQ7 A;  4NUB A;  5FZ3 A;  5IVC A;  5LW9 A;  2YBS A;  4QU1 A;  5A3T A;  2OS2 A;  3DXT A;  4CUG A;  5IVF A;  4Y4R A;  5E6H A;  4CSW A;  5F3I A;  2YPD A;  5F37 A;  5K4L A;  2OQ6 A;  5A80 A;  3PUS A; 
#chains in the Genus database with same CATH topology
 1AX0 A;  1J84 A;  1P8J A;  3ELN A;  2VY0 A;  4M3C F;  1QGL A;  1RVF 1;  1QJY 1;  5FYV A;  4U2A A;  3EJK A;  3O14 A;  2KD7 A;  1GNY A;  4MGS A;  4Z1V A;  1DP0 A;  5DQ0 A;  5DDJ 2;  3NNM A;  1UIJ A;  1D7P M;  1W8F A;  3HNM A;  4IEV A;  4NPR A;  4MV2 A;  4K20 A;  3MZH A;  1PVC 2;  2EAL A;  3D0J A;  3LIH A;  5CIR A;  1ND2 C;  4FPK A;  3VBF A;  1DZT A;  3MEP A;  4LLF A;  5GAL A;  4FSJ A;  3WQ7 A;  3AL6 A;  1ALY A;  3KHC A;  3WW1 A;  3LEI A;  1LEC A;  3AMH A;  4TYS A;  4COW A;  3SEP A;  2D3S A;  4CDX C;  3VHR A;  2JIG A;  5FAX A;  5FUN A;  2I07 B;  3N3H A;  1NY7 2;  3DF0 A;  3GJB A;  3B5L B;  4I3G A;  4B1M A;  5FMD A;  1W2U A;  5GLZ A;  4JAA A;  4PIY A;  1UY1 A;  5A7O A;  2I74 A;  3ROU A;  3SMH A;  4P14 A;  2VW2 A;  2Y33 A;  1HDK A;  3N9O A;  1MS3 A;  2B42 B;  3SCF A;  4CPB D;  5A3U A;  2QQN A;  2BNO A;  1Y3T A;  3MW4 A;  1GSL A;  1QDC A;  4GWJ A;  5FY9 A;  3KT7 A;  2JDP A;  1FPN 3;  1YQ2 A;  1VRH 2;  2OXB A;  2P2K A;  4O7X A;  3CU7 A;  4XFA A;  3BU7 A;  2A6Z A;  4C8D A;  2BNN A;  3INA A;  3B94 A;  2DFB A;  5FPZ A;  5GLU A;  3BTZ A;  1U5Z A;  4XFF A;  2GH2 A;  5GJ6 A;  1HQN A;  1W0N A;  2A3Y A;  3VKO A;  4MAD A;  3O7O A;  5IVJ A;  3AVS A;  1VBC 2;  4LHS A;  1YIF A;  5FYZ A;  1S0I A;  3SKV A;  3JXS A;  2W9X A;  3A7Q A;  3MIF A;  5IVB A;  4FPH A;  1A3K A;  3PU3 A;  4W6X A;  2CSG A;  3KV9 A;  3J9S A;  4CCK A;  1IG0 A;  4QXB A;  2ZEZ A;  3CIH A;  4HVQ A;  4QPI B;  4D94 A;  4QQ2 A;  3VBH C;  3DKW A;  3POG A;  2VVE A;  2E63 A;  2IXC A;  3ZFE A;  4AVC A;  1K42 A;  5JSR A;  1JOJ A;  2IXK A;  2PA7 A;  2V5Y A;  4LJH A;  5FO8 B;  3ECQ A;  4HBN A;  4QB1 A;  1HRV 2;  1K3I A;  1LU1 A;  5FZI A;  5JIU A;  2LS6 A;  2X10 A;  1VPH A;  4PBP A;  4R9A A;  3JCI A;  4I0A A;  1RIN A;  4IEP A;  4LKE A;  1CAU B;  1Y4W A;  2XML A;  1WCK A;  1X36 A;  3H50 A;  1RVF 3;  3VLB B;  4RL7 A;  2NMN A;  4G9S B;  4UAP A;  1X8M A;  2AEY A;  2W87 A;  4XQD A;  2GAU A;  1C1L A;  2VUD A;  3WW4 A;  1LTE A;  3I2D A;  2GH8 A;  2GNM A;  3Q8F A;  4B7E A;  1LOF A;  4IE7 A;  4PDW A;  3WF3 A;  4FFH A;  2QZ2 A;  3VZL A;  1KRI A;  4GA9 A;  4WM8 A;  1QJY 2;  3VKM A;  3J8F 1;  5C7G A;  1VBD 1;  2XBO 3;  2WNO A;  3O0W A;  1ZRI A;  2W1U A;  5BUV A;  1LES A;  1UU6 A;  2BNM A;  2ADD A;  3VDD C;  3FZ3 A;  4P9L A;  1N1T A;  4P5H A;  3AZV A;  1I3H A;  2BVV A;  3OUH A;  3OG2 A;  2G9G A;  4CDQ C;  1QOS A;  1R08 1;  2TUN A;  4AL9 A;  4JDO A;  2ARA A;  1NG0 A;  1X50 A;  1BBT 2;  2VVD A;  4FTE A;  3I2F A;  1FAY A;  5BNO B;  1UO9 A;  5F7U A;  4E2Q A;  2QQM A;  1YYN A;  4EWE A;  2DUP A;  3IT8 A;  3C7O A;  1GYK A;  3RQ0 A;  4MYE A;  1HXS 1;  3MF9 A;  2FHR A;  2VQU A;  4WVM A;  4Y20 B;  2WA3 A;  4UBG A;  2IZW A;  3P3P A;  4LBQ B;  4MET A;  1H1M A;  3MYX A;  2GC2 A;  2JB8 A;  1XB9 A;  2DVA A;  4P5Y A;  2YG0 A;  5JUV A;  4S2F A;  2YGL A;  4IE5 A;  2XKO A;  3DL3 A;  4JCK A;  5K0U A;  4URT A;  3RZG A;  1JYI A;  1Q8O A;  3J4U H;  1RUJ 2;  4CPB A;  2OII A;  3IPV B;  1WLT A;  4XTP A;  1I6X A;  1UYP A;  4Q8L A;  4E8C A;  5EPA A;  3GAL A;  4LBQ D;  5CB7 A;  2YHJ A;  1SBD A;  3N36 A;  4NRP A;  4LO4 B;  4JKL A;  3ZN6 B;  1JZ8 A;  2OUJ A;  3CNA A;  4IV1 B;  2GN7 A;  4HMZ A;  5B4X A;  5K7P A;  1W2T A;  1N1S A;  1WLC A;  4S2D A;  1UKG A;  4IE6 A;  1C5H A;  1WCD J;  4TXW A;  4E4S A;  2WA4 A;  1G7Y A;  2VPV A;  3ON7 A;  3BTA A;  4AYU A;  2PHF A;  4H55 A;  3I2H A;  4YW7 A;  1BEV 1;  2AEZ A;  3PNA A;  4M0N A;  4M3C A;  5FXW A;  1QXR A;  1ZRC A;  4N53 A;  1REE A;  4BPZ A;  5F5Q A;  3HQU A;  5A3O A;  3RYK A;  3TNP B;  4B4Q A;  5CFD C;  4OUE A;  5LZ6 A;  2W2I A;  2VXJ A;  3NJV A;  3D5O A;  3TN9 3;  4XFG A;  4HPK A;  3NO8 A;  1GV9 A;  1SPP A;  1EV1 3;  3FX3 A;  4XHB A;  1TEI A;  4JVA A;  4CTE A;  5CKQ A;  4LO8 A;  1PK6 B;  4LO6 B;  5JVV A;  5CIS A;  3ZFG B;  3OSD A;  1HRI 1;  1VBE 3;  3EHK A;  3T30 A;  2VAU A;  1PGL 2;  4CDQ A;  2D44 A;  5FZF A;  1I5P A;  1US3 A;  2XXZ A;  3H7Y A;  5H9P A;  4XTM A;  3PIJ A;  2QQW A;  3THD A;  2P1B A;  3OGG A;  4HK8 A;  4Q4V 3;  4XFB A;  4PIZ A;  5FYH A;  4Z2W A;  3BOW A;  5CA6 A;  1NA1 C;  3P6B A;  5D1I A;  1D4M 3;  2KXL A;  5CG8 A;  5FPX A;  3DPR A;  5DMY A;  1DQ5 A;  4AHW A;  4MHU A;  4Q4Y 2;  1RIR A;  1WUV A;  1GQG A;  2VCA A;  2WDB A;  4Y33 A;  5CZK A;  1OF3 A;  4L11 A;  4KBB A;  2HWC 3;  5AVP A;  4CRQ A;  5F1R A;  2PHR A;  3HQR A;  5J36 A;  5CBL A;  3LOB A;  2C1F A;  2HWD 3;  1RUJ 1;  2WO7 A;  4I0B A;  4TLG A;  1OXC A;  5DZG A;  1W3X A;  1T6B X;  1ND2 B;  2YPD A;  5LK5 A;  1ZVF A;  4IEY A;  4JC1 A;  1OUR A;  3QH6 A;  1LOC A;  1AYN 1;  1SCS A;  1GOG A;  1GNZ A;  4UF0 B;  3ZYF A;  1RJ7 A;  1ULG A;  3BOP A;  2BBV A;  3DEC A;  2IXL A;  1LHW A;  4N90 A;  3Q9O A;  1H6Y A;  1S0B A;  3LA3 A;  4COU A;  2ILM A;  1QJU 2;  3IDE A;  3K77 A;  2IVI B;  1BBT 3;  1CGP A;  1IGO A;  2W39 A;  3ES4 A;  3KCC A;  3P5B A;  2J1T A;  2ENR A;  3POE A;  4CP9 B;  3VB9 A;  4Q1R A;  2R32 A;  4KQ7 A;  1JOD