2GP5A

Crystal structure of catalytic core domain of jmjd2a complexed with alpha-ketoglutarate
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
347
structure length
347
Chain Sequence
ASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jumonji domain-containing protein 2A
publication title Structural insights into histone demethylation by JMJD2 family members
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 100
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2gp5A01
5A7NA 2WWJA 5A7OA 1VRBA 3PURA 5FYUA 2W2IA 5FYBA 5FY1A 5FXZA 4Y4RA 5KR7A 4XDPA 5FPVA 3ZLIA 3KV6A 4CSWA 5FZ1A 5FZ7A 5FYSA 3DXUA 5IVCA 2XDVA 5FYCA 4EZ4A 2YU1A 4LXLA 4V2VA 3LDBA 3N9LA 3KV5A 2GP3A 3AL5A 4GD4A 2OQ6A 3AVRA 4CCLA 4CCNA 2OT7A 5A7PA 2OS2A 2Q8DA 3LD8A 3DXTA 5F32A 3U4SA 5A3PA 5CEHA 3ZPOA 4BU2A 5FPAA 2Q8EA 3PUQA 4D6QA 4QWNA 3KV4A 5A3WA 5A80A 4EYUA 2YBSA 4QU1A 5FZ4A 4LITA 5FZFA 2XMLA 5E6HA 4CCOA 4V2WA 5FUNA 5F3GA 3K3OA 5FY4A 5FV3A 5A7WA 5FUPA 5FZ8A 3AVSA 4Y33A 5A7WB 4LIVA 5FZDA 3PUSA 5FJHA 5LY1A 3K2OA 3KVBA 4CCKA 5FPUA 3N9MA 3KVAA 5ANQA 4IGPA 5FZ3A 3PU8A 5K4LA 3PUAA 4AI9A 5A1FA 3N9OA 4CCMA 4UF0A 4QXBA 5FY8A 5LWBA 4TN7A 5FZ6A 4URAA 4CUGA 5F3CA 5IVEA 5FYTA 5A1LA 5A3NA 5FP7A 3PTRB 5F39A 5FYVA 4NUBA 5F5IA 5FZOA 5FPLA 3N9QA 5F2WA 5F5CA 5FZAA 5FP4A 2P5BA 5FZCA 3UYJA 2YPDA 2WWUA 5F2SA 2YBPA 4IGQA 5F5AA 5FYMA 3RVHA 5FZ0A 5FZGA 4C8DA 5FZKA 4LIUA 5IVFA 3N9PA 5A7QA 4QXCA 2YBKA 5F3EA 4XDOA 4BXFA 4QXHA 4EZHA 2OQ7A 2PXJA 5FZMA 4DIQA 4HONA 5FBJA 2GP5A 5FZBA 5IWFA 4AAPA 4DO0A 5FPBA 3PU3A 5FP8A 5IVVA 5FY5A 2XXZA 4UF0B 5F3IA 5A3TA 3OPWA 2YU2A 5FZ9A 5F37A 5ISLA 5FYHA 2XUEA 4GAZA 5FZEA 3PDQA 5FWEA 4E4HA 4GJYA 4HOOA 4QX7A 3NJYA 2VD7A 4D6RA 5FJKA 4ASKA 5IVJA 5FY0A 5FZOB 5FY7A 5FYIA 4CCJA 3KV9A 5FP3A 5FZHA 3OPTA 4D6SA 5FXVA 5FXXA 5FYYA 5IVBA 3N9NA 2OX0A 2Q8CA 3U78A 3AL6A 5LY2A 4Y3OA 5LW9A 5FZIA 5FZLA 3K3NA 4QX8A 5FYZA 5IVYA 5FP9A 5FXWA 5IW0A 5FY9A 4BISA 4IGOA 4GJZA 5FWJA 5A7SA
chains in the Genus database with same CATH superfamily
4FFFA 4DUVA 5IK4A 2JG9C 2WN3A 4JX0A 1RB8G 4NAOA 1ULOA 1PO13 3IIAA 4XDPA 5FPVA 1E5HA 3RWKX 2JEMA 5HV0A 1W0PA 3LFMA 1WCKA 2WN2A 4GZ9A 3HD8B 4ZY9A 1V6MA 2ENRA 4FFGA 3V0BB 4EZ4A 4FP2A 1NE4A 2PHWA 2FDIA 3PVNA 3ILNA 3N9LA 2XB6C 1IPSA 4YZ2A 4QPGA 1W6OB 3N36A 2VVDA 4ZPIA 4CCNA 2Q5TA 4Y26A 3LD8A 4GWJA 4XCAA 1D2QA 1FPN3 4RHV3 4XZPA 4XJ9A 4FCAA 5CFDC 4FVVA 3S0MA 3MPBA 1QNYA 3K4ZA 1YO8A 4AVVA 1J3QA 1ZBE1 3W9AA 5I8TA 4JHZA 2XKOA 2ZGMA 2ZOEB 4BQWA 3POWA 3MLJA 3VKLA 1OKOA 3VLBB 4CP1A 5FPXA 1OVSA 4AK3A 3H8XA 1JUHA 1PVC3 2LRPA 1VMJA 2Q1MA 4MLOA 1RUE2 4QDSA 1AXYA 2G19A 1ULCA 2JDHA 2ZX1A 3DN7A 1JOBA 1JN2P 3VBSC 1C8NA 1RUD1 2D7FA 2VMCA 1HRI2 2WS93 1H9WA 3F2ZA 3R4DB 1H8TB 1W9YA 4XEZA 3T09A 4XC9A 4ISQA 4ZKTB 4YW3A 5A6ZA 2GNTA 2NPIA 3NWKA 1ND3B 3AX4A 2Y8KA 3FUQA 1ODMA 4QX3A 3ACLA 3VDDC 4QT6A 4ZZ5A 1LOBA 3JD73 3R4SA 5A1LA 5KHHA 5IK7A 1APNA 1F9KA 1XQNA 1M4WA 2ADEA 4P9GA 2VOWA 4M3CA 4RSUA 3GXUA 1UW8A 1OUXA 3HEIA 3U75A 5DAXA 2ZEYA 1QJU1 4XF9A 1PIV3 4XJAA 5J3UA 3T08A 5FYMA 3MUZ1 1ZZ7A 1UY2A 3OEAA 4MGQA 4E9KA 3WY6A 1UIKA 2YV8A 4CP0A 4WBBA 2B8MA 5FZGA 3NNLA 1K5MC 4U2AA 3BOWA 3ZXKA 4XDOA 4SLIA 3E6BA 1IKPA 3OYWB 2BPA2 3BU0A 2YXSA 3AZYA 4Y20B 5BNPC 4HONA 1S0DA 1D0HA 2JG8B 4LUMA 3GBWA 2PFWA 2PMWB 1FPN1 2W95A 2XHKA 3ELNA 4R9DA 4RHV1 3UJOA 1L7RA 2GSYA 1G86A 2FZ2A 1AR82 2VECA 2VMEA 4FFIA 5FMOS 5FZ9A 2VU9A 4AVCA 4OFGA 4GULA 4E2QA 3GDBA 3NRUA 3ZYIB 2ZX0A 3OBZA 1S2EA 1BK0A 3BALA 4W50A 3VHRA 3ZYFA 4NRQA 1SLBA 3J7MA 1YQCA 3PMSA 4GIQA 5EQUA 2H6BA 3NJYA 1NA1B 3ZSKA 1W9FA 5FY7A 1YIFA 3MGUA 1ZZCA 4YW5A 3WEZA 5FP3A 3U10A 4YVWA 1QXJA 1S55A 4EJRA 4B4QA 3Q8BA 1DGWX 2CSGA 1VMFA 2RVAA 3G7DA 3RG0A 5LW9A 1WCDJ 5BNNB 5JPMB 3GF6A 3U07A 3VB9A 2WNUC 3PJQA 4HVOA 2BWAA 4HK8A 5FZLA 1U12A 2ZZJA 4QQOA 5FP9A 2BZDA 3TEYA 3VDAA 1JODA 5D1IA 1BMV2 2WO1A 4RD7A 3GYDA 3VBFA 1B35C 1WMEA 2D6LX 4UT5A 3WZ1A 2JDZA 2WZ8A 2JDYA 5C3SA 2YHJA 3CZJA 1VRBA 3FL7A 4FSJA 5B2GB 3AKPA 2YYOA 1CAXA 2VNRA 2VCCA 1RUE3 1M06G 2HBTA 5A6QA 1CPMA 2FDGA 2GDFA 1MR5A 1GV9A 1OHFA 1Y3TA 3AVRA 4XIOA 1YI7A 1HDKA 2PQSA 2Z79A 1HRI3 2EICA 3BI3A 4NN0A 2OS2A 4XPVA 3VBRB 3ZXJA 3H1MA 2OPWA 2QNKA 2OZJA 3GZTB 4QD2A 1UY0A 1RIRA 5CZKA 5A3PA 3MIGA 4BQ1A 4XIKA 5F9TA 2BERA 2JDAA 4HXCA 4OZOA 3WF0A 1ZVFA 1O6UA 3OTFA 4R9CA 1KS5A 2VXRA 1O91A 2DYCA 2ARBA 4LITA 4LHLA 4QXKA 4N43B 5EWSA 5FLIA 3SNMA 5T3NA 3VKNA 1SCRA 2EXKA 2CWSA 2XWBB 2JE9A 1KS4A 1N1YA 3T4HB 4IEYA 4N53A 3LEKA 3Q8AA 2QBXA 2VXJA 5BY5A 1DZRA 1MS0A 1RHI2 1TZOA 2V4VA 4HN1A 4IL7A 4XE9A 3LCPA 5GLTA 1U5IA 2RS51 3THPA 4AE2A 2VW2A 1SLIA 2JDNA 1SBFA 2A75A 3D4KA 4DO0A 5FKCA 4L99A 2ZGRA 1I5PA 5A3OA 2V5DA 1UZWA 2WSVA 2VZQA 3IAPA 1RUJ2 2XLGA 2ZGUA 3OOXA 2D3PA 3AFKA 4Q0PA 3CQOA 3POJA 4Y5SA 1AR83 3AZWA 2WNOA 2C1FA 2UU8A 4Q4W1 1GYKA 4IV1A 1MVQA 3DPRA 3B3QE 1KD7A 5F5CA 1FYUA 4BM8A 3E5QA 3A4UA 3O1PA 1W6MA 2YPDA 3A0KA 1DQ0A 5GZCA 2WLPA 3EJKA 5FZ0A 5EJ3A 1RUE1 3KHCA 1UY1A 3APBA 4C1WA 1WCQA 5FTTC 1FNYA 2DBNA 1RUF1 2VZTA 4Z07A 4ES9A 3ZFGC 2B39A 4QPWA 5FBZA 1QKQA 3BB6A 5JLVA 1H30A 4LA3A 2RS12 4Z92B 1HRI1 4DIQA 1OF3A 4QM8A 1XE8A 3JB8A 5CB7A 1I5ZA 3VZJA 4AR2A 1POQA 4QX1A 3AMPA 5A6YA 5IVVA 1W0NA 1RVF1 1S0BA 4UF0B 2I07B 5F37A 4IXLA 2QQKA 3GALA 5C4WA 3WDTA 4ZU7A 1MS8A 4ARYA 1T6BX 2P2KA 4O61A 4ONUA 1XYPA 3RMXA 4ATEA 1DF0A 5DZFA 2PHLA 1L3JA 3WR0A 4PJYA 1CAUB 2RDRA 3A21A 4XBQA 1HKDA 3BUCA 2ORXA 1BZWA 5FZHA 4XACA 1Q3EA 3I3EA 3NNJA 4H3WA 3RZJA 2J1TA 2P3JA 4BHPA 4MGTA 5FZIA 3J7NA 4Q8LA 2ET7A 2QTWB 3KF5A 5AC92 4TTGA 3WSOA 1V9U1 1PGL1 2LUWA 2PYTA 1WWYA 3ZSEA 4FPKA 1A6CA 3TNPB 1LEDA 3VD3A 4A7ZA 4D0QA 1KJRA 4PLOA 1AR81 1QXRA 4RQPC 5JZGC 4YG3A 5KR7A 2ZPXA 3RZHA 4L9BA 3VHOA 3KV6A 2GU9A 2YFZA 4Q0QA 4DXSA 2ZGTA 3OBAA 4LBJA 1I1EA 3DXUA 2R1BA 1FOD2 2VNGA 1ZYBA 2WZEA 4LXLA 4B7EA 4DXRA 3AMQA 1RHI3 5APAA 5EZWA 4CDWB 4INDA 1IS5A 4LEJA 1LCLA 1Q56A 1YQ5A 3CMGA 2OT7A 3RFRA 2ZEWA 5A7PA 4AEDB 2PAMA 3C7GA 1DU3D 4UBGA 3ZFEC 2BFUL 3JUUA 5DUVA 1DHKB 2BOJA 4M4PA 4CDUC 2FZ1A 1D4VB 4ET7A 1YJLA 1RUJ3 4GH4B 4WVWA 1WW4A 4LULA 1HX6A 2ZGLA 3I7DA 1BMV1 3AZVA 1ULFA 5LBCA 5F5QA 4YW7A 2EIDA 5FUNA 4JVAA 1BKZA 3L2HA 3UJQA 1B09A 4YW2A 3GJBA 3UV9A 3NJZA 2VR4A 4NWWA 4QQLA 5GZEA 4DXZA 1UOBA 2JIJA 4ORFA 3OGVA 1PZ9A 1SLCA 1E5SA 4Q2FA 5CBLA 4XUOA 4XYXA 2WNVC 3FFQA 2GC2A 4RS5B 4PI0A 1HQWA 4K1ZA 4CCMA 3MPPG 1PMIA 2RS13 4HKOA 4F83A 2IWGB 3FBYA 1RL3A 1H1AA 4CP9B 2CAUA 4YZ1A 1SLTA 2E7AA 2HKXA 1PO22 1JBCA 2N7GA 2TEPA 4JHTA 1N3PA 2JD4A 3M2MA 5D8AA 5F5IA 5FZOA 5FYVA 4HMZA 4Q0VA 4XFGA 1NAEA 5I0TA 1V6JA 1JZ6A 5L7OA 5G04L 1OLMA 3C7HA 5BNOC 1UL9A 4XDQA 4DZGA 3EB7A 1MQTC 3LOBA 