A;  1RUH 2;  4AEK A;  2GC3 A;  3V0A A;  2CGN A;  2TEP A;  2VUL A;  3DYM A;  1X9T A;  5IVY A;  5CKN A;  1RUF 2;  2B5H A;  3SQO A;  4BK5 A;  3FMG A;  3FE5 A;  1ZYB A;  2W1S A;  2NZ9 A;  2N7G A;  3LFI A;  2F4P A;  5FZ8 A;  1PHM A;  1OT5 A;  1R08 3;  5ANN A;  1FOD 1;  4NRQ A;  1POV 3;  1TMF 1;  2RDN A;  2Y0O A;  2VBD A;  3KMH A;  2ZX4 A;  4D69 A;  1C3H A;  2X5I C;  2ZBJ A;  4LOS A;  1OOP B;  1RUJ 3;  3HT2 A;  4HKW A;  5FYS A;  5ACA 3;  1OA3 A;  2WFF 1;  3MUZ 1;  1JZ4 A;  1DYO A;  5CG9 A;  3IKW A;  1CAX A;  2BEO A;  3CZJ A;  3N9M A;  1JTZ X;  4ATF A;  3V64 A;  3MLJ A;  1OF4 A;  1RL3 A;  2VMH A;  2WZE A;  2Z5W A;  4RFT 0;  1W2N A;  3OOX A;  2Y26 A;  3DN7 A;  3T4H B;  2ZEY A;  3SXW A;  3T1M A;  2Y6H A;  5FY7 A;  4MXW B;  3WD5 A;  2DFC A;  2VCM A;  1UZV A;  4XCA A;  1CAV A;  1ASJ 1;  3I2O A;  4ZKT B;  4P9X A;  4HET A;  5IW0 A;  1GZW B;  3I59 A;  4RS5 C;  1MEC 3;  3PUR A;  4XDQ A;  4Y22 B;  4EYU A;  1L3J A;  4QKN A;  1OH3 A;  4ZHN A;  1GUI A;  2JG8 A;  2KM2 A;  4LT5 A;  1PO2 3;  4Y1X A;  1B35 B;  3T2Q A;  3KHB A;  1NKG A;  4RSU A;  4OI0 A;  2CWS A;  3AM2 A;  4IV3 C;  1SLC A;  3OPW A;  4UWD A;  5F39 A;  1FV2 A;  1POV 0;  2GZW A;  4QXC A;  1SBE A;  4AK3 A;  2RS3 3;  3T0D A;  3IZO A;  5C9A B;  4XJW A;  4XXA A;  5DZE A;  2O14 A;  3TAY A;  5C71 A;  3IMM A;  2JDH A;  1RIT A;  4HXC A;  4LIU A;  2HJI A;  5JR2 A;  2GDF A;  3ZYP A;  4HAN A;  5AFE A;  3WDU A;  2DYC A;  3AP4 A;  3AX4 A;  3I7D A;  5FZ6 A;  2HYK A;  4FPE A;  4AGV A;  4A6S A;  1S0E A;  2R7E B;  2GP5 A;  1YQC A;  2DVB A;  5I0T A;  1US2 A;  4ZS2 A;  5FZ4 A;  1FT9 A;  2C4X A;  3GZA A;  4HG6 B;  3PMS A;  2QQV A;  5T54 A;  1H6X A;  3LQC A;  1UY2 A;  2VUC A;  1AZD A;  2C6S A;  1H8T A;  1ZM1 A;  2Y6L A;  2YFU A;  1H1A A;  3E5X A;  5CVR A;  3ACH A;  3ZXG A;  5FPV A;  4CCC A;  4WBB A;  4NII A;  3V0A B;  2E7Q A;  4Y1U A;  1CAW B;  4XJA A;  3B9C A;  1MZE A;  3WDT A;  2R30 A;  1MQT C;  5JXJ A;  1BBT 1;  4OQ8 A;  5D8A C;  4P9J A;  2W1Q A;  3MIC A;  2WNV B;  2RS5 1;  5T50 A;  4LE3 A;  1CVN A;  1W28 A;  5T5O A;  4F83 A;  5CFC B;  2C5D A;  3ZR6 A;  2OA2 A;  5BV6 A;  4MGK E;  4DO0 A;  2D5F A;  3WQB A;  1OKQ A;  3J7H A;  3PME A;  5C3Q A;  3O1T A;  2VCB A;  5FJH A;  1VR3 A;  4QQO A;  5FZO B;  4AR2 A;  3MPB A;  1W6O B;  2UYB A;  2UY8 A;  3GGL A;  4F8A A;  3TNQ A;  5A1L A;  1RUH 1;  3I54 A;  4P9G A;  3O1U A;  3H3U A;  2VBP A;  2FQP A;  4EZ4 A;  2ZKN A;  1PZ9 A;  4OZO A;  4PF5 A;  1W2O A;  4K21 A;  2CU5 A;  3KF5 A;  1C28 A;  5A1A A;  2EID A;  5FZ9 A;  3UL2 A;  1IS6 A;  4NIH A;  3POB A;  1HKD A;  3AZW A;  2WZP P;  2VZT A;  2Z2S B;  4LXL A;  4NIG A;  4OUS A;  1KJL A;  4PBO A;  1W6Q A;  1ZZ6 A;  4IE4 A;  4E9K A;  1QOO A;  3AB0 A;  1AR7 3;  3QCW A;  2A71 A;  1UXX X;  1QKQ A;  1N3P A;  1VAV A;  2RS1 3;  3VBS C;  3IDA A;  4JV4 A;  4BDV B;  2DUR A;  1WZX A;  4CUC A;  2VG9 A;  2Y6K A;  3IB3 A;  3KV6 A;  4WVV A;  5FY8 A;  1TME 3;  3VBH A;  3BAL A;  5FZE A;  2WN3 A;  1CIW A;  2HWE 2;  5CFD B;  4QKD A;  5KHI A;  2PYT A;  5BYN A;  2ZML A;  3I2G A;  3PIG A;  1NY7 1;  1AUY A;  1Q8P A;  5FZ1 A;  4NID A;  4LHL A;  1JZ3 A;  4HVR A;  2XWB B;  1XSR A;  4AFM A;  2FMY A;  2D6K A;  3VHP A;  2YU2 A;  1GU3 A;  2P6C A;  1RJ8 A;  3HR9 A;  4FFF A;  4KU7 A;  3ZFG C;  4AGR A;  1BEV 3;  1LR5 A;  1AR9 3;  4XHX A;  4A6O A;  5FZ7 A;  3MV1 1;  4JGY A;  2QQJ A;  4QGN A;  1W9F A;  5I93 A;  2XJP A;  5F8P A;  4KI5 M;  1SLI A;  4XBL A;  2H6C A;  1UW8 A;  5FIX A;  1SMV A;  1HQW A;  1SQ4 A;  4DXS A;  1F4H A;  4LKD A;  4ZZ8 A;  1LGB A;  5ABJ A;  1JYT A;  3VBU C;  3ZFF A;  3HAG A;  3FJS A;  3HOB A;  4X6Q B;  1IS5 A;  2WWS A;  4H14 A;  4YRD A;  3W9A A;  3ZFG A;  2RR1 3;  5L73 A;  4PLO A;  3NNL A;  3WDY A;  1QJX 1;  1HRV 3;  5BNN A;  4HFS A;  5FOB B;  1PK6 A;  3ZYR A;  2WQZ C;  1HB1 A;  1OLM A;  3ZYB A;  1ZA4 A;  2ZPX A;  3PUQ A;  1H4H A;  2JDZ A;  2YY1 A;  4QPW A;  1RHI 3;  4CDW B;  2G9F A;  3ZSL A;  4D3W A;  5AC9 2;  2WT1 A;  3H7J A;  2O0O A;  3RWK X;  2Q8C A;  4LO7 A;  4PQ9 A;  3BOD A;  2ET1 A;  1J1L A;  4GWI A;  4DB5 A;  1UZW A;  1O4Y A;  4FPF A;  5FYB A;  1WW5 A;  3U10 A;  2JKX A;  2F17 A;  5L9V A;  4BLJ A;  3RGB A;  5BXX A;  5A1F A;  4CU6 A;  3W5M A;  4W6Y A;  2E7A A;  3WCS A;  2ZHK A;  5FRE A;  3ST7 A;  1AR6 2;  1UOJ A;  3H8X A;  1TMF 2;  5FOJ B;  2ZAH A;  3PUA A;  5JXI A;  3SCH A;  3OEB A;  4DY5 A;  3CJX A;  5T52 A;  1QHD A;  1W3V A;  1TNR A;  4JGZ B;  4KMQ A;  3KV5 A;  5AVA A;  1AL0 G;  2RR1 2;  4YW2 A;  3VZJ A;  1MZ6 A;  4A7Y A;  1ZZ8 A;  4CP0 A;  4CVU A;  2XVK A;  3NNG A;  5EQU A;  3F2Z A;  3TB0 A;  3L9J T;  1W2A X;  2E6V A;  4DNY A;  1WBF A;  4JQT A;  2R06 2;  1W8O A;  2XOM A;  1YNA A;  2ZZQ A;  4MSV A;  4AQS A;  5C33 A;  2RS3 1;  2JWP A;  2PXJ A;  3WF2 A;  4IGP A;  3O0X A;  2ZGQ A;  3WG2 A;  3U37 A;  2WC2 A;  4LBK A;  5FPU A;  4BCU A;  5J7M A;  5K0U B;  4XAE A;  4NHK A;  2MNG A;  1DCS A;  2JG9 A;  1GZW A;  4I0W B;  3U0Z A;  3WV6 A;  3WCR A;  5I0D A;  1QWR A;  1DG6 A;  1PM7 A;  3SHR A;  4AFD A;  1EY2 A;  5E8A A;  3AMM A;  4BJ0 A;  1GZC A;  2RMU 1;  3FLP A;  2PHX A;  3T4V A;  5A3N A;  3IAQ A;  4C1X A;  1TME 1;  5EJZ B;  5JLV A;  4URA A;  2WZR 3;  1JZ2 A;  2OPW A;  2E33 A;  2JG9 C;  4D0Q A;  2FZ2 A;  2QQU A;  4WM7 B;  2H6B A;  2PEL A;  2PHW A;  3LA2 A;  1MQT A;  1N1Y A;  1ULF A;  3NW4 A;  1VBB 3;  3KSC A;  2QQL A;  4JTO A;  1AR7 1;  4R9B A;  5FQ0 A;  1L7R A;  2Z69 A;  5FMC A;  1O3T A;  2UWA A;  3VDB A;  2VNO A;  2OX0 A;  4AXO A;  3RDI A;  3D4K A;  1RUH 3;  2QUO A;  4RS5 B;  1WW6 A;  3I59 B;  4Y22 A;  4Q26 A;  4ZPI A;  3RYR A;  4YGC A;  1RVF 2;  1PMI A;  3VKN A;  2WO1 A;  1Z0H A;  3NMB A;  1N3O A;  4KU8 A;  3ZXD A;  4CCJ A;  1LEN A;  1U12 A;  1O91 A;  2JX9 A;  4IES A;  4Y1V A;  5IVE A;  1ZX5 A;  2C0Z A;  3IAP A;  1TG7 A;  1QJE A;  2UY9 A;  3ZKU A;  5FXX A;  3WDW A;  4Q0P A;  5IWF A;  5F6L B;  5B2G B;  4LIV A;  3ZXJ A;  1QJY 3;  1S0C A;  4OUM A;  2ETE A;  1F5F A;  3FLR A;  4X8N A;  3UKV A;  1VBB 2;  4QX1 A;  2E32 A;  1NE6 A;  2TNF A;  3I2J A;  3GHN A;  5EIY B;  2OT7 A;  4MGZ E;  3VDD A;  1LB2 A;  3VZM A;  3W21 A;  2OZJ A;  4K3U A;  3UES A;  3HWJ A;  3J7M A;  4JRL A;  2Q4S A;  1WLD A;  4CUB A;  3RZK A;  1VP6 A;  2K46 A;  3EYP A;  4CU9 A;  2HYX A;  5A3L A;  4E2S A;  1HXS 3;  1ENR A;  4XDO A;  2QTW B;  5FR3 A;  2A3X A;  2A1X A;  4EN0 A;  3FWE A;  5JSP A;  3UKT A;  4D6R A;  4GWM A;  4PI0 A;  4DPN A;  4AED B;  3N7K A;  4GAZ A;  4IXL A;  1UAI A;  1VRB A;  5A3W A;  2VL4 A;  3U14 A;  4IND A;  2Q30 A;  3FUO A;  4GD4 A;  4BYY A;  2XHN A;  3LFM A;  3DPR B;  2RM2 3;  4NRO A;  4QXK A;  2UUR A;  2EVX A;  2D43 A;  2HWC 1;  4RR3 B;  5GKA C;  2VMD A;  4AQ2 A;  2DTY A;  5FZK A;  4AI9 A;  3N9Q A;  4XZP A;  1BK0 A;  4YG6 A;  1O8S A;  2BER A;  4B7K A;  2GNB A;  4LR4 A;  4AHX A;  5JI7 A;  5CFC C;  1QXJ A;  1YO8 A;  3ASI A;  4RN5 A;  2B4K A;  3CLP A;  2XJV A;  5FY1 A;  4Y5T A;  2W3J A;  1CZV A;  1OLQ A;  1QXP A;  1C5I A;  1YFY A;  4LOR A;  4YG0 A;  1QNW A;  4GZ9 A;  5E16 A;  5GZF A;  3WF1 A;  1WA4 A;  2EF6 A;  4BQY A;  4XF9 A;  1CX1 A;  2ID4 A;  3BVC A;  4SBV A;  3VBU A;  3ZFF C;  1H0B A;  1ZBE 3;  2WYF A;  3HT1 A;  3OD4 A;  5KHK A;  4YM2 A;  3VBF C;  1JI6 A;  1OD3 A;  1PK6 C;  4O9G A;  1QH6 A;  4NE9 A;  3ZIW A;  1JN2 P;  2XVL A;  4EN9 B;  1KIT A;  3IMN A;  4KL1 A;  4R4Z A;  4DEQ A;  2RDQ A;  2VQT A;  1IHM A;  3C7H A;  1KS4 A;  2RHP A;  2EXH A;  3PTY A;  5ANQ A;  3WHT A;  4GH4 A;  4QKF A;  3DUI A;  3B02 A;  3MW3 A;  1D2S A;  3M1H A;  5KC5 A;  3N9L A;  4AHY A;  1O59 A;  1OQD A;  5F32 A;  1MS5 A;  2P6H A;  1CJP A;  2NN8 A;  4CP2 A;  4XUQ A;  4HLT A;  2WNU A;  3ZDV A;  1FI2 A;  4O65 A;  1XNK A;  3MIB A;  1Q3E A;  4P00 B;  1CAW A;  1C8M 1;  3D8C A;  4XF3 A;  5CFD A;  1E5S A;  3I3B A;  3TEX A;  4OUL A;  2BJS A;  1OLM E;  2Q8D A;  3VZO A;  4CZS A;  3LSD A;  1VBE 2;  4QDS A;  3ME2 A;  3USS A;  4YVW C;  4M4P A;  3USU A;  2ES3 A;  4XEZ A;  4ONU A;  1O5L A;  4AI2 A;  4RFR B;  5LWB A;  3NV4 A;  1ULP A;  5HV4 A;  4CUA A;  1H8T C;  4CU8 A;  4CEW C;  1RMU 3;  3ZXL A;  5JCT A;  1RUE 2;  5IK4 A;  2BGO A;  4HOO A;  3WNO A;  3ZO0 B;  3DXU A;  5K9Y A;  3FC0 A;  3T2O A;  3N9P A;  2Y6F A;  3MDP A;  3AC0 A;  1F2N A;  2C9A A;  4ERO A;  3OGJ A;  1ZZ7 A;  1V6J A;  4IV1 A;  1YC6 1;  1HQL A;  3OJB A;  1SFY A;  4BLI A;  5C9A A;  4XUP A;  1VBB 1;  1EP0 A;  2BFU S;  2RS1 2;  3ZVX A;  1HN1 A;  3OUI A;  4GXL A;  2AEN A;  1JS9 A;  4QM8 A;  3UKN A;  1BMV 1;  1ULO A;  3ZMO A;  2HEV F;  2QFE A;  4Y4Y A;  4Q4X 2;  4RD7 A;  2D40 A;  1SLT A;  4KH9 A;  4HT1 T;  2YGM A;  5IK5 A;  2BQP A;  1ZZC A;  1NXM A;  2HKX A;  2R06 1;  1COV 1;  1JYV A;  1ONA A;  2RG4 A;  1PIV 1;  2GP3 A;  2MHF A;  3K75 B;  4FO9 A;  1RMU 2;  3IIA A;  5LA9 A;  4AWD A;  3SC7 X;  1IZ3 A;  5DUV A;  1EUU A;  3U4S A;  4Y20 A;  4XAB A;  1CPN A;  2X5I B;  2MEV 2;  1EAH 1;  5IT6 A;  4XUR A;  2DCK A;  1XNA A;  4M4R A;  3CHX A;  1O3S A;  4QX0 A;  2VGD A;  1POQ A;  4ZXE A;  2PHU A;  3KQ4 B;  3NST A;  3WP5 A;  4JGZ A;  2PQS A;  4AQT A;  3EB7 A;  4Y3O A;  1O8P A;  1LOF C;  5A3M A;  2J42 A;  4FOV A;  1SLB A;  3A4U A;  4MGY E;  2F6B A;  1VE0 A;  2FCT A;  4GKY A;  5FYM A;  5C70 A;  5IK8 A;  4DIN B;  2DCJ A;  1AYM 1;  1QOT A;  1U0A A;  4RQP C;  4J1X A;  4A44 A;  4DXZ A;  4HSL A;  5J1X A;  2V5D A;  3WNX A;  2XWJ B;  4PDW C;  3U11 A;  4TWT A;  4XVH A;  2P37 A;  3S5Q A;  1O3Q A;  1XU2 A;  5FPB A;  4OI2 A;  4ES8 A;  4BZ4 A;  1NLS A;  5FZM A;  2XR4 A;  4LUM A;  3GCW A;  4UBH A;  4OVE A;  2XL7 A;  2Y0I A;  4BQX A;  4FBF A;  3NVC A;  1UNB A;  2SBA A;  5LW9 A;  4COV A;  2ZGS A;  3S7I A;  1GZT A;  1RUN A;  1RUO A;  4YZ2 A;  4Z92 B;  1UD1 A;  5A3T A;  2OS2 A;  4OHZ A;  3AK0 A;  2VVF A;  2FDF A;  2WSU A;  2VUJ A;  4Z07 A;  4CDW A;  3NWK A;  4S2G A;  4XUO A;  3V56 A;  5JOX A;  4CSW A;  2WLP A;  4O9E A;  4C0B A;  2MPF A;  4ZU7 A;  4RQP A;  3K51 A;  1D2Q A;  1CON A;  1XE8 A;  1OFN A;  1UOB A;  4EN8 B;  1W04 A;  2R1B A;  2P5B A;  3JBG 3;  2A7A A;  2VR4 A;  1VAL A;  1BMV 2;  4CCM A;  5FPA A;  3UNP A;  1S0F A;  1LKN A;  1VBC 1;  3AXE A;  5BNN C;  2P34 A;  5GZE A;  5L19 A;  2XJR A;  4LUK A;  1QJZ A;  5FYC A;  2YXS A;  3ZFE B;  1QIQ A;  2Z42 A;  3RJR A;  3QH7 A;  3HD8 B;  5ISL A;  4FQ4 A;  2Y60 A;  2YUE A;  4Q1P A;  1V6I A;  3UV9 A;  2X5I A;  2K0G A;  4XIL A;  3A22 A;  2HLE A;  1A8D A;  1HLC A;  4NRM A;  3JQX A;  3K2O A;  2XUE A;  1Y9G A;  2D98 A;  3BB6 A;  5I0R A;  