2R1DA 4IE0A 3N9PA 3O1UA 1S2BA 2YC2A 1J1TA 4ISRA 3HIFA 3C8XA 3POFA 1W6PB 1UF2C 4OLLA 2LTNA 3VV1A 1XSQA 2MEV2 5AC93 3N7LA 3CJIC 3L9JT 1IS6A 5EHDA 5CFCA 4CDXB 5FYHA 3T0DA 4AI2A 1XNAA 4EROA 3M8LA 2JIGA 3BVCA 3WXPA 1ENRA 1RUJ1 4A3ZA 1RUH2 3AP9A 2IXLA 4RGGA 4YZ4A 3RYPA 4D6RA 3MFCA 5H9QA 5LRRA 5IFPA 1GP6A 2EIEA 5C9AB 1JOPA 1POV0 4QPGC 2CNAA 4NR1A 3BIEA 1OPMA 5IVBA 2E31A 3N9NA 1FOD3 4FPGA 1LKNA 1W8HA 5CKMA 3RDIA 4XJZA 5I0DA 3KGLA 1QHDA 3ITQA 2RDQA 2XGXA 1OOPA 2JDKA 2R0FA 1LOFA 4JGZB 4N7UA 3K3NA 3E97A 3M3CA 2OZ6A 1OPOA 3PUIA 1AHSA 5FY9A 3J7LA 4BISA 2FHRA 3R05A 3WDWA 4XABA 2DU1A 4AVTA 1PMJX 1UOGA 1UIJA 5E89A 3JQXA 1WCUA 2D6MA 2WAAA 2F17A 1IGOA 4Y4RA 5FREA 3ZLIA 5IAVA 3ZIWA 3K75B 4URTA 3RYRA 1LEMA 1JZ2A 5LK7B 1O3TA 2D93A 3A7QA 3E5UA 3V0AA 4JV4A 5DUWA 4YVSB 2AREA 4EE2A 3KV5A 2V5YA 4Y22A 1UN1A 4Q0UA 1VBD2 1S0EA 4GD4A 4CCLA 4GKXA 4GMP3 1W8WA 2Q8DA 3ZM8A 1GNZA 4HKLA 4E2GA 4ES8A 2BUKA 1WLCA 3OY8B 4S2GA 1O5LA 3PUQA 1UAIA 1NCRA 3UKNA 5AC91 5L9VA 2VE1A 4I01A 4UOJA 5KHJA 1XSRA 5DMYA 1DG6A 2O8QA 3MLLA 1NZIA 3F95A 2HYKA 5K7PA 1NUKA 3BCWA 1RUG1 1PO23 3EMRA 2GNBA 2JECA 1DP0A 2KD7A 1NY72 2XG3A 1R082 1MZ6A 3WNXA 2PHFA 3UT0A 3AP7A 2YDEA 4ZONA 1R091 3N9MA 3RZMA 4LOSA 3HQUA 3HQRA 2IVJA 4Q4V2 4YW6A 3UESA 2H6CA 4DOUA 1UXXX 4NE9A 5FY8A 1I9RA 2AGSA 2WO7A 4IEWA 4XBLA 4YZ3A 1GMMA 2MEV3 2OIIA 4XTMA 2B42B 2Z42A 4I3GA 3WDUA 2ZGOA 1Y9GA 1NYWA 3IN9A 5A3NA 2Z5WA 4Y1ZA 1BEV2 1WBFA 4DRRA 1SLAA 2WFPA 1SZBA 1H6YA 3M4FA 2L9LA 4YVWC 4NPMA 1JW6A 3VKMA 1TEIA 1W05A 1RUH3 2IVIB 2WUHA 4F3JA 2R49A 4LBQD 4H14A 5CIRA 5F2SA 4WZCA 3LWCA 1VP6A 3X29B 1XBFA 2Y6KA 4LIUA 4XURA 5IVFA 4M3CF 4FO9A 4P14A 1SACA 2FDHA 1AR62 2IXIA 3W21A 2OQ7A 4GXLA 3N7JA 1NLRA 4FPJA 4TSVA 3VBFC 3ZN4A 3ZIXA 5C5UA 3LEGA 1A3KA 1R1A2 5KBFA 2C5DA 5FLJA 3VBOA 2VCMA 4OYUA 4AFDA 4ZXKA 2DUPA 2YU2A 4KBBA 5F8PA 1QOOA 3SCFA 3NKTA 2SBAA 4Y5TA 2X09A 3HMYA 3Q8EA 1CD3G 4G3YC 1GWMA 3PLQA 2WIIB 3CKHA 4HOOA 4PDWB 2Y6LA 3QBQA 5AVAA 5H9PA 3VBUB 3ZX7A 1PO21 2J1EA 2X10A 1GSLA 1SPPA 2BYVE 4CEYB 5HBAA 1YQ2A 1OXCA 2NLRA 4JKLA 1W03A 4XUQA 4MXWB 5DPNA 4RA0A 3J26N 4HK9A 4LBQB 1HQLA 3VHPA 4LKEA 4XMIA 1V6KA 3RZZA 2W0XA 1QEXA 3GZEA 1XJAA 5FMOL 1ZRDA 4YZ5A 1EY2A 1VBD3 2V09A 1VBE2 1VB4A 2Y64A 2D98A 2RMU2 1PX4A 2P6HA 4LBLA 2XHNA 4NIDA 1HJGA 1REFA 4CUCA 4Q27A 4Q4Y1 3PVOA 1ALYA 3WW1A 3D6EA 1WMFA 4FQ4A 3POIA 4N53C 1QDOA 5JOWA 5KC6A 2BJSA 1YUDA 5C8CA 1A34A 2F4LA 4C1XA 1RUH1 2BVVA 5FIXA 4PQ9A 5FYCA 4EQVA 1R083 2VAUA 3SISA 4LJHA 1VALA 4XUNA 4Y1VA 4BDVB 1CR7A 1ACCA 2D44A 1FMD2 3H7YA 4A44A 3UGGA 4QDRA 2DTWA 2R6QA 1N3QA 3ACGA 3AZXA 4Q4V3 4R9BA 3U4SA 4PBOA 5C3PA 1S0IA 2WYSA 5FR3A 1KEXA 5A3MA 4IV1C 4A4AA 5HPOA 2YY1A 1H2MA 2ES3A 2RDSA 1YI9A 3DPRC 4XZUG 2AENA 1W8FA 3I59A 5HCBA 3ZO0B 4KWUA 4Q5OA 5FRAA 2DCZA 1H2LA 2IXKA 1BEV3 1X9PA 2BWCA 3BTZA 3LSEA 1GWKA 1D4M2 1FAYA 2PLV2 4XHXA 1UNBA 1NOVA 3VZLA 1OFSA 3AFGA 1TE1B 3OGSA 1FI2A 1MACA 1FNZA 1X8MA 2J1VA 2VW1A 1C1FA 2QQLA 3AKTA 3PUAA 1UKRA 2FQPA 4FPLA 4YM3A 1AR63 5LWBA 1QIQA 3TOJA 3ST7A 1F5JA 5C4WC 3NSTA 2BOIA 1W39A 2ORZA 4CEWA 3SQOA 1SFPA 1R1A3 4W8JA 1MS1A 1W8NA 1KRIA 4NHMA 4NVPA 1KXGA 2E26A 1EUUA 4JDNA 3SKVA 5F39A 5DG2A 2VMIA 2VZUA 5ABJB 2VTXA 4OHXA 1ND2A 3KMHA 3D0JA 3VBHA 3NVCA 3AYAA 1VBA2 2W87A 1PMHX 1NY71 4ZU4A 1UCXA 1BQPA 3ZN6B 3KLSA 4A7YA 3I8TA 3FLPA 4MGYE 2UYBA 4AAPA 4HVQA 4Q4V1 2C9KA 4K21A 4HL0A 4CU6A 2RMU3 3ZR6A 1UZ0A 4BMEA 2XXZA 1CAWA 1MZEA 2ZZQA 1W2AX 4QPIB 1URXA 4LHNA 4NHKA 4ITCA 3OD4A 4JGYB 4PIXA 1W6NB 4AF9A 3O0VA 4IEPA 1OLRA 2RR12 3L2YA 2A3XA 5A32B 3V0BA 3RQ0A 1BEV1 2R32A 4BIOA 3OF1A 1O4ZA 3KV9A 1PVXA 1MZFA 3C7OA 1EYBA 1OQ1A 1W6OA 5FXVA 4KBZA 1YC61 2ZGKA 4FBFA 5LBEA 3A22A 3AL6A 5LZ6A 4HKWA 5H9SA 3FWEA 2W1UA 1FMD3 4QX8A 1AR61 2IFWA 2WYFA 1YQ6A 4RR3B 3ZFGB 3VZMA 3ZDSA 2W3JA 3HQXA 5JOZA 1QU0A 4I30A 1R1A1 3CLPA 1ENXA 4EN9B 4YPJA 2A6WA 3O1MA 4DB5A 1RJ7A 5DG1A 4UFIA 4Y4YA 3H8UA 2EIBA 2JXAA 1ZREA 2QKDA 2AACA 1ULDA 1YHFA 2Y34A 4XFAA 1LECA 3UKTA 1GOGA 3HT2A 1GKBA 3FLRA 2XJTA 3NJVA 1D4M3 1H8TA 1SMVA 1W8TA 4XCBA 1X36A 4IESA 5LATA 2PLV3 3U11A 3WW4A 3USUB 2AUYA 4WM8A 1ND3A 4X6QB 3LIGA 3WF2A 3VL9A 1PK6B 2X29A 2ZX3A 1VBE1 2DVDA 2KR2A 4YGBA 2BW8A 5JMCA 1W2UA 5FK8A 1G7YA 4FOQA 1AJKA 3AXDA 5D8AC 3AYEA 1DGWA 2VH9A 4LLOA 5L7OC 4QX5A 5EP9A 1YRZA 1U5ZA 1WZXA 4GA9A 4QB1A 3MW2A 1SCSA 2BEOA 2VZPA 3CO2A 4YLZA 2AC1A 5A3LA 1GZWB 1PGSA 3P3NA 5AFBA 5JOYA 4JKMA 4FTEA 4Y33A 4DXTA 2GN3A 2BV4A 3HT1A 4RQPB 3PHMA 5JZGB 1VBA3 3SHRA 4Y20A 2HYXA 5BV6A 5K4LA 2E63A 2ARAA 2JG8A 2BNMA 1Z7S2 1BJQA 1VBC2 5CFCC 2ZEZA 1ZRCA 4FOWA 3HVDA 2BBVA 3B69A 2QZ3A 2VC9A 3RI9A 3B01A 3FHAA 3VN4A 2HWB2 1VBB2 3TB0A 3ZKUA 1KDKA 4CYDA 2A71A 5FYTA 2JX9A 4YM1A 4DRVA 1K42A 3FJSA 1E57A 1RITA 1CZVA 2DVFA 1Q8OA 1NA1A 3WG1A 4YG0A 3POEA 1ULGA 3LOIA 5M0TA 1AX2A 5F2WA 5T5PA 2RR13 4PI2A 4IW3A 3UYJA 1RINA 1VRH2 3BIWE 4CZSA 3I49A 1Q43A 1S2KA 3KS7A 4W6YA 4HLTA 3PVBB 2XOMA 4XUTA 1OOPC 4MVTA 1D4M1 1LHOA 1LOFC 2AR6A 2ZTNA 3B7MA 3D3AA 4LBNA 5SV8A 5BNNA 2W91A 4A3XA 2O0OA 2YZ4A 1COV2 1HB3A 1NX9A 1X82A 2G9ZA 5L73A 3OUJA 3WW3A 5FBJA 4LO5B 5LK5A 2EXIA 3QLQA 5IAXA 5A3TA 4MV2A 5KC5A 2D3RA 5JSOA 2VM9A 1SBDA 1Y9MA 3ATGA 1C5IA 4JZRA 2WWSA 4L2NA 3NO8A 1N1SA 4AXOA 2XLFA 4WZFA 4BWOA 5A70A 3RGBA 3ES4A 3SCGA 3M3IA 4WVZA 3OEBA 1PO11 4AGRA 5FOJB 2XVGA 3IDCB 4BZ4A 1TMF2 3CBNA 4L97A 3VBRA 1CN1A 2EA7A 4LK6A 3K77A 1UO9A 3U4XA 5LY2A 3O1RA 3KCYA 4D69A 3B00A 1AVBA 3K4AA 1S1AA 2XJUA 1NCRC 2YC0A 1UOFA 3OJBA 1O3SA 4BB3A 3ILRA 4X6RB 1JZ7A 3ZVXA 4FFHA 2RDNA 4IGOA 4N43A 3M70A 1WUVA 2G9GA 1DLLA 2XJPA 2BDRA 2AEZA 2OXBA 4I0BA 1F35A 5DDJ2 4FPFA 2FDJA 2HEVF 3HN3A 4AHZA 1W8UA 1IG3A 2E33A 2W2IA 4PCRA 4ASMB 5FXZA 1HXS2 3G6JB 2XLAA 4LO8A 2G4IA 3WUCA 4IV3B 1PVC1 1ODNA 1UMIA 1XYOA 2E7TA 1NZCA 5TSWA 3IPVB 3AYDA 1N1TA 1UU4A 2W5FA 1C57A 5EYXA 5AVPA 1CGPA 4AI1A 3DKQA 4AL9A 2R30A 2B5HA 3WQBA 4OMDA 2WSUA 2WS91 3Q9OA 2ZGQA 4UBHA 1AL22 5EJ1B 1Z7S3 4NAMA 1VBC3 5CEHA 3CU7A 2XBO2 4UFHA 3AP5A 5GJ6A 1OH3A 4XF3A 2ZHKA 1YJKA 2E9QA 1C3HA 2HWB3 1VBB3 4UW6A 2DVBA 2ZCWA 3FFZA 3JD71 1GICA 2A6YA 4AVAA 5C3RA 1UY3A 5GZGA 4GKYA 4COUA 2W52A 3KSCA 3IWZA 5FUPA 1GZ9A 5A7WA 1JI6A 4BLIA 4NHLA 2EAAA 4L8QA 4FPHA 4AQTA 4LIVA 5FZDA 1PIV1 1VRH3 3MIHA 4OCTA 4BK5A 1BBT2 3AM2A 5IFTA 5EYYA 4AI8A 3KVAA 3LZZA 2Y26A 4QU2A 4HG6B 3NV3A 3VBOC 2DCYA 2BBAA 4UF0A 1COV3 4HT1T 1S0GA 3ZXGA 3ALQA 4F7ZA 2D6KA 3ON7A 4A6OA 3E6DA 4R9AA 3BTXA 1HJFA 2ZHMA 3P5BA 1NKGA 3WQ1A 3UETA 4B7KA 4Q4X2 2JE7A 4IE5A 4EN7B 1AJOA 3ZFFB 3BYWA 2K9ZA 5A33B 1UYXA 4M3CB 3AMHA 2C4XA 2RG4A 4BIFA 5I91A 1Z78A 1ZA4A 4PQQA 2JKXA 1QJEA 1QH6A 1SG3A 1WBLA 4QXCA 1TMF3 2K46A 1G9FA 1VAKA 3NNFA 4IEXA 