4HKO A;  5C8C B;  3NJY A;  4L9B A;  1UIK A;  3WHU A;  4UF0 A;  3MHZ A;  4B8E A;  3LSE A;  1HJF A;  2JEN A;  1QQP 2;  1JUH A;  1ZBA 3;  2O8Q A;  3VBO B;  3WNK A;  1X33 A;  4CEW A;  3JU9 A;  2X05 A;  2ZAB A;  5A70 A;  5ABJ B;  3AZX A;  3IDB B;  4WVW A;  4YSF A;  1UXZ A;  3DYO A;  4XFH A;  4GH4 B;  3HN3 A;  4OQ9 A;  3TEY A;  1CN1 A;  4N43 B;  3WF0 A;  4CCD A;  3PL0 A;  2AZ5 A;  1CPM A;  3G6J B;  3RSJ A;  3NV2 A;  2ZX2 A;  4A41 A;  2VMC A;  1AF9 A;  1WLW A;  2W95 A;  4LNV A;  2YBP A;  5FYI A;  1OVS A;  1UU5 A;  3UJO A;  4DIQ A;  4WV8 A;  4FPL A;  1M06 G;  4ASL A;  1ASJ 3;  3DPR C;  5JMO A;  2XDV A;  4YVW A;  4Q0S A;  4CEY C;  4COY A;  4PHZ A;  5JXH A;  1H2K A;  5FZG A;  1CZS A;  5FY0 A;  5I8S A;  5L7O A;  2XL9 A;  2XJQ A;  3T0B A;  1S1A A;  1NX9 A;  2JDA A;  2UWB A;  4GIQ A;  4DQA A;  4NN0 A;  4XPV A;  5L7O C;  3OUJ A;  2BGC A;  3USU B;  3A0N A;  5HXV A;  2DVG A;  2HEY F;  2XB6 C;  3WG3 A;  3B01 A;  3ZPY A;  2CV6 A;  1K5J A;  1LCL A;  5FZC A;  5A6Q A;  4RHV 2;  2MEV 3;  3I4I A;  4TLF A;  4XF0 A;  1J59 A;  3H0O A;  3P3N A;  2RJK A;  2G1M A;  4IER A;  3JQW A;  4FAG A;  1BKZ A;  3U78 A;  3E6B A;  3IPV A;  2O8O A;  4QHB A;  3KT1 A;  4IDZ A;  1GKB A;  2ZGL A;  3FLT A;  4D6S A;  2XLG A;  1H2N A;  1LED A;  2WWU A;  3E6D A;  4UOJ A;  5JI9 A;  3KVA A;  2P3Y A;  1ST8 A;  2ZOE B;  3AKR A;  4I02 A;  3KGL A;  2RVA A;  3T2P A;  4QHO A;  2IXI A;  4HN0 A;  4CCO A;  3EO6 A;  4NWW A;  3AYE A;  4QKB A;  4WVM B;  2BGP A;  1E5H A;  2XUM A;  2D93 A;  5J98 B;  3WP4 A;  4JQR A;  1G9A A;  3GBG A;  2R06 3;  3ZXA C;  1QNY A;  2JD4 A;  4C91 A;  2ZHN A;  4XET A;  2E9Q A;  3VBU B;  4XQ4 A;  4BXS V;  3M3C A;  1UCX A;  3GZT B;  5D8A A;  3VD7 A;  4XBQ A;  3OB8 A;  1A8M A;  4JZR A;  4AI1 A;  1RUG 2;  4N9H A;  2HBU A;  1KXG A;  4QX5 A;  4QX3 A;  4CDX B;  2QZ3 A;  3VKF C;  2ZEX A;  5F3I A;  1YEW A;  2DCZ A;  5F37 A;  5K4L A;  1JHJ A;  4RR3 A;  3OGV A;  5A80 A;  3VD3 A;  4LHK A;  3PUS A;  4BH9 A;  1GAN A;  2RDS A;  3AKP A;  1GZ9 A;  3HBK A;  3JBG 1;  5KXC A;  2CDO A;  3B7M A;  4IE0 A;  2W08 A;  1XSQ A;  1VBC 3;  1RUI 2;  1JH5 A;  1JUI A;  1QJF A;  1V6L A;  2W1W A;  3ZIX A;  2D3P A;  4MOA A;  4SLI A;  1RMU 1;  4XMA A;  2XPJ A;  4DUV A;  3R0R A;  1VBA 3;  3MID A;  4YLZ A;  4LBQ A;  4YVS A;  1WME A;  2HH9 A;  1AXY A;  5T5P A;  3AFG A;  3RMY A;  3VUO A;  4YVS C;  2HWD 1;  1CD3 G;  3I3E A;  1UKR A;  1UF2 C;  4W8J A;  5FP7 A;  1OUX A;  1DZQ A;  2GME A;  3FHQ A;  5FQ0 B;  4BQ2 A;  1WCQ A;  5LY2 A;  1RUD 1;  2ARX A;  3I49 A;  4HZF A;  1PZ8 A;  1DHK B;  2BW8 A;  5T3N A;  4YW6 A;  1EV1 1;  3S5A A;  1W9Y A;  1ZNP A;  2BU9 A;  3OD0 A;  2R0H A;  3S7E A;  3OY8 B;  4WM8 C;  4LMF A;  2PAE A;  4H2A A;  2AR6 A;  3BPZ A;  5TSW A;  5JZG B;  2JDK A;  2BUK A;  4I3P A;  1ULD A;  3ATG A;  2V4V A;  4BB3 A;  2DUO A;  1QMJ A;  4AFC A;  1GR3 A;  2YYO A;  1LU2 A;  5K0U C;  2JEC A;  5A33 B;  3RFR A;  1W8N A;  2P3J A;  3BI3 A;  3WZ1 A;  2D6L X;  1UPI A;  2XVG A;  5FUP A;  3THT A;  4CDU B;  5F3G A;  4ET7 A;  1EAH 3;  3J8F 2;  2L9L A;  2AGS A;  3E5U A;  1KDM A;  2W5F A;  3KT4 A;  4XW3 A;  1OPO A;  4FFI A;  4CE8 A;  1J83 A;  5DAQ A;  5E89 A;  4ASM B;  4NMI A;  1YLL A;  3PJY A;  4KG8 A;  2B8M A;  5IFP A;  4DXT A;  1YQ5 A;  4FPY A;  4ARX A;  2HWB 1;  1S2E A;  1U5I A;  2PLV 3;  3E97 A;  3ETQ A;  3WNP A;  1ZBE 1;  4E27 A;  3AYA A;  5KHG A;  4LIT A;  1BVP 1;  2IWG B;  1D4M 2;  2HEW F;  4ISR A;  1JU4 A;  4FCA A;  4MHR A;  5HCB A;  4A4A A;  1LOG A;  1NE4 A;  5CNA A;  4CDX A;  4UFL A;  2D97 A;  5BNO A;  4Z2A A;  4IL7 A;  3VBR B;  4HON A;  3CZU A;  1PNG A;  1YCI A;  3DEM A;  4GJZ A;  4ATE A;  2D6O X;  2QCS B;  4UYB A;  1ND2 A;  1JZ5 A;  3BPS A;  5A7Q A;  1LUL A;  1TNF A;  5FP8 A;  2BFU L;  4XFC A;  1BVV A;  1PNF A;  4IEQ A;  1FX5 A;  5IVV A;  3R6S A;  1VMH A;  1V70 A;  1FNY A;  5DAV A;  3ZXE A;  1PX3 A;  5T5L A;  1XC6 A;  4CDQ B;  3H9A A;  1G9D A;  4YGD A;  2WZ8 A;  1FPN 1;  4Q2F A;  2IC1 A;  3VHO A;  3FFQ A;  1AYN 3;  2LRP A;  2ZGO A;  2PHL A;  3PVO A;  1FNZ A;  1FOD 2;  1JZ6 A;  4CEY A;  1V9U 1;  1MAC A;  4FP3 A;  1UY4 A;  1IPS A;  4RGK A;  4K6B A;  4FXK B;  2WAO A;  2VQA A;  1YUD A;  3X29 B;  1BXH A;  4UFI A;  3JD7 2;  1A6C A;  2E31 A;  1GP5 A;  3AXD A;  2CWM A;  1OPM A;  1Y9Q A;  3SKJ E;  4L92 A;  2OQ7 A;  5LAS A;  1YJK A;  1YFW A;  1XPW A;  2A75 A;  4ZU4 A;  5JPM B;  3OPZ A;  4K8F A;  1KGY A;  4Q4W 1;  2J1A A;  2FDJ A;  3NV1 A;  2ZAC A;  1W0P A;  4AAX A;  1GP6 A;  3B00 A;  3AP5 A;  4GMP 3;  3TN9 1;  5KWR A;  4TZD A;  2ZHL A;  1BQP A;  4RR3 C;  1BJQ A;  2OVU A;  1NA1 A;  4AG4 A;  2WL1 A;  1X7N A;  2WZR 2;  4MXV A;  5FWJ A;  4Y1Z A;  4Q5O A;  1JW6 A;  2VUA A;  3K3N A;  4V1P A;  4D6Q A;  5ACA 2;  4ZXK A;  2XLA A;  3O0V A;  4BXF A;  4FVV A;  1K5M C;  1UMI A;  4P9Y A;  3CJI A;  2VOK A;  5FP4 A;  1RB8 G;  3LF7 A;  2YU1 A;  3OEA A;  4S2H A;  1H1I A;  3CQO A;  4HL0 A;  4N8M A;  4AVT A;  5LAT A;  5HBA A;  4AAP A;  4GMP 1;  3E1F 1;  4Y5Z 0;  2VOW A;  3WXP A;  1W9W A;  3VBF B;  4E4H A;  2WII B;  2XON A;  1XQN A;  4R8H A;  1OUS A;  5AFB A;  4A2U A;  1DQ6 A;  4K1Y A;  3MLK A;  1ODM A;  5DDJ 3;  4BA6 A;  4RA0 A;  4Z8B A;  2VZO A;  5SV8 A;  4LA3 A;  4C1W A;  3VBS A;  3GBF A;  4A3Z A;  4XJ9 A;  1E5R A;  2ZXQ A;  3LOI A;  1RUD 3;  1SDW A;  3C2U A;  1GQH A;  1F31 A;  4CXW A;  1G9F A;  2JEM A;  5EXO A;  3VBR A;  3M4F A;  3TRS B;  5C3S A;  1DGR A;  4AE2 A;  2ZGM A;  3LAG A;  1SLA A;  4AFB A;  1XOY A;  2HWB 2;  1W8W A;  1UY0 A;  1X8E A;  4Y5S A;  1R1Z A;  2WNV A;  1OFS A;  2B9V A;  3AMP A;  4OFG A;  1NQJ A;  1QY4 A;  1WW4 A;  2EXI A;  3LD8 A;  4WVZ A;  3ZMN A;  4AFA A;  5H9R A;  2PQQ A;  3JD7 1;  4E8D A;  3T3Y A;  5C8C A;  2BOJ A;  1H9W A;  1RC6 A;  2K9Z A;  1LNS A;  2PLV 2;  4KGG A;  3OF1 A;  1DGW X;  4NHM A;  3E6C C;  1E5I A;  3C7F A;  1C8N A;  2FZ1 A;  2XLF A;  4AVB A;  1AXK A;  1OMI A;  1COV 2;  2EXJ A;  4JKM A;  4FTB A;  1HB4 A;  4Q0Q A;  1QJX 3;  1AL2 2;  4EN6 B;  4XMI A;  4KWK A;  1OD5 A;  5FZO A;  2JDN A;  2WNE A;  1RUC 3;  1OVP A;  1RUE 1;  2F4L A;  3B9I A;  3M3I A;  4AQ6 A;  2VTF A;  1ZRE A;  4P9W A;  2HWB 3;  4OHW A;  2RV9 A;  1FV3 A;  2VQ0 A;  3HN1 A;  2HWE 3;  5A6X A;  4COZ A;  4B29 A;  3BCW A;  1CAU A;  3ZSK A;  2YDE A;  2NYY A;  3MI8 A;  5L9R A;  2W47 A;  4A7Z A;  1GQP A;  4V2W A;  3KQR A;  2ZGK A;  5HCH A;  1AR8 3;  2P3I A;  1YQ6 A;  2RS5 2;  1KQR A;  4YAR A;  1OI6 A;  1SEF A;  2J1E A;  2BZD A;  3VZK A;  3MFA A;  3FUQ A;  5JOW A;  5J37 A;  3LZZ A;  5IAT A;  4LA2 A;  4MGI E;  1WBL A;  2BP6 A;  1MR5 A;  4J6G A;  1R1A 3;  4AOC A;  4NJ4 A;  4QM9 A;  2JE9 A;  4Q4Y 3;  1U5X A;  4FP2 A;  5BNO C;  3VD4 A;  1XYP A;  4YVS B;  1H2L A;  4GKX A;  3DXT A;  3AKT A;  1FAT A;  2DBI A;  2H0V A;  4LKS A;  4Y26 A;  2YB7 A;  3U1X A;  2WZR 1;  2HWD 2;  2ZMN A;  1ENS A;  2CGP A;  2UWC A;  1DZR A;  1YWK A;  4QPG C;  1N3Q A;  1V00 A;  3CBN A;  2R04 2;  2HWC 2;  3IWZ A;  4K7J A;  3HPN A;  5C5T A;  2FDK A;  2VE1 A;  4QPG A;  5FJK A;  4IV3 A;  5J48 A;  1LHV A;  5FTT C;  1JYW A;  1OOP C;  3T0A A;  5CEH A;  3T08 A;  2X29 A;  4Q27 A;  5CKM A;  3III A;  3WDV A;  3ZPO A;  1IPJ A;  1HRI 3;  2ZX3 A;  4MUV A;  4QQP A;  5FP3 A;  3ES1 A;  3JZV A;  2LTN A;  3K4Z A;  3UK9 A;  2QBX A;  1F15 A;  3ALQ A;  1Q56 A;  2P4E A;  4JHZ A;  4AEJ A;  2GAL A;  4OMC A;  5KHJ A;  2GNT A;  4W50 A;  1W6M B;  3WW2 A;  4LBN A;  4E4Z A;  4LO5 B;  1RUG 3;  1SAC A;  2WLQ A;  5HXM A;  4XYX A;  2VTX J;  2XH6 A;  4FAH A;  1HXS 2;  1DGW A;  1DLL A;  1FMD 1;  1SBF A;  2XBO 2;  2ZMK A;  3LDB A;  4LOT A;  4QDR A;  4CCN A;  3PUH A;  5A7S A;  2XG3 A;  3QAC A;  2P3K A;  4JDN A;  2VO5 A;  2WJS A;  3OGS A;  1B35 A;  4FXG B;  5FMO L;  2DU0 A;  5LK7 B;  4BQ3 A;  5EWS A;  1B35 C;  1ZRD A;  2D3R A;  1XNT A;  2DBN A;  2WUH A;  3Q8B A;  3KGZ A;  1GOH A;  1RUF 3;  1UQX A;  2J22 A;  4BQ1 A;  2XJT A;  1CAX B;  1FPN 2;  3MBW A;  5I0S A;  3Q8C A;  1Z78 A;  4L99 A;  1GFF 2;  1JXN A;  1UPS A;  4PLM A;  1CES A;  2QJV A;  3I3D A;  3PJQ A;  1OKO A;  3POY A;  1BYH A;  3ZYI B;  4GJY A;  3NJZ A;  3FBM A;  4GWN A;  3ZN5 A;  4KNC A;  1GBG A;  2IFR A;  2WN2 A;  4XAC A;  4NHX A;  4DFS A;  4A7K A;  1LAJ A;  1W39 A;  1WA6 X;  3HVD A;  3GJA A;  3WP3 A;  3E5Q A;  3NAP C;  4LKF A;  1D0H A;  3BN6 A;  4GAL A;  3V0B A;  3D3A A;  4JGY C;  2OUH A;  4AZZ A;  1SFN A;  4FTS A;  3AZY A;  2ZTN A;  5KHH A;  4YW3 A;  3ZYH A;  4BMB A;  2I45 A;  1UMZ A;  2W92 A;  1CJD A;  1ULE A;  2NQY A;  3CMG A;  3S57 A;  2ZA9 A;  4MG2 A;  3AJZ A;  3AYC A;  1EAH 2;  1V6O A;  3J8F 3;  4KBZ A;  3W58 A;  1MVE A;  1PVC 3;  4Q0V A;  5ABJ C;  3KCY A;  2QQI A;  4ITC A;  3RZJ A;  1YI7 A;  1PGW 1;  3QD6 A;  4UFM A;  4UW3 A;  2BWA A;  2YFZ A;  3DCQ A;  2DU1 A;  2WFF 3;  4W65 A;  4XOG A;  5CU1 A;  2WIN B;  1GWK A;  2ORX A;  4LK6 A;  1CWP A;  3W59 A;  2W91 A;  3R4U A;  1AR7 2;  1WCS A;  1G86 A;  4PIX A;  1QQP 3;  1LGC A;  1Z7S 2;  2LUW A;  5IYY A;  2R0F A;  2FDI A;  4HPK B;  3LEK A;  1FMD 2;  1VBD 3;  2XBO 1;  1YQ8 A;  2GN3 A;  4CEY B;  5H9S A;  1JMU B;  2QKD A;  5C4W B;  4U36 A;  1XRU A;  1XU1 A;  1W06 A;  4QAW A;  3N35 A;  3OBZ A;  5FLI A;  5L7O B;  3OGR A;  2OW4 A;  5LRS A;  3BYW A;  4Q4Y 1;  2ZZJ A;  5JR7 B;  3UGF A;  1DFQ A;  2RM2 1;  2YBS A;  1IS4 A;  4A42 A;  5CFC A;  3G7D A;  2VME A;  4N53 C;  1RUI 3;  1O4Z A;  2WFP A;  3I2K A;  3SH4 A;  2QDR A;  3ZM8 A;  1I9R A;  1AR8 1;  1DYP A;  3J7N A;  2YPJ A;  2FDG A;  4ZY9 A;  1S4C A;  5FXZ A;  4YW4 A;  1MS1 A;  4OLL A;  3KF3 A;  4NPM A;  4QX7 A;  3HBZ A;  1HW5 A;  2VCC A;  4P08 A;  1YRZ A;  1SPP B;  4JX0 A;  5DUX A;  5C8W A;  4RGA A;  1RUC 2;  3AMQ A;  3ZXF A;  2YBK A;  1W6P A;  3LIG A;  4YZ3 A;  5FZA A;  1WD3 A;  1VLN A;  4IGQ A;  4CCL A;  1DLC A;  1HJG A;  3FHA A;  3H8U A;  3KZ4 C;  4A3X A;  3PUI A;  3C7G A;  1O3R A;  3ACF A;  2BPA 2;  3Q8A A;  2CGO A;  4ASK A;  2D5H A;  1XNB A;  1CIY A;  2GMM A;  3C7E A;  2ZS6 B;  2JJ6 A;  3D6E A;  4LBJ A;  3S30 A;  1GOF A;  4QU2 A;  4R9C A;  4YFZ A;  5DDJ 1;  1J3Q A;  1RHI 1;  2ZEW A;  3OTF A;  5A33 A;  3WUC A;  1J1T A;  1OQE A;  3VDD B;  3ZR5 A;  3LWC A;  3OBA A;  1H2M A;  1NOV A;  1AR6 3;  4MLO A;  5E88 A;  1GLH A;  2VZP A;  3ABZ A;  4YWA A;  4GB3 1;  1UY3 A;  1W9S A;  5DG1 A;  5KXB A;  2WS9 3;  3ZN6 A;  1QJU 1;  4C90 A;  4IV3 B;  3DV8 A;  1ULC A;  4BIS A;  2BWC A;  5DXD A;  3B69 A;  4NAO A;  4PCR A;  2Y6G A;  4TSV A;  2XQR A;  1J58 A;  5A6Y A;  3BU0 A;  