4S2FA 4CUAA 1LESA 3I3DA 2CWMA 2RV9A 4MGKE 1O3RA 3KHBA 2DCJA 3WNLA 3C3VA 3I2HA 2CV6A 1VBC1 5FP8A 1F4HA 3AMNA 1H8VA 5E16A 2VOVA 4O9EA 4HZFA 4P00B 1QJX2 1WA4A 5A6XA 2EF6A 5BNQA 5C8CC 2HWB1 4LPLA 1XNBA 4QHZA 5DDJ3 2OPKA 3LB9A 4QX7A 2Z69A 5KXBA 2H0VA 1AL0G 1OQDA 1H4HA 2J1UA 2VBDA 1HXS3 1YFWA 4CDWA 1BYHA 4M3CE 4RFRB 1QOSA 4D6SA 3JU9A 5JXGA 4R52A 5C5TA 3RPQA 3DYPA 4DNYA 4AEDA 3KT1A 2WJSA 3DYMA 4Y3OA 5J98B 4NRPA 1D7PM 5K0UB 4JKKA 3WDYA 2VZ1A 3AKQA 3N3HA 4PBPA 4X8NA 2WZR2 1YLLA 1HLCA 1MZ5A 3O1SA 1AL23 5IW0A 2GAUA 4WVMB 3NAPB 4GH4A 4Y1YA 5FPZA 5BUVA 2XBO3 1DGRA 2GN7A 5JIUA 2Y6GA 1EPZA 1Y43B 1GP5A 5LCWL 4LE3A 3U1XA 1W8OA 5LBBA 1SEFA 1CAVB 1HIXA 2BGPA 1W2OA 2X5IA 4B4PA 1O3QA 1FATA 3OCPA 3FE5A 3SEPA 3LQCA 4V2VA 4RS5A 3AB0A 3OG2A 5FAXA 1RXFA 2Q4SA 3AL5A 1BBT3 4CP2A 1WLDA 2E51A 4H55A 1TMF1 4L92A 2JB4A 3VD9A 3NQHA 3KGZA 4CP9A 4CEWC 3GHMA 2AEYA 1WLWA 1GQGA 2HWE2 4IEVA 3V65A 2FDFA 1OD3A 2C0ZA 4MX3A 4RFT0 5C70A 4UFJA 4E2SA 2SLIA 4GQ7A 3INAA 4OHWA 4DUXA 4D7SA 1IZ3A 4DPNA 1AYM2 1ND2C 3VBHC 5KXDA 4NIHA 2ZMLA 4AYUA 1YNAA 4Q4X3 4Q1PA 3VZOA 3FBMA 2XQXA 1WLTA 2QDRA 4YYOA 1MS9A 2OUJA 1BVVA 2VMGA 4XVHA 1GP4A 5GALA 1GZCA 2VW0A 1W6PA 5ANQA 4PLMA 2E7QA 2BRTA 1Q8SA 4AI9A 2WINB 4NMIA 2W94A 4TWTA 2Y6HA 4CDXA 4KWKA 2ETEA 1AUYA 2IUWA 5JVVA 4I0WB 4P02B 2P4EA 4CUGA 5F3CA 1AL21 2XPJA 3OSDA 2CL2A 2EXJA 2FCTA 2WRAA 1DQ4A 1T6GC 1QJX3 3GNEA 4P9IA 3SH5A 2JDUA 3HWJA 4CDQA 3HOBA 5T52A 5FPLA 5C9AA 4YGEA 5CADA 4P9JA 4PF1A 2VVFA 4FXGB 3H50A 1V6OA 5J7MA 2J1AA 4QGMA 2XL7A 1HN1A 3ASIA 3J7HA 4QGLA 4FT8A 3O1TA 1TME2 4K8FA 4M4RA 2QZ2A 3S30A 4Z2WA 3WUDA 4W6WA 3UGHA 2GALA 5IYYA 4DMIA 3WT3A 2Q8OA 1OUSA 1AXZA 1BBT1 4OHZA 4OULA 4XHBA 5J96B 1CIWA 3EHKA 1IKQA 4R4ZA 3PL0A 4ZU5A 2WT1A 2WZR3 4DUWA 2HJIA 1RMU2 2LM3A 5F3IA 4C0HA 4CXYA 3IZOA 4M0NA 1WD3A 2ZAAA 2VULA 2ZA9A 4MHUA 1V70A 3IKWA 4GAZA 1RTVA 4E4HA 5C4WB 3TEWA 1RGSA 1XB9A 1JZ5A 4G4FA 4AHXA 1AR92 3H8OA 2OVUA 1TG7A 2WLQA 1H8TC 5F7UA 1C8M2 4NROA 4Q4X1 2CHHA 4WM8C 2VUCA 1O59A 2VBPA 1ND3C 5FXXA 4XAEA 1G9CA 1LU2A 2P3KA 4NRMA 3U78A 5J1XA 2LS6A 1JYVA 4FPEA 3VDCA 2E32A 1RHI1 3OY8A 4WM7B 3VGIA 2J7MA 2B45X 2ERFA 4QB6A 4AQ6A 2GZWA 3FUOA 4E4SA 1IOAA 4IERA 1WD4A 5DUUA 4D94A 5ACA2 5FXWA 1QJZA 5DZEA 2ZJCA 2NM1A 2HWE3 2VUDA 5FO8B 4GJZA 2E53A 2ZKNA 5SV5A 3WP3A 5K9YA 1EPWA 2ARXA 2PQQA 5A7NA 2UY9A 1NCQA 1H0BA 4YSFA 1ZA7A 4CXXA 1Y4WA 1AYM3 2GC0A 4AG4A 4KH9A 1UZZA 4CE8A 3O1VA 1YFUA 1P8JA 4JRAA 2JG8C 1H1IA 1A8MA 1WA6X 3RZGA 1HRV3 5E88A 5FLHA 3H3ZA 4HPKB 1ASJ2 2HWC2 4Y5Z0 3PUHA 5F32A 2JKBA 2EVXA 2PAEA 1H4GA 3WHUA 5BPXA 4IEQA 2PHXA 1NA1C 2RS11 3KV4A 2P1BA 1UOJA 4QU1A 2H0BA 2KM2A 3PJYA 3U0ZA 2W92A 4BQ3A 4JQRA 5T5JA 4CCOA 3DV8A 3KB5A 3H7JA 1H1MA 5CYYA 5LEJA 1NLSA 1W8ZA 2ZEXA 5BNNC 4KG8A 4EN6B 1DGRN 1W6QB 3K2OA 1TME3 3OBRA 1IQDC 4UFMA 2QJVA 1LGCA 3WNOA 4XW3A 1CIYA 3PU8A 2PA7A 4FTBA 3GZAA 4COVA 2ZS6B 2QUOA 4XOGA 4KL1A 4X8PA 2BNOA 5DAVA 3CEWA 2VNVA 3ETQA 4QKDA 1UKGA 4OQ8A 2R072 2VTXJ 1RMU3 2HWE1 5HI0A 4BQYA 5IVEA 3VBUA 4LKSA 2YGLA 4PDWA 4PF5A 5D2AA 5FP7A 4CEYA 2O8OA 2P37A 3S5AA 3IDEA 1OF4A 4AI3A 4J1XA 3RRDA 1NT0A 3BOPA 2MNGA 4MXWA 4GB32 3ZXLA 1AR93 4XETA 1UQXA 4IDZA 1AYM1 5ANNA 5FZCA 4LBQA 5GLUA 3VBRC 2KXLA 1J84A 1EAH2 2YBPA 1C8M3 1GNHA 4KG0A 4LO4B 3LE0A 4Q1RA 1W28A 1JHJA 3IMNA 4I3PA 2JG9B 3I2KA 3M3QA 4MHRA 3CHXA 3RS6A 1S0CA 5FOBB 5F3EA 1QY4A 1LOCA 1FOD1 4YG6A 3WW2A 4N43C 4GALA 1EV12 4KU8A 5GKAC 5FPBA 1DQ1A 3H8RA 3N4MA 4G9SB 4XXAA 4LTAA 5ACA3 2DBIA 1W3VA 4N9IA 2XUEA 4H7MA 3BODA 4LHSA 2HWD2 2ZX4A 3KCXA 4DS0A 5J36A 3ES1A 3MF9A 1H2NA 4O9GA 1LGBA 2D5FA 3HN1A 1ENSA 4MH0E 5L9RA 1XNCA 4ZS3A 5BYNA 2WT2A 4HN0A 2FMDA 3CIHA 4RGKA 1H2KA 1OLME 3UNPA 2ADDA 4D7YA 2XR4A 4O7XA 1UD1A 3C7EA 4CU7A 2GH2A 3POSA 2YB7A 3GJAA 1ASJ3 2HWC3 1HQNA 3ACHA 3LPGA 3D0SA 2RM22 3PMEA 1JYWA 2PAKA 5FYZA 2WKKA 4GMP1 5GZFA 2WFF2 4GWMA 4ZS2A 3VBSB 3VD7A 4TZDA 3C7FA 2WA3A 1PZ7A 1JZ8A 4AVSA 1DQ5A 1W90A 4OI2A 3AP4A 1IS3A 2DUQA 4JTOA 4J6GA 1RUC2 2J1SA 4RL7A 3SMHA 2VL4A 1KJLA 1V6LA 3PURA 4YGDA 2GMEA 5FY1A 1PHMA 1LOEA 3ZPYA 3RJRA 2A7AA 3VDDB 5LEKA 1RUOA 2VCAA 1AR91 4I0AA 3WCRA 1QXPA 2A5ZA 3WDXA 5LA1A 1YFYA 1JYXA 4KWLA 3FN9A 4H2AA 4LKDA 4MADA 2QQIA 1SLLA 1ZZ9A 1VIWB 3GGLA 4AGGA 1K5MB 5JSRA 1LOGA 1W99A 3LEIA 3MDPA 1W2NA 2OUHA 2ZX2A 3GBGA 4OZXA 3TWIA 3WOGA 4EYUA 3KT4A 2MEV1 5BNPB 2R073 5ABJA 4J25A 2C26A 2EAKA 1KITA 3EXUA 4XQWA 3VUOA 3CJXA 4HANA 4OI0A 2WQZC 2QQVA 1WMXA 1W9TA 3T2OA 4UFKA 2EXHA 4GB33 3MLKA 5FZ8A 3IBMA 2X8KA 3POBA 3ZN6A 4COYA 2CDPA 2E6VA 2VMHA 2AZ5A 1EAH3 4XJWA 3CNAA 4FPOB 1OA3A 2OA2A 4W6XA 4E27A 3FHIB 4M01A 4XJ8A 3N9OA 3VKFC 1AR72 2IXHA 4QXBA 1ASJ1 4QPIA 1CX4A 1KQRA 2NYYA 4QX0A 1DFQA 3VZKA 1EV13 2ZMNA 3IIIA 3ZXDA 2XVKA 4JGYA 1W6NA 3HNMA 2UWCA 2W1SA 3QCWA 2WNUB 1O8PA 2HWD3 5JXIA 4NWVA 4CDWC 3WP4A 1LTEA 5T55A 3O1OA 3ZSLA 1OH4A 1FT9A 3CF6E 1RXGA 4MO3M 5LA0A 3C2UA 2P34A 2VMDA 4W65A 5IT6A 1B35B 2ID4A 3B94A 4PT6A 4AEDC 2V73A 4IGQA 1HB2A 4RGAA 1JYNA 1PX3A 3WP6A 3LDKA 5JIAA 4C8DA 3BKZA 4OHVA 4NOTA 1ZRIA 1LHWA 3ZSJA 4N8MA 4GH4C 2HH9A 4L0PA 4RR3A 1VBD1 1ZBE2 4YWAA 3UK9A 2RM23 2WZPP 5FY5A 5DAQA 2LROA 2WFF3 2VZRA 5ISLA 2FCUA 5J37A 4B8EA 2A3WA 2Y0IA 2X5IC 2R071 4AEKA 1RUC3 3PTYA 4QMAA 5A3UA 1LHUA 1BCXA 2HEWF 5T5LA 2QQOA 3I2OA 3ENRA 3MZHA 3TYJA 4A6SA 4UYBA 1RUD2 4RS5C 1X33A 4CCJA 1GWLA 3USUA 3T0AA 2PELA 2WQ8A 3KZ4C 1JOJA 3ZN5A 1R081 1V6NA 2R0HA 2YFUA 1PK6A 1SDWA 3CDZB 5I0SA 5IK8A 5CFDB 1GZTA 4YNIA 3HBKA 3LA3A 3R4UA 1ZBA2 1EV11 4LE4A 3NV1A 2DTYA 3J8F2 1QWRA 1QJU2 5IK5A 5DQ0A 5FYUA 4LKFA 4C91A 4FTSA 2XQRA 5CA6A 1QMJA 2HWD1 1NQJA 1JH5A 3U37A 2QQUA 3VD5A 3LSDA 1DYKA 4I09A 4YARA 2XDVA 3THTA 3TEZA 1K3IA 3NKGA 4R4XA 4AEJA 4TLGA 5JXHA 1RJ8A 2D6NA 4CDXC 1MEC2 1L7QA 4K3UA 5HCHA 3RNSA 1ZM1A 3D8CA 5CG9A 2CY6A 3K51A 3W58A 1AR73 3MIFA 4BH9A 4K8RB 4C0BA 4Q8KA 1VR3A 4D6QA 2RM21 1EP0A 2Q30A 4CDQC 1JU3A 4AQSA 2WFF1 3LPFA 5C9AC 1D2SA 4XF0A 4KWJA 3FX3A 5CISA 1GOHA 3B02A 3UL2A 1JXNA 4OVEA 3K3OA 4YM2A 2LALA 1PNFA 3W20A 4OUMA 3LKJA 4CCDA 4FAGA 2FDKA 4OUSA 3KF3A 3AK0A 1JS9A 3KWVA 4LR4A 4TYSA 3E5XA 1VMHA 4D3WA 4EWEA 2Q1FA 1C1LA 3O7OA 1F8VA 3ACFA 3TEXA 3H3UA 1XNTA 5LA9A 3KT7A 4OQ9A 4XFBA 1XU1A 2BGCA 1VE0A 3Q8FA 1QGLA 1IQAA 4TN7A 3T30A 2VPVA 4ZXEA 1LOAA 2F4PA 1ZBE3 3MHZA 3FLTA 4KI5M 3HNYM 2QQJA 3D82A 2QDNA 3AKRA 2RMU1 1UU5A 3OGGA 4DFSA 4YM0A 2PHDA 4E8DA 3HAGA 3SLIA 1GUIA 2UWAA 2EALA 2VCBA 2TBVA 4NUBA 1W9WA 5JI9A 3T2PA 1WGPA 3SITA 4HBNA 3I3MA 2VZOA 3MO4A 4AFAA 1MPXA 5LRSA 1RUD3 2BVBA 2PHTA 1ND2B 3ZYRA 5JUVA 3VBHB 3I54A 5FZKA 1UY4A 1JTZX 1J1LA 1Q8VA 3OYWA 4Y1XA 4R8HA 2PTMA 5J48A 3DEMA 2WT0A 5FZMA 5C6CA 1LJ7A 2XWJB 5LASA 3JQWA 1ZZBA 