2WO2 A;  1S55 A;  1CAV B;  3THP A;  1QF3 A;  2K2S A;  2OZ6 A;  4UFJ A;  3DYP A;  2IXH A;  4KWL A;  3VDC A;  5D21 A;  2V72 A;  3WP6 A;  3ZSM A;  2A3W A;  2VMG A;  4PT6 A;  4QWN A;  4B4R A;  4EE2 A;  3ETP A;  3BUC A;  1DF0 A;  5E1R A;  2PAK A;  2ZCW A;  2VW1 A;  5FY5 A;  4LE4 A;  2A5Z A;  2GND A;  3H42 B;  2CHH A;  5LEJ A;  4QX8 A;  3MLL A;  3NRU A;  2KA3 A;  1YFU A;  1Q8Q A;  1PM4 A;  1RUE 3;  1D4M 1;  2JB4 A;  3HNB M;  2VD7 A;  1ZBE 2;  5FWE A;  2ZX1 A;  4ARY A;  1SLL A;  1NQD A;  2R07 3;  3WR0 A;  4XJU A;  5LEK A;  2UYA A;  2NP0 A;  1C8M 2;  5HCA A;  1UYX A;  1MS9 A;  1WKY A;  5FXV A;  1HX6 A;  4N7U A;  5D8A B;  4H7M A;  4FOW A;  1G6N A;  1L7L A;  3MGU A;  5FO9 B;  3ENR A;  4GB3 3;  1F4A A;  2EA7 A;  2JG8 B;  1T6G C;  3PHM A;  4X6R B;  1PMH X;  3WNM A;  4R4X A;  1H30 A;  2X09 A;  5A32 A;  5EZW A;  4CXX A;  3VD5 A;  5DPN A;  2J7M A;  1VAM A;  4I09 A;  2WKK A;  2HWF 1;  4K1Z A;  3DGT A;  3CKH A;  1KJR A;  2E26 A;  4QXH A;  4XJZ A;  3LB9 A;  1D4V B;  3FBY A;  2DV9 A;  1OH4 A;  4QU1 A;  1NCQ A;  5J3U A;  1RUG 1;  1POV 1;  1TMF 3;  4OZX A;  2G4I A;  2RDR A;  5IVF A;  1KD7 A;  1W03 A;  2ARE A;  4FOQ A;  3N4M A;  1IQD C;  3WIN E;  1J3P A;  2X53 S;  3QOP A;  1PVX A;  5EJ1 B;  1TE1 B;  2RR1 1;  1G9B A;  1G9C A;  2ARB A;  2CL2 A;  1ZA7 A;  2Q5T A;  4BIO A;  1HB3 A;  3H1W A;  4NHL A;  3KVB A;  2BRT A;  4Q4W 2;  3S0M A;  1Y43 B;  2XHK A;  1WD4 A;  1GMM A;  4XCB A;  5CAZ A;  2ZGU A;  1PGS A;  1X82 A;  1NXD 1;  2GMP A;  2VZU A;  3AVR A;  1B09 A;  3VBS B;  3TN9 2;  2WO3 A;  3GYD A;  4B1L A;  5FYT A;  5FZB A;  2W94 A;  2FBE A;  1ENX A;  1MZ5 A;  4F7Z A;  1PMJ X;  4I2O A;  1VIW B;  3N9N A;  2WNV C;  5L36 A;  4YM1 A;  1W9T A;  4L0P A;  1S0J A;  5EV7 A;  3UET A;  1MZF A;  4AW7 A;  1JZ7 A;  5LB6 A;  2FMD A;  2JKB A;  2XJU A;  2R04 3;  1X9P A;  5G05 L;  1BK1 A;  4H3W A;  1ND3 B;  4LLO A;  4PQQ A;  2WSV A;  5IUQ A;  5DZF A;  4FPJ A;  1JOB A;  2DVD A;  1NCR C;  2ZJC A;  3S6P A;  4M3C E;  2XJS A;  1HRI 2;  2KR2 A;  4JGY B;  2VXR A;  2B7Y A;  4XJ8 A;  3RI9 A;  3UYJ A;  2HBT A;  2D6P A;  2FD8 A;  1DQ4 A;  1K12 A;  1Q43 A;  1W6Q B;  2VC9 A;  2ZAA A;  5GLT A;  3BTX A;  4YGB A;  2HWE 1;  4IEW A;  3WG4 A;  3ORJ A;  2E7T A;  4KWJ A;  1V6K A;  1MEC 2;  2O1Q A;  3MIE A;  2AAC A;  1OSG A;  3LDR A;  4IW3 A;  1VB4 A;  2RJL A;  4CU7 A;  1QDO A;  3RI8 A;  2Q0A A;  2ZKL A;  5BY5 A;  1DIW A;  5KC6 A;  3BIW E;  3M3E A;  1XYN A;  1TVG A;  2R1D A;  3WOG A;  2ZGN A;  2BOI A;  4B4P A;  1XBF A;  1ZBA 1;  3M2M A;  4FOY A;  4HN1 A;  5C3R A;  1AYM 3;  3SEE A;  1AR6 1;  2SLI A;  5CAD A;  2EIG A;  4DS0 A;  3AJY A;  2WAA A;  3UT0 A;  1JYC A;  4AVA A;  2WNU B;  5C3O A;  2Y8K A;  1J3R A;  4IQP A;  5EP9 A;  1GNH A;  2A6X A;  5FZH A;  3WT3 A;  2EXK A;  3KV4 A;  4LK7 A;  4NWV A;  5JAX A;  3U75 A;  1PO1 3;  3NNJ A;  1YHF A;  5FZL A;  2Z79 A;  2Q1Z B;  3WSO A;  5AC9 1;  2B39 A;  1FOD 3;  1BEV 2;  3KD4 A;  2E53 A;  1AL2 1;  3K4A A;  2A6Y A;  1H9P A;  1JBC A;  4LQR A;  4BOW A;  1C1F A;  1GP4 A;  4NO4 A;  3M70 A;  3I8T A;  3CEW A;  1VBA 2;  3AP6 A;  2DVF A;  1TQ5 A;  2JE8 A;  4AI3 A;  4M01 A;  3M7A A;  5FZD A;  3O1P A;  1Q5O A;  4QB6 A;  4QX2 A;  4AI8 A;  2XKP A;  2PN5 A;  3L2Y A;  4LTA A;  2FDH A;  4EQV A;  4L8Q A;  1UOF A;  3PVN A;  1V0A A;  2YRO A;  1HIX A;  3AL5 A;  3QLQ A;  2CY6 A;  2R49 A;  1AJO A;  4K9S A;  1FYU A;  1LEM A;  5IVC A;  1KEX A;  1OQ1 A;  4NUB A;  5FZ3 A;  4CDW C;  1EPZ A;  3VL9 A;  3TBD A;  5AC9 3;  1RGS A;  1QH7 A;  3MFC A;  3URF A;  1OC1 A;  2C26 A;  5C6C A;  1IQA A;  3GXU A;  2QQO A;  5E6H A;  4UT5 A;  4R52 A;  5LBF A;  2JG9 B;  3HMY A;  3EXU A;  3SLI A;  5GLV A;  4WM7 C;  3GM8 A;  4BHP A;  4LPL A;  5LCW L;  1DQ0 A;  1XJA A;  1I1E A;  1WWY A;  1PO2 2;  2R07 1;  3VDA A;  1DQ1 A;  2CDP A;  3WW3 A;  1MS4 A;  2VZQ A;  4XUT A;  2PMW B;  3PVE A;  4NPL A;  3IDC B;  1MVQ A;  3UJQ A;  1UWW A;  3KM5 A;  3R05 A;  3H1M A;  3H3Z A;  3L2H A;  3TEZ A;  4WM7 A;  1C8M 3;  3U4X A;  1O6U A;  1NYW A;  2A6W A;  5GLW A;  2VMI A;  3W20 A;  2J1R A;  2EIE A;  2Y6J A;  3V65 A;  2GU9 A;  3BGA A;  4IEO A;  2I2S A;  2VOV A;  2YV8 A;  3C3V A;  1W90 A;  1W6M A;  1XYO A;  2CAU A;  5JIA A;  2QQK A;  1MQT B;  3TWI A;  1DU3 D;  4RYD A;  2VNR A;  5FPL A;  3H3L A;  1DBN A;  4NVP A;  1OA2 A;  4P02 B;  5D2A A;  1OA4 A;  2OYZ A;  5KBF A;  4YG3 A;  3IN9 A;  4QHZ A;  4EWD A;  1NAE A;  1AX2 A;  4KGQ A;  4FT8 A;  1MPX A;  4AVV A;  4LEJ A;  5LBC A;  5C3P A;  1QJU 3;  4LHN A;  3RJ2 X;  1Q8V A;  5SV5 A;  5FLJ A;  4C0H A;  4HK9 A;  2R04 1;  5ACA 1;  4MZU A;  4AI0 A;  1F35 A;  1IG3 A;  1XNC A;  4DUX A;  3I3M A;  3NQH A;  3ILF A;  4D7T A;  1K45 A;  1PX4 A;  1BZW A;  4JTN A;  1NLQ A;  5FP9 A;  5EJ3 A;  4AF9 A;  3MPP G;  1AYN 2;  1PO1 1;  3WDX A;  2WR9 A;  4MVT A;  4A45 A;  5FFO C;  4OCT A;  1HRV 1;  2A73 B;  1WCU A;  2DUQ A;  2Z4F A;  3R4D B;  4FPC A;  4QQH A;  2DCT A;  5IJR A;  2IVJ A;  4R9D A;  2OKX A;  1AL2 3;  1RTV A;  2JDM A;  3RRD A;  3ZXK A;  3JD7 3;  2WWJ A;  4E4D X;  1ZZ9 A;  3WNL A;  1T2X A;  1V6N A;  2W52 A;  1M4W A;  1VB2 A;  2PLV 1;  2FCU A;  3N7L A;  4QQL A;  4Q4X 3;  5A7N A;  5B4N A;  3ILR A;  2V09 A;  4LBO A;  2JG8 C;  2JDY A;  4XIK A;  4Z82 A;  3UGG A;  2ARC A;  3ILN A;  3LA7 A;  4FFG A;  4J25 A;  2QNK A;  2EAK A;  2VZ1 A;  5FYY A;  1S2K A;  1V9U 3;  4XXP A;  3AYD A;  4JDM A;  4OYU A;  1JYX A;  1RUF 1;  5FZ0 A;  3H8O A;  3D82 A;  4Y1Y A;  4AEM A;  5FO7 B;  4WZF A;  1R09 2;  1CX4 A;  2ET7 A;  4IET A;  4QT6 A;  3BKZ A;  1UOG A;  3VD9 A;  2RMU 3;  2C24 A;  3NAP B;  3RS6 A;  3KS7 A;  5H9Q A;  3ZSJ A;  4YZ5 A;  1NT0 A;  3CJI B;  1H4G A;  4MH0 E;  5DAB A;  4BIF A;  4BQ5 A;  4D7S A;  4DEV A;  4DMI A;  5BNP A;  3RZL A;  3POI A;  1YIP A;  3ZFE C;  5BNP C;  2R16 A;  2H0B A;  1WMX A;  2XGX A;  1LHU A;  4DXR A;  3M3Q A;  4K8R B;  1W8T A;  2Y38 A;  4MX3 A;  1ZRR A;  4GUL A;  2NM1 A;  4OHX A;  2RS3 2;  3PU8 A;  4OHV A;  3ACI A;  2VH9 A;  3NJX A;  4AED A;  1VBE 1;  2EAA A;  2IFW A;  2WQ4 A;  2ZGP A;  3MV0 1;  3I97 A;  4W6W A;  3POS A;  1CR7 A;  4TTG A;  4CUG A;  5JXG A;  4YW5 A;  5FUI A;  1ENQ A;  1F5J A;  1SDD B;  1GWM A;  2DWR A;  2VZS A;  3LDK A;  5FK7 A;  4BE3 A;  5GZC A;  1I5Z A;  4XUN A;  3AMN A;  2RMU 2;  3SH3 A;  3LE0 A;  3VBO C;  1W8U A;  4NIA A;  1LRH A;  1RUD 2;  1U5Y A;  3HNY M;  3UGH A;  5LY1 A;  4RGG A;  4X8P A;  1NCR B;  5F2W A;  4DOU A;  3GHM A;  3POF A;  1QEX A;  3A0K A;  1C4R A;  4RHV 1;  3WF4 A;  3KB5 A;  4BME A;  4CEW B;  1AXZ A;  3AKQ A;  1ND3 A;  3GZE A;  3ZDS A;  3ZFF B;  2QQP A;  1UZY A;  4MGQ A;  1W05 A;  1Y9M A;  1BLZ A;  5C4W C;  1SZB A;  3PLQ A;  4ZON A;  1UYY A;  5FKB A;  5L9B A;  3SH5 A;  5IFT A;  4Q4W 3;  1S0D A;  5JMC A;  3TEW A;  4JGZ C;  2VOX A;  2DCY A;  3FL7 A;  1REF A;  3NKT A;  4B3N A;  2WS9 1;  3NKG A;  1QJX 2;  3HJR A;  4XDP A;  3AFK A;  4IEZ A;  1XND A;  3CDZ B;  2JDU A;  3EMR A;  4N53 B;  5CYY A;  3ZLI A;  2RE9 A;  4M3C B;  4QGL A;  2ZHM A;  4Q0U A;  2D6N A;  4XQW A;  3ACG A;  4N43 A;  1DQ2 A;  5M0T A;  1BHG A;  3PVB B;  4ZS3 A;  4BWO A;  5DAX A;  2EIC A;  5BPX A;  2Y34 A;  1ZBA 2;  5ERL A;  1RED A;  4QPI C;  4RS5 A;  1G8W A;  3VBH B;  1W6O A;  1AR8 2;  2CYF A;  2RS5 3;  3ITQ A;  5A3P A;  2C9K A;  4CCE A;  1UX7 A;  1TZO A;  2PFW A;  2DDU A;  2LM3 A;  5HPO A;  3WUD A;  4ZU5 A;  4TN7 A;  4BQ4 A;  5LA1 A;  1UYZ A;  3LEM A;  1R64 A;  5LA2 A;  2BTV C;  4KG0 A;  3SNM A;  1LOA A;  1IOA A;  1H8T B;  1WGP A;  5A7W B;  2Q1F A;  3RNS A;  4YGE A;  5EYY A;  4OI1 A;  1FXZ A;  4I01 A;  3DKQ A;  3RWN A;  4Q8K A;  3SCG A;  4PI2 A;  2BVB A;  2VMF A;  3LPG A;  3MW2 A;  2WYS A;  4IUG A;  3OYW A;  1PO2 1;  2LW8 A;  2W46 A;  4QPY A;  3RZZ A;  5FV3 A;  2R07 2;  1OHF A;  4ZZ5 A;  5IK7 A;  2VZ3 A;  5A32 B;  4D7Y A;  1WMD A;  4EJR A;  1N47 A;  1HV1 A;  3FN9 A;  2AC1 A;  1NZI A;  4PJY A;  3VV1 A;  4QMA A;  4EV0 A;  2MEV 1;  3OPT A;  1SCR A;  1O7F A;  2B9U A;  4XBN A;  2PHT A;  3OY8 A;  1Z7S 3;  1A34 A;  2WBK A;  4YM0 A;  3U07 A;  1RYY A;  1R08 2;  2RS1 1;  3WG1 A;  2J1S A;  3LKJ A;  4BQW A;  4UW6 A;  3AP9 A;  1XE7 A;  3Q8E A;  4QGM A;  2EIB A;  5HCF A;  2IXJ A;  1AYM 2;  3APB A;  3JB8 A;  1R09 3;  3SIT A;  2Q8O A;  5F3C A;  1HN0 A;  3QBQ A;  2LRO A;  3JUU A;  3M3O A;  4IGO A;  3T2T A;  5A7P A;  1NCQ B;  3POW A;  5JSO A;  1ACC A;  1S0G A;  4YYO A;  2WAB A;  4AHZ A;  2VU9 A;  4XC9 A;  4V2V A;  5I8Y A;  3IBM A;  5EFU A;  4DRR A;  5J09 A;  2WT0 A;  1SFP A;  1R1A 1;  3I2I A;  5JDB A;  4UW4 A;  3OBT A;  4CP9 A;  1MS8 A;  1LJ7 A;  4XF4 A;  3ZOI A;  2JIJ A;  1O4T A;  1NLR A;  4JRA A;  3MUY 1;  1ZZB A;  3POJ A;  1Y7B A;  4AED C;  2VM9 A;  2ERF A;  2YZ4 A;  4N9I A;  3AZZ A;  1UMH A;  1STM A;  4MXW A;  4CP1 A;  1H8V A;  5IAX A;  4W4Z A;  4BK4 A;  4YM3 A;  4AGG A;  4K40 A;  2QE3 A;  4MGT A;  4L2N A;  2VNG A;  1UZ0 A;  2D6M A;  1UN1 A;  3KWV A;  2J1V A;  3LCP A;  5JZG A;  4CXY A;  3EQE A;  3GCX A;  4LBM A;  1UL9 A;  2JE7 A;  2NLR A;  2BBA A;  1Z7S 1;  2VOT A;  1N1V A;  4PF1 A;  1OOP A;  1EUT A;  3KLS A;  1K5M A;  1KFX L;  4ISQ A;  3RMX A;  4CDU C;  5T55 A;  5IAV A;  1NUK A;  3MIG A;  2Q1M A;  2R6Q A;  3GNE A;  4XF1 A;  5DAP A;  2VZV A;  4DY3 A;  4IV1 C;  4NR1 A;  1RUI 1;  5IHR A;  5KXD A;  1AX1 A;  2RM2 2;  3P1I A;  4NHY A;  1HV0 A;  2XQX A;  3OBR A;  5A7W A;  1AHS A;  1LOE A;  3PDQ A;  5APA A;  2AYH A;  5BNN B;  3WNN A;  1YFX A;  2CTV A;  3ZX7 A;  1W6P B;  2LAL A;  5FY4 A;  1AR9 1;  4EWA A;  3VBO A;  1DGL A;  1DYK A;  2B46 X;  1LOD A;  2JXA A;  3K4D A;  3VBR C;  3H8R A;  5FK8 A;  2VJX A;  1GIC A;  1RXF A;  3GBW A;  1PGL 1;  1MS0 A;  2WFF 2;  3J7L A;  2VNV A;  3PTR B;  4D8M A;  1JYN A;  1OLR A;  4ORF A;  4Q29 A;  1XXN A;  5JOZ A;  4YZ1 A;  2BV4 A;  4RHV 3;  4EZH A;  4DZG A;  2E51 A;  3TYJ A;  2Y64 A;  5C8C C;  1MEC 1;  2AUY A;  5J96 B;  4FI9 A;  4MO3 M;  5T5J A;  5LBE A;  2PTM A;  1S2B A;  4YVW B;  1JOP A;  4GMP 0;  1ND3 C;  5LA0 A;  1NA1 B;  3VN4 A;  3KCX A;  2DTW A;  1R09 1;  3N7M A;  1PIV 3;  4JHT A;  3ZKY A;  5F6K A;  4XZU G;  4NAM A;  3CJI C;  2V73 A;  4GH4 C;  4L97 A;  2VEC A;  4N7I A;  1PVC 1;  3FFZ A;  1ODN A;  5BNP B;  3O1S A;  2G9Z A;  3M8L A;  4GB3 2;  4QB2 A;  5DG2 A;  4HSJ A;  1GWL A;  1E57 A;  1YJL A;  2V4A A;  1PZ7 A;  3GF6 A;  3FHI B;  3NL1 A;  2BYV E;  1KFU L;  2D7F A;  2QDN A;  5GM0 A;  3WQ1 A;  5A6Z A;  2DF7 A;  4CYD A;  1NCR A;  4UXA A;  3W5N A;  4GQ7 A;  2ZGR A;  2VBB A;  3CL1 A;  