3FMGA 2R042 3JBG2 4UW3A 3EQEA 1FMD1 3OPWA 3MICA 1DYOA 1ZBA3 1NCQC 3DF0A 5C3OA 3THCA 1PZ8A 2TNFA 5JSPA 2VZ3A 2RJLA 3JB4C 3ZFEB 5LB6A 1WW5A 3J8F3 2VVEA 1QJU3 4IV3A 1N1VA 1ZZ6A 1RC6A 4CDUB 2VGDA 2Y60A 2RS52 3POGA 2VZSA 5IVJA 5FY0A 4WVVA 2VY0A 3IPVA 4AWDA 3ROUA 5L9BA 2RJKA 1CESA 1DQ6A 1N47A 2GMPA 4S2DA 3USSA 1YCIA 1MS5A 2PLV1 3HNBM 1MEC3 3OUIA 4IQPA 4BQXA 2IC1A 5IUQA 2VQTA 3OGRA 5FQ0B 4XAAA 2VQUA 2CYFA 5IVYA 2MHFA 2A3YA 1HN0A 4Q4W2 3K48A 3M7AA 4Q26A 1QH7A 2CGNA 3T1LA 4EWAA 4XMAA 2W1WA 2WNVB 3I2GA 3JCIA 1F15A 3PVEA 2Y38A 3TN92 4QAWA 3DGTA 3ILFA 4QQHA 1OT5A 1IPJA 4FOYA 4HVRA 3I2DA 4BMBA 5FMCA 3DCQA 3J9SA 4P9WA 5DAWA 1QDCA 3KM5A 2XONA 1RUF2 3FHQA 4QB2A 4OI4A 4KGGA 5D21A 3ZYGA 1O8SA 2DUOA 3WX5A 2XJQA 5C33A 3WF1A 4CXWA 3BTYA 2DURA 3IDBB 1VBA1 3FC0A 4WM8B 1RVF2 5BNOB 4MSVA 4XUPA 1MQTB 2GMMA 4P08A 3VBUC 4PDWC 2PHUA 4QKFA 2XUMA 4CEYC 1JYTA 1Q5OA 1TNFA 4DY5A 3P3PA 3P1IA 1ZBA1 5GM0A 3ZFFA 2Q0AA 5DZGA 1NXMA 2JDMA 5A33A 3T2QA 4AZZA 2WABA 3WF4A 5I0RA 4CVUA 3CJIB 3MYXA 1DQ2A 3J8F1 2JICA 1JZ3A 4IE7A 1X9TA 2V72A 1REEA 3KQRA 2VG9A 3ZR5A 2RR11 3WNKA 1W0OA 3W5MA 2GNMA 5FJHA 2YG0A 3ZDVA 2W9XA 5FPUA 1HV0A 3FZ3A 1V9U2 1PGL2 4IGPA 2A6ZA 1CVNA 3E1F1 1MEC1 1LULA 1Q8QA 3MIEA 4QPGB 4D8MA 2ZHNA 2QQNA 5JR7B 4NIGA 5FZ6A 3OB8A 5FO9B 3MF6A 3JBG3 2QFEA 2R043 4M0HA 1SHWB 4OI1A 4AVBA 3OD0A 3LFIA 3MW4A 1FX5A 2FBEA 4MG2A 3ACIA 4Q0SA 1TQ5A 4YFWA 3TAYA 5EV7A 4NPLA 1W06A 5LBFA 2B7YA 2RS53 3ZYHA 1WW6A 1ST8A 2DF7A 1WCSA 4LK7A 4N7IA 4XF1A 2ARCA 3KCCA 4CCCA 1US2A 5K0UA 5GLWA 3WP5A 3B5LB 5HCAA 1LNSA 4XBNA 1I3HA 3I2IA 5FK7A 4WVMA 2RJ2A 3NAPA 5IWFA 2VBBA 5FZBA 4CUBA 3UKVA 2JJ6A 1MS4A 1O4YA 2Y33A 3H3LA 3JZVA 4QKBA 1F31A 3MUY1 4Q4W3 3VZNA 1AYN2 5GZDA 3DL3A 1CAVA 3TN93 4Z1VA 1DCSA 2VZVA 4QM9A 1OD5A 2VJXA 2YPJA 1CAUA 4C90A 2VD7A 3EO6A 3BGAA 5FJKA 1YQ8A 1VLNA 2XVLA 5JXJA 3UGFA 4ZHNA 2CU5A 2I45A 1RUF3 1SDDB 1U5XA 1Z0HA 4JAAA 1AXKA 4AFBA 1KFUL 5GLVA 5KHGA 1LRHA 5JOXA 2ZBJA 3MI8A 1RVF3 1RYYA 1UPSA 2ILMA 4NIAA 4MGZE 4AEMA 5ABJC 1Z7S1 1SQ4A 3AZZA 2R062 2DFCA 3MFAA 3JBG1 2R041 3OGJA 1SFNA 4P9YA 4BJ0A 1VBB1 1OA4A 4IE6A 3SH4A 4Y24A 2WNEA 1J3PA 2B46X 2F6BA 2XJSA 5KXCA 2OYZA 1RUI2 2C24A 5H9RA 2YU1A 2GP3A 1JYCA 3OPZA 4PIZA 4YVWB 2G1MA 1VRH1 2VMFA 2OQ6A 4QPIC 3U14A 1X7NA 3WD5A 3H1WA 5JR2A 2VUJA 1V9U3 1OQEA 2YUEA 1DYPA 2YGMA 3DKWA 4IE4A 4JGYC 4CTEA 1A78A 4YRDA 3MV01 4HSLA 1COV1 4K7JA 2B4KA 3PIJA 4JQTA 4QWNA 5FZ4A 3WG2A 5CKQA 3WQ0A 1GQHA 3I2FA 1U0AA 3VBFB 3W5NA 1GNYA 4COZA 2XMLA 4XQ4A 1UYYA 4P9LA 5JPNB 4F8AA 1QJY2 2ET1A 3AP6A 3H1YA 4LA2A 5T50A 3TN91 1X50A 1DGLA 3NNMA 3O14A 2A70A 3AVSA 1QF3A 4LNVA 4L11A 1CAXB 5A7WB 4BLJA 1ONAA 5LY1A 1VB2A 1J83A 4EN8B 1IG0A 3ECQA 4RR3C 2NMOA 4I2OA 1PNGA 1UPIA 1W9SA 3N7KA 1DIWA 1DDLA 1XRUA 3RSJA 4KNCA 1UX6A 3ZXEA 4I02A 4ARXA 5BXXA 1PM4A 3CZUA 3ETPA 1JHNA 1ULPA 2NQYA 4FI9A 1AX1A 5CNAA 4AFMA 2HLEA 3V56A 5IATA 4LBOA 1XE7A 3QOPA 1YYNA 2IXCA 2DCKA 4UW4A 1AYN3 1XPWA 1ZX5A 3O0WA 4N9HA 3IT8A 4S2HA 4XQDA 3N9QA 2RE9A 2IZWA 2ZKLA 3K4DA 4NHYA 5DDJ1 1CWPA 3ZMNA 2ZHLA 4YFZA 2WWUA 1LENA 4K40A 1MS3A 4NJ4A 3VL8A 4LORA 4N53B 1HRV2 1HXS1 1PK6C 4WM7A 5FMBA 2CTVA 1J3RA 1US3A 2VQAA 2X53S 3DECA 3NW4A 4BXFA 4BK4A 1HW5A 4DY3A 1QQP2 1BLZA 1KDMA 3I4IA 5K8SA 5DUXA 2BNNA 3PU3A 2UY8A 3URFA 5CKNA 1XE0A 5FKBA 2CAVA 1RUG2 2BTVC 5HV4A 2W68A 2Y6FA 4MGIE 4MXVA 2R063 1VJ2A 2XBO1 3PDQA 4LOTA 4KGQA 5FWEA 4ATFA 1PGW2 5DN2A 3ZMOA 4PLNA 2KA3A 3IB3A 4AHWA 5J09A 4ASKA 4IV1B 3PNAA 1R092 4E4DX 5FYIA 1OSGA 3DPRB 3NJXA 2G9FA 4CCEA 5HCFA 2V4AA 4HPKA 3AKSA 2QQPA 1DZTA 2B9VA 2Q1ZB 1RUI3 1E5IA 3PIGA 5FYYA 1W6MB 5JAXA 4IEZA 4LQRA 1LODA 1VAMA 4CU9A 4K1YA 4JGZA 3GCXA 5EIYB 3THDA 1JU4A 3WNMA 2NN8A 4A7KA 3SXWA 1LAJA 1OVPA 2QQWA 3RJ2X 1HB1A 2GC3A 2NP0A 2P17A 1F5FA 1UZVA 2ZMKA 2HEYF 2BQPA 2WQ4A 3QD6A 1JYIA 2XH6A 2HWF2 1D0GA 1MVEA 5A7OA 3GCWA 1AYN1 1OKQA 2CDOA 3IM0A 3O0XA 3R6SA 3NV2A 4AOCA 4AW7A 1NQDA 4B3NA 4CPBA 1QJY3 1W6QA 2WAOA 1GLHA 2WC2A 4LO6B 5FZ1A 3WDVA 4BPZA 2WR9A 5JWPA 1HV1A 2X5IB 4KMQA 4META 4YVSA 5IVCA 5JMOA 2A6XA 3GM8A 3T3YA 3J4UH 3WG3A 3LDBA 1EUTA 2JD9A 3MV11 2VOTA 4AGVA 2D97A 4BYYA 1O5UA 1V00A 1GQPA 2A6VA 2DWRA 2QQMA 4RYDA 1UZYA 3RZLA 1L7LA 1ZRFA 3NV4A 2Y6JA 1FV3A 1CJPA 4U36A 4BU2A 3TBDA 5FPAA 1G8WA 2Q8EA 1ENQA 2AYHA 2DV9A 3KQ4B 1UX7A 4QHOA 3A23A 4Y1UA 3RZKA 2NMNA 5B4NA 1F2NA 3LF7A 3HR9A 1O7FA 5FZFA 3SC7X 1K5JA 2R061 3HJRA 4XILA 4K20A 4V2WA 1QJX1 1TVGA 4JRLA 1UXZA 2ZGSA 4CPBD 5I8YA 1CPNA 5FUIA 2JG9A 4OMCA 3TNQA 3SKJE 2W39A 4OUEA 1F4AA 4AI0A 3S57A 3AC0A 4BOWA 1RUI1 5JDBA 5FZ3A 1ULEA 4BA6A 1ZRRA 3N35A 2QCSB 4XXPA 5C3QA 4JC1A 1XU2A 4Q4Y2 5F6LB 4YGCA 1A8DA 5IHRA 1QQP3 4URAA 2PN5A 5B4XA 2WZR1 4P5HA 5FO7B 4IV3C 2P3YA 1RUG3 2RHPA 1I6XA 3MIBA 3PTRB 5KWRA 4D7TA 3MEPA 4BQ4A 4CDQB 5FZAA 2FMYA 2ZGPA 1QJY1 1SFYA 5L19A 4RN5A 2DCTA 5F5AA 4COWA 4IETA 1R093 3RVHA 3ZSMA 2UYAA 3E6CC 1OI6A 1WKYA 4GMP0 1QJFA 5A7QA 2YBKA 4HSJA 1POV3 4XJUA 3VBSA 1DZQA 3DUIA 4K6BA 2C6SA 5DABA 3S6PA 2VO5A 1KGYA 3HPNA 4Z82A 1STMA 4QQPA 1JUIA 4QX2A 1AZDA 4QPYA 3B9CA 1E5RA 1NG0A 1ZZ8A 5JI7A 3VDDA 2HWF3 3Q8CA 3I2JA 1C4RA 3WHTA 1K45A 2ZABA 4JDMA 3H42B 4A41A 5FZOB 3W59A 5D8AB 4A2UA 4E8CA 3SCHA 2VOKA 3OPTA 1YWKA 3M3EA 5L7OB 5EFUA 3JXSA 4EV0A 2OX0A 2Q8CA 3EBRA 2WO3A 4DEQA 1JMUB 1HRV1 1K5MA 1DBNA 3T1MA 1CQ9A 4DEVA 1G9AA 1G6NA 2LW8A 3WLUA 3O5SA 5I0UA 3ZFFC 5BNPA 4B4RA 1QQP1 2JE8A 4PHZA 3MIDA 4QHBA 5CFCB 3WNNA 4UW5A 5FDBA 4GWIA 2WWJA 1R1ZA 2W47A 1VAVA 3A0NA 5FYBA 2D40A 1NCQB 1HB4A 1PGW1 4CSWA 4P9XA 3OBTA 4XFHA 1AX0A 3VD4A 1OBNA 5G05L 1QOTA 1Y9QA 4A42A 1YEWA 2MPFA 3MW3A 4XFIA 1TME1 4XTPA 3BTAA 2WBKA 2VOXA 4QDQA 1BK1A 1POV1 3DXTA 3ME2A 1IPKA 1GFF2 4Q4Y3 3RYKA 1KFXL 4UFLA 1OOPB 1R64A 1LHNA 1LHVA 1GR3A 2EIGA 2WNUA 3NNGA 4J1WA 5HXVA 5KXEA 4B29A 3I3BA 1LU1A 1DLCA 3WV6A 2UWBA 1RMU1 4PIYA 4AFCA 2W08A 3O12A 1XYNA 2XKPA 1B35A 3K46A 2K0GA 5F3GA 5GLZA 2HWF1 4Z2AA 1GBGA 3AJYA 3T0BA 4LLFA 4LBMA 1UMZA 2D43A 5K0UC 5KHIA 2CGOA 1XXNA 3ABZA 1ZNPA 5CU1A 2NZ9A 1JZ4A 4IUGA 5KHKA 3AJZA 3MBWA 4CCKA 1C8M1 3OUHA 3NAPC 2IFRA 4K9SA 3T2TA 3V0AB 4YW1A 5C71A 4HETA 4XF4A 5CG8A 5T54A 3GHNA 2RS32 1Q8PA 4Y22B 4LBKA 3I3QA 2VUAA 4QKNA 3WVJA 3VKOA 4ZZ8A 1IS4A 3LEMA 4MYEA 5C7GA 1WMDA 1WW7A 2VQ0A 2ZAHA 4QGNA 1NCRB 1SBEA 1XNKA 2D6PA 4MUVA 3ZYJB 5ACA1 4FXKB 1LGNA 2Z4FA 4WV8A 2YROA 2UURA 1W04A 2Y0OA 5ERLA 5T5OA 1RUNA 2DU0A 5FCCA 4AHYA 4KU7A 4MZUA 1BHGA 4JCKA 3D5OA 1H9PA 4DINB 1GU3A 3P6BA 3GZUC 5I8SA 3WNPA 4AQ2A 4LHKA 2DVGA 1UU6A 3TRSB 5CFDA 3B93A 2ZGNA 3LDRA 3LAGA 4QXHA 4EZHA 5L36A 2PXJA 2HBUA 2XJVA 2GP5A 1CZSA 1NXD1 3AYCA 3H0OA 3IDAA 4LO7A 2HWC1 4NO4A 1C28A 4NHXA 4EWDA 4OHYA 1J58A 3RI8A 3RWNA 