5KXE A;  1V6M A;  3AP7 A;  4HKL A;  4QDQ A;  4YNI A;  4BU2 A;  3VKL A;  2VZR A;  1K5M B;  5DUW A;  3O1R A;  3HEI A;  2HWF 2;  3AKS A;  3K48 A;  5DUU A;  2QVS B;  2WQ8 A;  5FYU A;  2AH2 A;  2WNU C;  4Q4V 2;  3CF6 E;  1O5U A;  1VJ2 A;  2GC0 A;  5G04 L;  5FBZ A;  4EN7 B;  1AR9 2;  3I3Q A;  4Y4R A;  1XE0 A;  3B93 A;  2CAV A;  3V0B B;  1YI9 A;  4UFH A;  2NMO A;  2ORZ A;  5FMB A;  1ZRF A;  1JU3 A;  3JBG 2;  2YC0 A;  3IM0 A;  4XIO A;  1OBN A;  5FKC A;  5LBB A;  1VRH 3;  5JPN B;  3D0S A;  3B3Q E;  1WW7 A;  2WS9 2;  3TOJ A;  5F9T A;  4FQZ A;  5I8T A;  4RQP B;  5FLH A;  1LOB A;  5F5C A;  3VHN A;  3WQ0 A;  2W0X A;  1EPW A;  4LUL A;  1F9K A;  4UFK A;  4WM8 B;  5JZG C;  3WEZ A;  3ZYG A;  4QD2 A;  1AJK A;  2YC2 A;  1LHO A;  1RXG A;  1VMF A;  2CNA A;  4PDW B;  3VL8 A;  1HB2 A;  4M00 A;  5I91 A;  4WZC A;  4UW5 A;  3A21 A;  1FMD 3;  1VBD 2;  2JIC A;  2WT2 A;  3ZYJ B;  5KR7 A;  4KWU A;  5JWP A;  4Y24 A;  5FCC A;  2YMZ A;  5DAW A;  3VGI A;  4E2G A;  3OCP A;  4OI4 A;  5HV0 A;  3RZM A;  1QQP 1;  2GC1 A;  2OPK A;  3C8X A;  1PGW 2;  3THC A;  2P17 A;  3HQX A;  3BTY A;  1IKP A;  2A70 A;  3WY6 A;  3ZN4 A;  1W6N A;  3NNF A;  5K8S A;  3K46 A;  4YW1 A;  1L7Q A;  2X8K A;  1IS3 A;  5I0U A;  1KS5 A;  3JB4 C;  3WLU A;  3LGR A;  1IKQ A;  2VW0 A;  4LBL A;  3MO4 A;  4XFI A;  1JHN A;  4YZ4 A;  5F5A A;  5C9A C;  3BIE A;  2WRA A;  1WMF A;  1SHW B;  3O1V A;  2TBV A;  3OYW B;  5FDB A;  3CO2 A;  2W68 A;  3A23 A;  3O12 A;  1R1A 2;  5DN2 A;  1ASJ 2;  4OHY A;  4CDU A;  3J26 N;  1CZT A;  1D0G A;  1KDK A;  4IEU A;  4J1W A;  1F8V A;  4O61 A;  1VAK A;  4G4F A;  4IEX A;  2NPI A;  4XAA A;  4YPJ A;  3RYP A;  2PHD A;  1LGN A;  3NV3 A;  2ZX0 A;  2RJ2 A;  1EV1 2;  2IUW A;  5EHD A;  2BDR A;  5F2S A;  2ATF A;  5GZG A;  5FMO S;  1PO1 2;  1W8Z A;  4UI9 L;  3WX5 A;  1V9U 2;  2ZGT A;  1W6N B;  2UU8 A;  3O1O A;  5F3E A;  3O1M A;  5JOY A;  1NCQ C;  4FPG A;  4PLN A;  3RPQ A;  1W0O A;  3VZN A;  3RG0 A;  4DUW A;  1IPK A;  2FCV A;  5FBJ A;  1RUC 1;  1Q8S A;  3RZH A;  4CA9 A;  1C57 A;  3N7J A;  2G19 A;  1W8H A;  4OMD A;  5LRR A;  1DDL A;  3HIF A;  4QPG B;  4ES9 A;  1UX6 A;  3MF6 A;  5F5I A;  4N43 C;  5C4W A;  1COV 3;  3LEG A;  1AVB A;  1DGR N;  1VBA 1;  4F3J A;  3ACL A;  3F95 A;  3T1L A;  1APN A;  2VTX A;  4NOT A;  4QPI A;  3K3O A;  5FRA A;  1W99 A;  1VRH 1;  1LHN A;  1VMJ A;  1RHI 2;  1SG3 A;  2YC4 A;  4I30 A;  3R4S A;  4Q4V 1;  3ZSE A;  4M0H A;  1BCX A;  4BM8 A;  2JD9 A;  5HI0 A;  3MIH A;  1EYB A;  2Q8E A;  3EBR A;  1URX A;  1TME 2;  4G3Y C;  3H1Y A;  1CQ9 A;  4FPO B;  3RVH A;  3GDB A;  3SIS A;  5C5U A;  3NAP A;  5GZD A;  2HWF 3;  4AVS A;  3O5S A;  2B45 X;  4HVO A;  1A78 A;  1NZC A;  4Q4X 1;  5BNQ A;  3WVJ A;  2GSY A;  2PAM A;  4P9I A;  2A6V A;  1UU4 A;  1YXW A;  4JKK A;  5EYX A;  1PIV 2;  2ADE A;  4H7L A;  4DRV A;  1QU0 A;  1UZZ A;  2J1U A;  2OQ6 A;  3LPF A;  4YFW A;  3T09 A;  3GZU C;  4XE9 A; 
#chains in the Genus database with same CATH homology
 2PXJ A;  4IGP A;  4DO0 A;  5FJK A;  5ANQ A;  2P5B A;  5FXZ A;  5FPU A;  3KVB A;  4UF0 B;  5LY1 A;  5FJH A;  5FZO B;  5CEH A;  5FYV A;  3ZPO A;  5FWJ A;  4QX7 A;  5F5C A;  5F2W A;  5FPA A;  4CCM A;  3N9L A;  3K3N A;  5FP3 A;  3AVR A;  5F32 A;  5A1L A;  4D6Q A;  5FYT A;  5FZB A;  2YBK A;  4EZ4 A;  5FYC A;  5FZA A;  4BXF A;  4IGQ A;  5A3N A;  4CCL A;  5ISL A;  3N9N A;  5KR7 A;  4URA A;  5FP4 A;  2Q8D A;  5FZ9 A;  5FP7 A;  2YU1 A;  3LDB A;  4CCN A;  4LXL A;  5A7S A;  5IVY A;  5LY2 A;  3AL6 A;  4XDP A;  4AAP A;  4ASK A;  5FPL A;  5A7W A;  3K2O A;  2XUE A;  4E4H A;  5FZ8 A;  5LWB A;  3PDQ A;  3ZLI A;  2OX0 A;  3NJY A;  5FUN A;  3UYJ A;  4UF0 A;  4HOO A;  5FY4 A;  3DXU A;  3N9P A;  3KV6 A;  5F5A A;  5FY8 A;  5FYS A;  5A7O A;  5A3P A;  5FZE A;  4CCJ A;  3N9M A;  5IVE A;  3N9O A;  5FUP A;  4BIS A;  3PTR B;  4GJY A;  5F3G A;  5FXX A;  4TN7 A;  5FY9 A;  5FZ1 A;  5IWF A;  4LIV A;  5FP9 A;  4EZH A;  5FY7 A;  4C8D A;  5A7W B;  4DIQ A;  2YBP A;  2YU2 A;  3LD8 A;  5FYI A;  5IW0 A;  4EYU A;  2OT7 A;  3PUR A;  2XDV A;  5FZ7 A;  5IVJ A;  2WWJ A;  2GP3 A;  3AVS A;  5F2S A;  5FZG A;  5FXW A;  4QWN A;  5FYZ A;  5FY0 A;  5A7N A;  5FY5 A;  4LIT A;  5F3E A;  5FV3 A;  2W2I A;  3U4S A;  3OPW A;  4XDO A;  4QX8 A;  3PU3 A;  5F39 A;  3KV9 A;  4CCK A;  4QXB A;  4QXC A;  4D6R A;  3OPT A;  4HON A;  5FZC A;  5FZH A;  5FBJ A;  5FYY A;  4GAZ A;  3KV4 A;  4GJZ A;  5FZO A;  2VD7 A;  1VRB A;  5FWE A;  4LIU A;  5A3W A;  5FZL A;  3PUQ A;  4GD4 A;  5FZ0 A;  3U78 A;  4Y3O A;  5A7Q A;  5FP8 A;  5F5I A;  4D6S A;  5FXV A;  5FYM A;  2Q8C A;  5IVV A;  5FZ6 A;  5FZK A;  5FZF A;  3N9Q A;  5FYB A;  5FZI A;  2WWU A;  4AI9 A;  2XXZ A;  5F3C A;  3KVA A;  2GP5 A;  4V2W A;  4IGO A;  3K3O A;  5A7P A;  5A1F A;  5FZD A;  5IVB A;  5FZ4 A;  5FYH A;  4CCO A;  2XML A;  4V2V A;  4BU2 A;  5FPB A;  5FY1 A;  3PUA A;  3AL5 A;  5FZM A;  2Q8E A;  5FPV A;  3RVH A;  3KV5 A;  4Y33 A;  3PU8 A;  4QXH A;  5FYU A;  2OQ7 A;  4NUB A;  5FZ3 A;  5IVC A;  5LW9 A;  2YBS A;  4QU1 A;  5A3T A;  2OS2 A;  3DXT A;  4CUG A;  5IVF A;  4Y4R A;  5E6H A;  4CSW A;  5F3I A;  2YPD A;  5F37 A;  5K4L A;  2OQ6 A;  5A80 A;  3PUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...