3SH3A 4N90A 2VNOA 3WINE 3QH7A 5FZEA 2OKXA 1OC1A 2ATFA 4GJYA 5IJRA 3AXEA 5A32A 2JDPA 3I97A 2ZXQA 1N3OA 1O4TA 1GANA 2B9UA 2C9AA 3ZXFA 5F1RA 2VTFA 4FAHA 2XL9A 1UYZA 2J22A 4UAPA 5C8WA 3ZOIA 3WG4A 4P5YA 5FFOC 3B9IA 1AF9A 2D3SA 2P3IA 3BPSA 5E1RA 3RMYA 3DYOA 2I2SA 1W3XA 2FCVA 3BU7A 1X8EA 3ZYBA 3ZFGA 3KD4A 5CAZA 3WQ7A 1YFXA 4JTNA 1G9DA 5FWJA 1NE6A 2P6CA 4UI9L 2DFBA 3QACA 2I74A 4FPYA 5A7SA 1CZTA 3VBOB 2R16A 5I93A 4YW4A 1C5HA 2BFUS 2PHRA 5EJZB 1YXWA 3LA7A 4MOAA 2AH2A 3T4VA 1FV2A 2J1RA 4IEOA 4XFCA 5FZ7A 5FYSA 1OFNA 3BPZA 4TXWA 1FXZA 1SPPB 4H7LA 1CX1A 3ZXAC 2BGOA 2YMZA 4GB31 4BXSV 4O65A 1Y7BA 4MGSA 2R7EB 4FQZA 1EAH1 1S4CA 2QE3A 4LT5A 3CL1A 3SEEA 3S7EA 1YIPA 2RS33 3GBFA 5DXDA 3ZPOA 1XNDA 5A3WA 5A80A 2YBSA 3WF3A 4A45A 1PO12 1OURA 5E6HA 5LA2A 2X05A 4BE3A 3VDBA 2A73B 1CONA 1GZWA 5FY4A 4NIIA 2D5HA 4M00A 3LA2A 4SBVA 1W2TA 4WM7C 3BN6A 5FV3A 1OMIA 5AFEA 4RQPA 5JZGA 1H6XA 5C8CB 4QQ2A 5CVRA 3PUSA 1NLQA 3KVBA 2WL1A 1TNRA 3IAQA 5HXMA 3M1HA 2JWPA 4TLFA 4DQAA 4IEUA 3QH6A 4CA9A 3M3OA 1FPN2 4RHV2 5A1FA 4CRQA 1VBE3 3AMMA 5EXOA 4FPCA 2J42A 3HBZA 4KQ7A 4HFSA 3EYPA 1GOFA 4B1LA 1S0FA 1CJDA 1U5YA 2XJRA 3NMBA 5FMDA 3ZFEA 2WA4A 4CDUA 1G9BA 1XC6A 2CGPA 4FOVA 5A1AA 1PVC2 2IXJA 2DDUA 1PM7A 3I59B 4CU8A 5JCTA 1V0AA 4UXAA 3WCSA 1RUC1 5FP4A 2P5BA 1LR5A 2DVAA 2WDBA 4JGZC 2WS92 1REDA 3H9AA 2W46A 3R0RA 2GC1A 3V64A 3ZKYA 5FQ0A 3ZYPA 2GNDA 3POYA 1UYPA 3NL1A 2TUNA 4EN0A 2RS31 2WNVA 1OA2A 3S7IA 4UWDA 1LB2A 2W1QA 5DAPA 3IMMA 3JD72 4FP3A 3N7MA 1XOYA 2ZACA 4CEWB 1QNWA 5E8AA 1BVP1 2QVSB 2FD8A 4YVSC 4NPRA 1PIV2 3ORJA 5F6KA 4Z8BA 2Z2SB 2JENA 4B1MA 4E4ZA 2D6OX 2A1XA 2OW4A 2WO2A 3VHNA 2BP6A 2O1QA 4W4ZA 4AAXA 2JB8A 1OLQA 2GH8A 1K12A 4XFFA 4Q29A 3LIHA 1VPHA 4V1PA 5BNOA 1MQTA 1T2XA 2YC4A 3LGRA 1J59A 2K2SA 1UWWA 4LUKA 1IHMA 4BCUA 3S5QA 4LMFA 4ASLA 4GWNA 2O14A 4BQ2A 2BU9A 1UMHA 1S0JA 1V6IA 5EPAA 1AR71 4BQ5A 4JDOA 1BXHA 3CJIA 1CAWB
chains in the Genus database with same CATH topology
5A7NA 2WWJA 5A7OA 1VRBA 3PURA 5FYUA 2W2IA 5FYBA 5FY1A 5FXZA 4Y4RA 5KR7A 4XDPA 5FPVA 3ZLIA 3KV6A 4CSWA 5FZ1A 5FZ7A 5FYSA 3DXUA 5IVCA 2XDVA 5FYCA 4EZ4A 2YU1A 4LXLA 4V2VA 3LDBA 3N9LA 3KV5A 2GP3A 3AL5A 4GD4A 2OQ6A 3AVRA 4CCLA 4CCNA 2OT7A 5A7PA 2OS2A 2Q8DA 3LD8A 3DXTA 5F32A 3U4SA 5A3PA 5CEHA 3ZPOA 4BU2A 5FPAA 2Q8EA 3PUQA 4D6QA 4QWNA 3KV4A 5A3WA 5A80A 4EYUA 2YBSA 4QU1A 5FZ4A 4LITA 5FZFA 2XMLA 5E6HA 4CCOA 4V2WA 5FUNA 5F3GA 3K3OA 5FY4A 5FV3A 5A7WA 5FUPA 5FZ8A 3AVSA 4Y33A 5A7WB 4LIVA 5FZDA 3PUSA 5FJHA 5LY1A 3K2OA 3KVBA 4CCKA 5FPUA 3N9MA 3KVAA 5ANQA 4IGPA 5FZ3A 3PU8A 5K4LA 3PUAA 4AI9A 5A1FA 3N9OA 4CCMA 4UF0A 4QXBA 5FY8A 5LWBA 4TN7A 5FZ6A 4URAA 4CUGA 5F3CA 5IVEA 5FYTA 5A1LA 5A3NA 5FP7A 3PTRB 5F39A 5FYVA 4NUBA 5F5IA 5FZOA 5FPLA 3N9QA 5F2WA 5F5CA 5FZAA 5FP4A 2P5BA 5FZCA 3UYJA 2YPDA 2WWUA 5F2SA 2YBPA 4IGQA 5F5AA 5FYMA 3RVHA 5FZ0A 5FZGA 4C8DA 5FZKA 4LIUA 5IVFA 3N9PA 5A7QA 4QXCA 2YBKA 5F3EA 4XDOA 4BXFA 4QXHA 4EZHA 2OQ7A 2PXJA 5FZMA 4DIQA 4HONA 5FBJA 2GP5A 5FZBA 5IWFA 4AAPA 4DO0A 5FPBA 3PU3A 5FP8A 5IVVA 5FY5A 2XXZA 4UF0B 5F3IA 5A3TA 3OPWA 2YU2A 5FZ9A 5F37A 5ISLA 5FYHA 2XUEA 4GAZA 5FZEA 3PDQA 5FWEA 4E4HA 4GJYA 4HOOA 4QX7A 3NJYA 2VD7A 4D6RA 5FJKA 4ASKA 5IVJA 5FY0A 5FZOB 5FY7A 5FYIA 4CCJA 3KV9A 5FP3A 5FZHA 3OPTA 4D6SA 5FXVA 5FXXA 5FYYA 5IVBA 3N9NA 2OX0A 2Q8CA 3U78A 3AL6A 5LY2A 4Y3OA 5LW9A 5FZIA 5FZLA 3K3NA 4QX8A 5FYZA 5IVYA 5FP9A 5FXWA 5IW0A 5FY9A 4BISA 4IGOA 4GJZA 5FWJA 5A7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A7N A;  2WWJ A;  5A7O A;  1VRB A;  3PUR A;  5FYU A;  2W2I A;  5FYB A;  5FY1 A;  5FXZ A;  4Y4R A;  5KR7 A;  4XDP A;  5FPV A;  3ZLI A;  3KV6 A;  4CSW A;  5FZ1 A;  5FZ7 A;  5FYS A;  3DXU A;  5IVC A;  2XDV A;  5FYC A;  4EZ4 A;  2YU1 A;  4LXL A;  4V2V A;  3LDB A;  3N9L A;  3KV5 A;  2GP3 A;  3AL5 A;  4GD4 A;  2OQ6 A;  3AVR A;  4CCL A;  4CCN A;  2OT7 A;  5A7P A;  2OS2 A;  2Q8D A;  3LD8 A;  3DXT A;  5F32 A;  3U4S A;  5A3P A;  5CEH A;  3ZPO A;  4BU2 A;  5FPA A;  2Q8E A;  3PUQ A;  4D6Q A;  4QWN A;  3KV4 A;  5A3W A;  5A80 A;  4EYU A;  2YBS A;  4QU1 A;  5FZ4 A;  4LIT A;  5FZF A;  2XML A;  5E6H A;  4CCO A;  4V2W A;  5FUN A;  5F3G A;  3K3O A;  5FY4 A;  5FV3 A;  5A7W A;  5FUP A;  5FZ8 A;  3AVS A;  4Y33 A;  5A7W B;  4LIV A;  5FZD A;  3PUS A;  5FJH A;  5LY1 A;  3K2O A;  3KVB A;  4CCK A;  5FPU A;  3N9M A;  3KVA A;  5ANQ A;  4IGP A;  5FZ3 A;  3PU8 A;  5K4L A;  3PUA A;  4AI9 A;  5A1F A;  3N9O A;  4CCM A;  4UF0 A;  4QXB A;  5FY8 A;  5LWB A;  4TN7 A;  5FZ6 A;  4URA A;  4CUG A;  5F3C A;  5IVE A;  5FYT A;  5A1L A;  5A3N A;  5FP7 A;  3PTR B;  5F39 A;  5FYV A;  4NUB A;  5F5I A;  5FZO A;  5FPL A;  3N9Q A;  5F2W A;  5F5C A;  5FZA A;  5FP4 A;  2P5B A;  5FZC A;  3UYJ A;  2YPD A;  2WWU A;  5F2S A;  2YBP A;  4IGQ A;  5F5A A;  5FYM A;  3RVH A;  5FZ0 A;  5FZG A;  4C8D A;  5FZK A;  4LIU A;  5IVF A;  3N9P A;  5A7Q A;  4QXC A;  2YBK A;  5F3E A;  4XDO A;  4BXF A;  4QXH A;  4EZH A;  2OQ7 A;  2PXJ A;  5FZM A;  4DIQ A;  4HON A;  5FBJ A;  2GP5 A;  5FZB A;  5IWF A;  4AAP A;  4DO0 A;  5FPB A;  3PU3 A;  5FP8 A;  5IVV A;  5FY5 A;  2XXZ A;  4UF0 B;  5F3I A;  5A3T A;  3OPW A;  2YU2 A;  5FZ9 A;  5F37 A;  5ISL A;  5FYH A;  2XUE A;  4GAZ A;  5FZE A;  3PDQ A;  5FWE A;  4E4H A;  4GJY A;  4HOO A;  4QX7 A;  3NJY A;  2VD7 A;  4D6R A;  5FJK A;  4ASK A;  5IVJ A;  5FY0 A;  5FZO B;  5FY7 A;  5FYI A;  4CCJ A;  3KV9 A;  5FP3 A;  5FZH A;  3OPT A;  4D6S A;  5FXV A;  5FXX A;  5FYY A;  5IVB A;  3N9N A;  2OX0 A;  2Q8C A;  3U78 A;  3AL6 A;  5LY2 A;  4Y3O A;  5LW9 A;  5FZI A;  5FZL A;  3K3N A;  4QX8 A;  5FYZ A;  5IVY A;  5FP9 A;  5FXW A;  5IW0 A;  5FY9 A;  4BIS A;  4IGO A;  4GJZ A;  5FWJ A;  5A7S A; 
#chains in the Genus database with same CATH topology
 4FFF A;  4DUV A;  5IK4 A;  2JG9 C;  2WN3 A;  4JX0 A;  1RB8 G;  4NAO A;  1ULO A;  1PO1 3;  3IIA A;  4XDP A;  5FPV A;  1E5H A;  3RWK X;  2JEM A;  5HV0 A;  1W0P A;  3LFM A;  1WCK A;  2WN2 A;  4GZ9 A;  3HD8 B;  4ZY9 A;  1V6M A;  2ENR A;  4FFG A;  3V0B B;  4EZ4 A;  4FP2 A;  1NE4 A;  2PHW A;  2FDI A;  3PVN A;  3ILN A;  3N9L A;  2XB6 C;  1IPS A;  4YZ2 A;  4QPG A;  1W6O B;  3N36 A;  2VVD A;  4ZPI A;  4CCN A;  2Q5T A;  4Y26 A;  3LD8 A;  4GWJ A;  4XCA A;  1D2Q A;  1FPN 3;  4RHV 3;  4XZP A;  4XJ9 A;  4FCA A;  5CFD C;  4FVV A;  3S0M A;  3MPB A;  1QNY A;  3K4Z A;  1YO8 A;  4AVV A;  1J3Q A;  1ZBE 1;  3W9A A;  5I8T A;  4JHZ A;  2XKO A;  2ZGM A;  2ZOE B;  4BQW A;  3POW A;  3MLJ A;  3VKL A;  1OKO A;  3VLB B;  4CP1 A;  5FPX A;  1OVS A;  4AK3 A;  3H8X A;  1JUH A;  1PVC 3;  2LRP A;  1VMJ A;  2Q1M A;  4MLO A;  1RUE 2;  4QDS A;  1AXY A;  2G19 A;  1ULC A;  2JDH A;  2ZX1 A;  3DN7 A;  1JOB A;  1JN2 P;  3VBS C;  1C8N A;  1RUD 1;  2D7F A;  2VMC A;  1HRI 2;  2WS9 3;  1H9W A;  3F2Z A;  3R4D B;  1H8T B;  1W9Y A;  4XEZ A;  3T09 A;  4XC9 A;  4ISQ A;  4ZKT B;  4YW3 A;  5A6Z A;  2GNT A;  2NPI A;  3NWK A;  1ND3 B;  3AX4 A;  2Y8K A;  3FUQ A;  1ODM A;  4QX3 A;  3ACL A;  3VDD C;  4QT6 A;  4ZZ5 A;  1LOB A;  3JD7 3;  3R4S A;  5A1L A;  5KHH A;  5IK7 A;  1APN A;  1F9K A;  1XQN A;  1M4W A;  2ADE A;  4P9G A;  2VOW A;  4M3C A;  4RSU A;  3GXU A;  1UW8 A;  1OUX A;  3HEI A;  3U75 A;  5DAX A;  2ZEY A;  1QJU 1;  4XF9 A;  1PIV 3;  4XJA A;  5J3U A;  3T08 A;  5FYM A;  3MUZ 1;  1ZZ7 A;  1UY2 A;  3OEA A;  4MGQ A;  4E9K A;  3WY6 A;  1UIK A;  2YV8 A;  4CP0 A;  4WBB A;  2B8M A;  5FZG A;  3NNL A;  1K5M C;  4U2A A;  3BOW A;  3ZXK A;  4XDO A;  4SLI A;  3E6B A;  1IKP A;  3OYW B;  2BPA 2;  3BU0 A;  2YXS A;  3AZY A;  4Y20 B;  5BNP C;  4HON A;  1S0D A;  1D0H A;  2JG8 B;  4LUM A;  3GBW A;  2PFW A;  2PMW B;  1FPN 1;  2W95 A;  2XHK A;  3ELN A;  4R9D A;  4RHV 1;  3UJO A;  1L7R A;  2GSY A;  1G86 A;  2FZ2 A;  1AR8 2;  2VEC A;  2VME A;  4FFI A;  5FMO S;  5FZ9 A;  2VU9 A;  4AVC A;  4OFG A;  4GUL A;  4E2Q A;  3GDB A;  3NRU A;  3ZYI B;  2ZX0 A;  3OBZ A;  1S2E A;  1BK0 A;  3BAL A;  4W50 A;  3VHR A;  3ZYF A;  4NRQ A;  1SLB A;  3J7M A;  1YQC A;  3PMS A;  4GIQ A;  5EQU A;  2H6B A;  3NJY A;  1NA1 B;  3ZSK A;  1W9F A;  5FY7 A;  1YIF A;  3MGU A;  1ZZC A;  4YW5 A;  3WEZ A;  5FP3 A;  3U10 A;  4YVW A;  1QXJ A;  1S55 A;  4EJR A;  4B4Q A;  3Q8B A;  1DGW X;  2CSG A;  1VMF A;  2RVA A;  3G7D A;  3RG0 A;  5LW9 A;  1WCD J;  5BNN B;  5JPM B;  3GF6 A;  3U07 A;  3VB9 A;  2WNU C;  3PJQ A;  4HVO A;  2BWA A;  4HK8 A;  5FZL A;  1U12 A;  2ZZJ A;  4QQO A;  5FP9 A;  2BZD A;  3TEY A;  3VDA A;  1JOD A;  5D1I A;  1BMV 2;  2WO1 A;  4RD7 A;  3GYD A;  3VBF A;  1B35 C;  1WME A;  2D6L X;  4UT5 A;  3WZ1 A;  2JDZ A;  2WZ8 A;  2JDY A;  5C3S A;  2YHJ A;  3CZJ A;  1VRB A;  3FL7 A;  4FSJ A;  5B2G B;  3AKP A;  2YYO A;  1CAX A;  2VNR A;  2VCC A;  1RUE 3;  1M06 G;  2HBT A;  5A6Q A;  1CPM A;  2FDG A;  2GDF A;  1MR5 A;  1GV9 A;  1OHF A;  1Y3T A;  3AVR A;  4XIO A;  1YI7 A;  1HDK A;  2PQS A;  2Z79 A;  1HRI 3;  2EIC A;  3BI3 A;  4NN0 A;  2OS2 A;  4XPV A;  3VBR B;  3ZXJ A;  3H1M A;  2OPW A;  2QNK A;  2OZJ A;  3GZT B;  4QD2 A;  1UY0 A;  1RIR A;  5CZK A;  5A3P A;  3MIG A;  4BQ1 A;  4XIK A;  5F9T A;  2BER A;  2JDA A;  4HXC A;  4OZO A;  3WF0 A;  1ZVF A;  1O6U A;  3OTF A;  4R9C A;  1KS5 A;  2VXR A;  1O91 A;  2DYC A;  2ARB A;  4LIT A;  4LHL A;  4QXK A;  4N43 B;  5EWS A;  5FLI A;  3SNM A;  5T3N A;  3VKN A;  1SCR A;  2EXK A;  2CWS A;  2XWB B;  2JE9 A;  1KS4 A;  1N1Y A;  3T4H B;  4IEY A;  4N53 A;  3LEK A;  3Q8A A;  2QBX A;  2VXJ A;  5BY5 A;  1DZR A;  1MS0 A;  1RHI 2;  1TZO A;  2V4V A;  4HN1 A;  4IL7 A;  4XE9 A;  3LCP A;  5GLT A;  1U5I A;  2RS5 1;  3THP A;  4AE2 A;  2VW2 A;  1SLI A;  2JDN A;  1SBF A;  2A75 A;  3D4K A;  4DO0 A;  5FKC A;  4L99 A;  2ZGR A;  1I5P A;  5A3O A;  2V5D A;  1UZW A;  2WSV A;  2VZQ A;  3IAP A;  1RUJ 2;  2XLG A;  2ZGU A;  3OOX A;  2D3P A;  3AFK A;  4Q0P A;  3CQO A;  3POJ A;  4Y5S A;  1AR8 3;  3AZW A;  2WNO A;  2C1F A;  2UU8 A;  4Q4W 1;  1GYK A;  4IV1 A;  1MVQ A;  3DPR A;  3B3Q E;  1KD7 A;  5F5C A;  1FYU A;  4BM8 A;  3E5Q A;  3A4U A;  3O1P A;  1W6M A;  2YPD A;  3A0K A;  1DQ0 A;  5GZC A;  2WLP A;  3EJK A;  5FZ0 A;  5EJ3 A;  1RUE 1;  3KHC A;  1UY1 A;  3APB A;  4C1W A;  1WCQ A;  5FTT C;  1FNY A;  2DBN A;  1RUF 1;  2VZT A;  4Z07 A;  4ES9 A;  3ZFG C;  2B39 A;  4QPW A;  5FBZ A;  1QKQ A;  3BB6 A;  5JLV A;  1H30 A;  4LA3 A;  2RS1 2;  4Z92 B;  1HRI 1;  4DIQ A;  1OF3 A;  4QM8 A;  1XE8 A;  3JB8 A;  5CB7 A;  1I5Z A;  3VZJ A;  4AR2 A;  1POQ A;  4QX1 A;  3AMP A;  5A6Y A;  5IVV A;  1W0N A;  1RVF 1;  1S0B A;  4UF0 B;  2I07 B;  5F37 A;  4IXL A;  2QQK A;  3GAL A;  5C4W A;  3WDT A;  4ZU7 A;  1MS8 A;  4ARY A;  1T6B X;  2P2K A;  4O61 A;  4ONU A;  1XYP A;  3RMX A;  4ATE A;  1DF0 A;  5DZF A;  2PHL A;  1L3J A;  3WR0 A;  4PJY A;  1CAU B;  2RDR A;  3A21 A;  4XBQ A;  1HKD A;  3BUC A;  2ORX A;  1BZW A;  5FZH A;  4XAC A;  1Q3E A;  3I3E A;  3NNJ A;  4H3W A;  3RZJ A;  2J1T A;  2P3J A;  4BHP A;  4MGT A;  5FZI A;  3J7N A;  4Q8L A;  2ET7 A;  2QTW B;  3KF5 A;  5AC9 2;  4TTG A;  3WSO A;  1V9U 1;  1PGL 1;  2LUW A;  2PYT A;  1WWY A;  3ZSE A;  4FPK A;  1A6C A;  3TNP B;  1LED A;  3VD3 A;  4A7Z A;  4D0Q A;  1KJR A;  4PLO A;  1AR8 1;  1QXR A;  4RQP C;  5JZG C;  4YG3 A;  5KR7 A;  2ZPX A;  3RZH A;  4L9B A;  3VHO A;  3KV6 A;  2GU9 A;  2YFZ A;  4Q0Q A;  4DXS A;  2ZGT A;  3OBA A;  4LBJ A;  1I1E A;  3DXU A;  2R1B A;  1FOD 2;  2VNG A;  1ZYB A;  2WZE A;  4LXL A;  4B7E A;  4DXR A;  3AMQ A;  1RHI 3;  5APA A;  5EZW A;  4CDW B;  4IND A;  1IS5 A;  4LEJ A;  1LCL A;  1Q56 A;  1YQ5 A;  3CMG A;  2OT7 A;  3RFR A;  2ZEW A;  5A7P A;  4AED B;  2PAM A;  3C7G A;  1DU3 D;  4UBG A;  3ZFE C;  2BFU L;  3JUU A;  5DUV A;  1DHK B;  2BOJ A;  4M4P A;  4CDU C;  2FZ1 A;  1D4V B;  4ET7 A;  1YJL A;  1RUJ 3;  4GH4 B;  4WVW A;  1WW4 A;  4LUL A;  1HX6 A;  2ZGL A;  3I7D A;  1BMV 1;  3AZV A;  1ULF A;  5LBC A;  5F5Q A;  4YW7 A;  2EID A;  5FUN A;  4JVA A;  1BKZ A;  3L2H A;  3UJQ A;  1B09 A;  4YW2 A;  3GJB A;  3UV9 A;  3NJZ A;  2VR4 A;  4NWW A;  4QQL A;  5GZE A;  4DXZ A;  1UOB A;  2JIJ A;  4ORF A;  3OGV A;  1PZ9 A;  1SLC A;  1E5S A;  4Q2F A;  5CBL A;  4XUO A;  4XYX A;  2WNV C;  3FFQ A;  2GC2 A;  4RS5 B;  4PI0 A;  1HQW A;  4K1Z A;  4CCM A;  3MPP G;  1PMI A;  2RS1 3;  4HKO A;  4F83 A;  2IWG B;  3FBY A;  1RL3 A;  1H1A A;  4CP9 B;  2CAU A;  4YZ1 A;  1SLT A;  2E7A A;  2HKX A;  1PO2 2;  1JBC A;  2N7G A;  2TEP A;  4JHT A;  1N3P A;  2JD4 A;  3M2M A;  5D8A A;  5F5I A;  5FZO A;  5FYV A;  4HMZ A;  4Q0V A;  4XFG A;  1NAE A;  5I0T A;  1V6J A;  1JZ6 A;  5L7O A;  5G04 L;  1OLM A;  3C7H A;  5BNO C;  1UL9 A;  4XDQ A;  4DZG A;  3EB7 A;  1MQT C;  3LOB A;  2R1D A;  4IE0 A;  3N9P A;  3O1U A;  1S2B A;  2YC2 A;  1J1T A;  4ISR A;  3HIF A;  3C8X A;  3POF A;  1W6P B;  1UF2 C;  4OLL A;  2LTN A;  3VV1 A;  1XSQ A;  2MEV 2;  5AC9 3;  3N7L A;  3CJI C;  3L9J T;  1IS6 A;  5EHD A;  5CFC A;  4CDX B;  5FYH A;  3T0D A;  4AI2 A;  1XNA A;  4ERO A;  3M8L A;  2JIG A;  3BVC A;  3WXP A;  1ENR A;  1RUJ 1;  4A3Z A;  1RUH 2;  3AP9 A;  2IXL A;  4RGG A;  4YZ4 A;  3RYP A;  4D6R A;  3MFC A;  5H9Q A;  5LRR A;  5IFP A;  1GP6 A;  2EIE A;  5C9A B;  1JOP A;  1POV 0;  4QPG C;  2CNA A;  4NR1 A;  3BIE A;  1OPM A;  5IVB A;  2E31 A;  3N9N A;  1FOD 3;  4FPG A;  1LKN A;  1W8H A;  5CKM A;  3RDI A;  4XJZ A;  5I0D A;  3KGL A;  1QHD A;  3ITQ A;  2RDQ A;  2XGX A;  1OOP A;  2JDK A;  2R0F A;  1LOF A;  4JGZ B;  4N7U A;  3K3N A;  3E97 A;  3M3C A;  2OZ6 A;  1OPO A;  3PUI A;  1AHS A;  5FY9 A;  3J7L A;  4BIS A;  2FHR A;  3R05 A;  3WDW A;  4XAB A;  2DU1 A;  4AVT A;  1PMJ X;  1UOG A;  1UIJ A;  5E89 A;  3JQX A;  1WCU A;  2D6M A;  2WAA A;  2F17 A;  1IGO A;  4Y4R A;  5FRE A;  3ZLI A;  5IAV A;  3ZIW A;  3K75 B;  4URT A;  3RYR A;  1LEM A;  1JZ2 A;  5LK7 B;  1O3T A;  2D93 A;  3A7Q A;  3E5U A;  3V0A A;  4JV4 A;  5DUW A;  4YVS B;  2ARE A;  4EE2 A;  3KV5 A;  2V5Y A;  4Y22 A;  1UN1 A;  4Q0U A;  1VBD 2;  1S0E A;  4GD4 A;  4CCL A;  4GKX A;  4GMP 3;  1W8W A;  2Q8D A;  3ZM8 A;  1GNZ A;  4HKL A;  4E2G A;  4ES8 A;  2BUK A;  1WLC A;  3OY8 B;  4S2G A;  1O5L A;  3PUQ A;  1UAI A;  1NCR A;  3UKN A;  5AC9 1;  5L9V A;  2VE1 A;  4I01 A;  4UOJ A;  5KHJ A;  1XSR A;  5DMY A;  1DG6 A;  2O8Q A;  3MLL A;  1NZI A;  3F95 A;  2HYK A;  5K7P A;  1NUK A;  3BCW A;  1RUG 1;  1PO2 3;  3EMR A;  2GNB A;  2JEC A;  1DP0 A;  2KD7 A;  1NY7 2;  2XG3 A;  1R08 2;  1MZ6 A;  3WNX A;  2PHF A;  3UT0 A;  3AP7 A;  2YDE A;  4ZON A;  1R09 1;  3N9M A;  3RZM A;  4LOS A;  3HQU A;  3HQR A;  2IVJ A;  4Q4V 2;  4YW6 A;  3UES A;  2H6C A;  4DOU A;  1UXX X;  4NE9 A;  5FY8 A;  1I9R A;  2AGS A;  2WO7 A;  4IEW A;  4XBL A;  4YZ3 A;  1GMM A;  2MEV 3;  2OII A;  4XTM A;  2B42 B;  2Z42 A;  4I3G A;  3WDU A;  2ZGO A;  1Y9G A;  1NYW A;  3IN9 A;  5A3N A;  2Z5W A;  4Y1Z A;  1BEV 2;  1WBF A;  4DRR A;  1SLA A;  2WFP A;  1SZB A;  1H6Y A;  3M4F A;  2L9L A;  4YVW C;  4NPM A;  1JW6 A;  3VKM A;  1TEI A;  1W05 A;  1RUH 3;  2IVI B;  2WUH A;  4F3J A;  2R49 A;  4LBQ D;  4H14 A;  5CIR A;  5F2S A;  4WZC A;  3LWC A;  1VP6 A;  3X29 B;  1XBF A;  2Y6K A;  4LIU A;  4XUR A;  5IVF A;  4M3C F;  4FO9 A;  4P14 A;  1SAC A;  2FDH A;  1AR6 2;  2IXI A;  3W21 A;  2OQ7 A;  4GXL A;  3N7J A;  1NLR A;  4FPJ A;  4TSV A;  3VBF C;  3ZN4 A;  3ZIX A;  5C5U A;  3LEG A;  1A3K A;  1R1A 2;  5KBF A;  2C5D A;  5FLJ A;  3VBO A;  2VCM A;  4OYU A;  4AFD A;  4ZXK A;  2DUP A;  2YU2 A;  4KBB A;  5F8P A;  1QOO A;  3SCF A;  3NKT A;  2SBA A;  4Y5T A;  2X09 A;  3HMY A;  3Q8E A;  1CD3 G;  4G3Y C;  1GWM A;  3PLQ A;  2WII B;  3CKH A;  4HOO A;  4PDW B;  2Y6L A;  3QBQ A;  5AVA A;  5H9P A;  3VBU B;  3ZX7 A;  1PO2 1;  2J1E A;  2X10 A;  1GSL A;  1SPP A;  2BYV E;  4CEY B;  5HBA A;  1YQ2 A;  1OXC A;  2NLR A;  4JKL A;  1W03 A;  4XUQ A;  4MXW B;  5DPN A;  4RA0 A;  3J26 N;  4HK9 A;  4LBQ B;  1HQL A;  3VHP A;  4LKE A;  4XMI A;  1V6K A;  3RZZ A;  2W0X A;  1QEX A;  3GZE A;  1XJA A;  5FMO L;  1ZRD A;  4YZ5 A;  1EY2 A;  1VBD 3;  2V09 A;  1VBE 2;  1VB4 A;  2Y64 A;  2D98 A;  2RMU 2;  1PX4 A;  2P6H A;  4LBL A;  2XHN A;  4NID A;  1HJG A;  1REF A;  4CUC A;  4Q27 A;  4Q4Y 1;  3PVO A;  1ALY A;  3WW1 A;  3D6E A;  1WMF A;  4FQ4 A;  3POI A;  4N53 C;  1QDO A;  5JOW A;  5KC6 A;  2BJS A;  1YUD A;  5C8C A;  1A34 A;  2F4L A;  4C1X A;  1RUH 1;  2BVV A;  5FIX A;  4PQ9 A;  5FYC A;  4EQV A;  1R08 3;  2VAU A;  3SIS A;  4LJH A;  1VAL A;  4XUN A;  4Y1V A;  4BDV B;  1CR7 A;  1ACC A;  2D44 A;  1FMD 2;  3H7Y A;  4A44 A;  3UGG A;  4QDR A;  2DTW A;  2R6Q A;  1N3Q A;  3ACG A;  3AZX A;  4Q4V 3;  4R9B A;  3U4S A;  4PBO A;  5C3P A;  1S0I A;  2WYS A;  5FR3 A;  1KEX A;  5A3M A;  4IV1 C;  4A4A A;  5HPO A;  2YY1 A;  1H2M A;  2ES3 A;  2RDS A;  1YI9 A;  3DPR C;  4XZU G;  2AEN A;  1W8F A;  3I59 A;  5HCB A;  3ZO0 B;  4KWU A;  4Q5O A;  5FRA A;  2DCZ A;  1H2L A;  2IXK A;  1BEV 3;  1X9P A;  2BWC A;  3BTZ A;  3LSE A;  1GWK A;  1D4M 2;  1FAY A;  2PLV 2;  4XHX A;  1UNB A;  1NOV A;  3VZL A;  1OFS A;  3AFG A;  1TE1 B;  3OGS A;  1FI2 A;  1MAC A;  1FNZ A;  1X8M A;  2J1V A;  2VW1 A;  1C1F A;  2QQL A;  3AKT A;  3PUA A;  1UKR A;  2FQP A;  4FPL A;  4YM3 A;  1AR6 3;  5LWB A;  1QIQ A;  3TOJ A;  3ST7 A;  1F5J A;  5C4W C;  3NST A;  2BOI A;  1W39 A;  2ORZ A;  4CEW A;  3SQO A;  1SFP A;  1R1A 3;  4W8J A;  1MS1 A;  1W8N A;  1KRI A;  4NHM A;  4NVP A;  1KXG A;  2E26 A;  1EUU A;  4JDN A;  3SKV A;  5F39 A;  5DG2 A;  2VMI A;  2VZU A;  5ABJ B;  2VTX A;  4OHX A;  1ND2 A;  3KMH A;  3D0J A;  3VBH A;  3NVC A;  3AYA A;  1VBA 2;  2W87 A;  1PMH X;  1NY7 1;  4ZU4 A;  1UCX A;  1BQP A;  3ZN6 B;  3KLS A;  4A7Y A;  3I8T A;  3FLP A;  4MGY E;  2UYB A;  4AAP A;  4HVQ A;  4Q4V 1;  2C9K A;  4K21 A;  4HL0 A;  4CU6 A;  2RMU 3;  3ZR6 A;  1UZ0 A;  4BME A;  2XXZ A;  1CAW A;  1MZE A;  2ZZQ A;  1W2A X;  4QPI B;  1URX A;  4LHN A;  4NHK A;  4ITC A;  3OD4 A;  4JGY B;  4PIX A;  1W6N B;  4AF9 A;  3O0V A;  4IEP A;  1OLR A;  2RR1 2;  3L2Y A;  2A3X A;  5A32 B;  3V0B A;  3RQ0 A;  1BEV 1;  2R32 A;  4BIO A;  3OF1 A;  1O4Z A;  3KV9 A;  1PVX A;  1MZF A;  3C7O A;  1EYB A;  1OQ1 A;  1W6O A;  5FXV A;  4KBZ A;  1YC6 1;  2ZGK A;  4FBF A;  5LBE A;  3A22 A;  3AL6 A;  5LZ6 A;  4HKW A;  5H9S A;  3FWE A;  2W1U A;  1FMD 3;  4QX8 A;  1AR6 1;  2IFW A;  2WYF A;  1YQ6 A;  4RR3 B;  3ZFG B;  3VZM A;  3ZDS A;  2W3J A;  3HQX A;  5JOZ A;  1QU0 A;  4I30 A;  1R1A 1;  3CLP A;  1ENX A;  4EN9 B;  4YPJ A;  2A6W A;  3O1M A;  4DB5 A;  1RJ7 A;  5DG1 A;  4UFI A;  4Y4Y A;  3H8U A;  2EIB A;  2JXA A;  1ZRE A;  2QKD A;  2AAC A;  1ULD A;  1YHF A;  2Y34 A;  4XFA A;  1LEC A;  3UKT A;  1GOG A;  3HT2 A;  1GKB A;  3FLR A;  2XJT A;  3NJV A;  1D4M 3;  1H8T A;  1SMV A;  1W8T A;  4XCB A;  1X36 A;  4IES A;  5LAT A;  2PLV 3;  3U11 A;  3WW4 A;  3USU B;  2AUY A;  4WM8 A;  1ND3 A;  4X6Q B;  3LIG A;  3WF2 A;  3VL9 A;  1PK6 B;  2X29 A;  2ZX3 A;  1VBE 1;  2DVD A;  2KR2 A;  4YGB A;  2BW8 A;  5JMC A;  1W2U A;  5FK8 A;  1G7Y A;  4FOQ A;  1AJK A;  3AXD A;  5D8A C;  3AYE A;  1DGW A;  2VH9 A;  4LLO A;  5L7O C;  4QX5 A;  5EP9 A;  1YRZ A;  1U5Z A;  1WZX A;  4GA9 A;  4QB1 A;  3MW2 A;  1SCS A;  2BEO A;  2VZP A;  3CO2 A;  4YLZ A;  2AC1 A;  5A3L A;  1GZW B;  1PGS A;  3P3N A;  5AFB A;  5JOY A;  4JKM A;  4FTE A;  4Y33 A;  4DXT A;  2GN3 A;  2BV4 A;  3HT1 A;  4RQP B;  3PHM A;  5JZG B;  1VBA 3;  3SHR A;  4Y20 A;  2HYX A;  5BV6 A;  5K4L A;  2E63 A;  2ARA A;  2JG8 A;  2BNM A;  1Z7S 2;  1BJQ A;  1VBC 2;  5CFC C;  2ZEZ A;  1ZRC A;  4FOW A;  3HVD A;  2BBV A;  3B69 A;  2QZ3 A;  2VC9 A;  3RI9 A;  3B01 A;  3FHA A;  3VN4 A;  2HWB 2;  1VBB 2;  3TB0 A;  3ZKU A;  1KDK A;  4CYD A;  2A71 A;  5FYT A;  2JX9 A;  4YM1 A;  4DRV A;  1K42 A;  3FJS A;  1E57 A;  1RIT A;  1CZV A;  2DVF A;  1Q8O A;  1NA1 A;  3WG1 A;  4YG0 A;  3POE A;  1ULG A;  3LOI A;  5M0T A;  1AX2 A;  5F2W A;  5T5P A;  2RR1 3;  4PI2 A;  4IW3 A;  3UYJ A;  1RIN A;  1VRH 2;  3BIW E;  4CZS A;  3I49 A;  1Q43 A;  1S2K A;  3KS7 A;  4W6Y A;  4HLT A;  3PVB B;  2XOM A;  4XUT A;  1OOP C;  4MVT A;  1D4M 1;  1LHO A;  1LOF C;  2AR6 A;  2ZTN A;  3B7M A;  3D3A A;  4LBN A;  5SV8 A;  5BNN A;  2W91 A;  4A3X A;  2O0O A;  2YZ4 A;  1COV 2;  1HB3 A;  1NX9 A;  1X82 A;  2G9Z A;  5L73 A;  3OUJ A;  3WW3 A;  5FBJ A;  4LO5 B;  5LK5 A;  2EXI A;  3QLQ A;  5IAX A;  5A3T A;  4MV2 A;  5KC5 A;  2D3R A;  5JSO A;  2VM9 A;  1SBD A;  1Y9M A;  3ATG A;  1C5I A;  4JZR A;  2WWS A;  4L2N A;  3NO8 A;  1N1S A;  4AXO A;  2XLF A;  4WZF A;  4BWO A;  5A70 A;  3RGB A;  3ES4 A;  3SCG A;  3M3I A;  4WVZ A;  3OEB A;  1PO1 1;  4AGR A;  5FOJ B;  2XVG A;  3IDC B;  4BZ4 A;  1TMF 2;  3CBN A;  4L97 A;  3VBR A;  1CN1 A;  2EA7 A;  4LK6 A;  3K77 A;  1UO9 A;  3U4X A;  5LY2 A;  3O1R A;  3KCY A;  4D69 A;  3B00 A;  1AVB A;  3K4A A;  1S1A A;  2XJU A;  1NCR C;  2YC0 A;  1UOF A;  3OJB A;  1O3S A;  4BB3 A;  3ILR A;  4X6R B;  1JZ7 A;  3ZVX A;  4FFH A;  2RDN A;  4IGO A;  4N43 A;  3M70 A;  1WUV A;  2G9G A;  1DLL A;  2XJP A;  2BDR A;  2AEZ A;  2OXB A;  4I0B A;  1F35 A;  5DDJ 2;  4FPF A;  2FDJ A;  2HEV F;  3HN3 A;  4AHZ A;  1W8U A;  1IG3 A;  2E33 A;  2W2I A;  4PCR A;  4ASM B;  5FXZ A;  1HXS 2;  3G6J B;  2XLA A;  4LO8 A;  2G4I A;  3WUC A;  4IV3 B;  1PVC 1;  1ODN A;  1UMI A;  1XYO A;  2E7T A;  1NZC A;  5TSW A;  3IPV B;  3AYD A;  1N1T A;  1UU4 A;  2W5F A;  1C57 A;  5EYX A;  5AVP A;  1CGP A;  4AI1 A;  3DKQ A;  4AL9 A;  2R30 A;  2B5H A;  3WQB A;  4OMD A;  2WSU A;  2WS9 1;  3Q9O A;  2ZGQ A;  4UBH A;  1AL2 2;  5EJ1 B;  1Z7S 3;  4NAM A;  1VBC 3;  5CEH A;  3CU7 A;  2XBO 2;  4UFH A;  3AP5 A;  5GJ6 A;  1OH3 A;  4XF3 A;  2ZHK A;  1YJK A;  2E9Q A;  1C3H A;  2HWB 3;  1VBB 3;  4UW6 A;  2DVB A;  2ZCW A;  3FFZ A;  3JD7 1;  1GIC A;  2A6Y A;  4AVA A;  5C3R A;  1UY3 A;  5GZG A;  4GKY A;  4COU A;  2W52 A;  3KSC A;  3IWZ A;  5FUP A;  1GZ9 A;  5A7W A;  1JI6 A;  4BLI A;  4NHL A;  2EAA A;  4L8Q A;  4FPH A;  4AQT A;  4LIV A;  5FZD A;  1PIV 1;  1VRH 3;  3MIH A;  4OCT A;  4BK5 A;  1BBT 2;  3AM2 A;  5IFT A;  5EYY A;  4AI8 A;  3KVA A;  3LZZ A;  2Y26 A;  4QU2 A;  4HG6 B;  3NV3 A;  3VBO C;  2DCY A;  2BBA A;  4UF0 A;  1COV 3;  4HT1 T;  1S0G A;  3ZXG A;  3ALQ A;  4F7Z A;  2D6K A;  3ON7 A;  4A6O A;  3E6D A;  4R9A A;  3BTX A;  1HJF A;  2ZHM A;  3P5B A;  1NKG A;  3WQ1 A;  3UET A;  4B7K A;  4Q4X 2;  2JE7 A;  4IE5 A;  4EN7 B;  1AJO A;  3ZFF B;  3BYW A;  2K9Z A;  5A33 B;  1UYX A;  4M3C B;  3AMH A;  2C4X A;  2RG4 A;  4BIF A;  5I91 A;  1Z78 A;  1ZA4 A;  4PQQ A;  2JKX A;  1QJE A;  1QH6 A;  1SG3 A;  1WBL A;  4QXC A;  1TMF 3;  2K46 A;  1G9F A;  1VAK A;  3NNF A;  4IEX A;  4S2F A;  4CUA A;  1LES A;  3I3D A;  2CWM A;  2RV9 A;  4MGK E;  1O3R A;  3KHB A;  2DCJ A;  3WNL A;  3C3V A;  3I2H A;  2CV6 A;  1VBC 1;  5FP8 A;  1F4H A;  3AMN A;  1H8V A;  5E16 A;  2VOV A;  4O9E A;  4HZF A;  4P00 B;  1QJX 2;  1WA4 A;  5A6X A;  2EF6 A;  5BNQ A;  5C8C C;  2HWB 1;  4LPL A;  1XNB A;  4QHZ A;  5DDJ 3;  2OPK A;  3LB9 A;  4QX7 A;  2Z69 A;  5KXB A;  2H0V A;  1AL0 G;  1OQD A;  1H4H A;  2J1U A;  2VBD A;  1HXS 3;  1YFW A;  4CDW A;  1BYH A;  4M3C E;  4RFR B;  1QOS A;  4D6S A;  3JU9 A;  5JXG A;  4R52 A;  5C5T A;  3RPQ A;  3DYP A;  4DNY A;  4AED A;  3KT1 A;  2WJS A;  3DYM A;  4Y3O A;  5J98 B;  4NRP A;  1D7P M;  5K0U B;  4JKK A;  3WDY A;  2VZ1 A;  3AKQ A;  3N3H A;  4PBP A;  4X8N A;  2WZR 2;  1YLL A;  1HLC A;  1MZ5 A;  3O1S A;  1AL2 3;  5IW0 A;  2GAU A;  4WVM B;  3NAP B;  4GH4 A;  4Y1Y A;  5FPZ A;  5BUV A;  2XBO 3;  1DGR A;  2GN7 A;  5JIU A;  2Y6G A;  1EPZ A;  1Y43 B;  1GP5 A;  5LCW L;  4LE3 A;  3U1X A;  1W8O A;  5LBB A;  1SEF A;  1CAV B;  1HIX A;  2BGP A;  1W2O A;  2X5I A;  4B4P A;  1O3Q A;  1FAT A;  3OCP A;  3FE5 A;  3SEP A;  3LQC A;  4V2V A;  4RS5 A;  3AB0 A;  3OG2 A;  5FAX A;  1RXF A;  2Q4S A;  3AL5 A;  1BBT 3;  4CP2 A;  1WLD A;  2E51 A;  4H55 A;  1TMF 1;  4L92 A;  2JB4 A;  3VD9 A;  3NQH A;  3KGZ A;  4CP9 A;  4CEW C;  3GHM A;  2AEY A;  1WLW A;  1GQG A;  2HWE 2;  4IEV A;  3V65 A;  2FDF A;  1OD3 A;  2C0Z A;  4MX3 A;  4RFT 0;  5C70 A;  4UFJ A;  4E2S A;  2SLI A;  4GQ7 A;  3INA A;  4OHW A;  4DUX A;  4D7S A;  1IZ3 A;  4DPN A;  1AYM 2;  1ND2 C;  3VBH C;  5KXD A;  4NIH A;  2ZML A;  4AYU A;  1YNA A;  4Q4X 3;  4Q1P A;  3VZO A;  3FBM A;  2XQX A;  1WLT A;  2QDR A;  4YYO A;  1MS9 A;  2OUJ A;  1BVV A;  2VMG A;  4XVH A;  1GP4 A;  5GAL A;  1GZC A;  2VW0 A;  1W6P A;  5ANQ A;  4PLM A;  2E7Q A;  2BRT A;  1Q8S A;  4AI9 A;  2WIN B;  4NMI A;  2W94 A;  4TWT A;  2Y6H A;  4CDX A;  4KWK A;  2ETE A;  1AUY A;  2IUW A;  5JVV A;  4I0W B;  4P02 B;  2P4E A;  4CUG A;  5F3C A;  1AL2 1;  2XPJ A;  3OSD A;  2CL2 A;  2EXJ A;  2FCT A;  2WRA A;  1DQ4 A;  1T6G C;  1QJX 3;  3GNE A;  4P9I A;  3SH5 A;  2JDU A;  3HWJ A;  4CDQ A;  3HOB A;  5T52 A;  5FPL A;  5C9A A;  4YGE A;  5CAD A;  4P9J A;  4PF1 A;  2VVF A;  4FXG B;  3H50 A;  1V6O A;  5J7M A;  2J1A A;  4QGM A;  2XL7 A;  1HN1 A;  3ASI A;  3J7H A;  4QGL A;  4FT8 A;  3O1T A;  1TME 2;  4K8F A;  4M4R A;  2QZ2 A;  3S30 A;  4Z2W A;  3WUD A;  4W6W A;  3UGH A;  2GAL A;  5IYY A;  4DMI A;  3WT3 A;  2Q8O A;  1OUS A;  1AXZ A;  1BBT 1;  4OHZ A;  4OUL A;  4XHB A;  5J96 B;  1CIW A;  3EHK A;  1IKQ A;  4R4Z A;  3PL0 A;  4ZU5 A;  2WT1 A;  2WZR 3;  4DUW A;  2HJI A;  1RMU 2;  2LM3 A;  5F3I A;  4C0H A;  4CXY A;  3IZO A;  4M0N A;  1WD3 A;  2ZAA A;  2VUL A;  2ZA9 A;  4MHU A;  1V70 A;  3IKW A;  4GAZ A;  1RTV A;  4E4H A;  5C4W B;  3TEW A;  1RGS A;  1XB9 A;  1JZ5 A;  4G4F A;  4AHX A;  1AR9 2;  3H8O A;  2OVU A;  1TG7 A;  2WLQ A;  1H8T C;  5F7U A;  1C8M 2;  4NRO A;  4Q4X 1;  2CHH A;  4WM8 C;  2VUC A;  1O59 A;  2VBP A;  1ND3 C;  5FXX A;  4XAE A;  1G9C A;  1LU2 A;  2P3K A;  4NRM A;  3U78 A;  5J1X A;  2LS6 A;  1JYV A;  4FPE A;  3VDC A;  2E32 A;  1RHI 1;  3OY8 A;  4WM7 B;  3VGI A;  2J7M A;  2B45 X;  2ERF A;  4QB6 A;  4AQ6 A;  2GZW A;  3FUO A;  4E4S A;  1IOA A;  4IER A;  1WD4 A;  5DUU A;  4D94 A;  5ACA 2;  5FXW A;  1QJZ A;  5DZE A;  2ZJC A;  2NM1 A;  2HWE 3;  2VUD A;  5FO8 B;  4GJZ A;  2E53 A;  2ZKN A;  5SV5 A;  3WP3 A;  5K9Y A;  1EPW A;  2ARX A;  2PQQ A;  5A7N A;  2UY9 A;  1NCQ A;  1H0B A;  4YSF A;  1ZA7 A;  4CXX A;  1Y4W A;  1AYM 3;  2GC0 A;  4AG4 A;  4KH9 A;  1UZZ A;  4CE8 A;  3O1V A;  1YFU A;  1P8J A;  4JRA A;  2JG8 C;  1H1I A;  1A8M A;  1WA6 X;  3RZG A;  1HRV 3;  5E88 A;  5FLH A;  3H3Z A;  4HPK B;  1ASJ 2;  2HWC 2;  4Y5Z 0;  3PUH A;  5F32 A;  2JKB A;  2EVX A;  2PAE A;  1H4G A;  3WHU A;  5BPX A;  4IEQ A;  2PHX A;  1NA1 C;  2RS1 1;  3KV4 A;  2P1B A;  1UOJ A;  4QU1 A;  2H0B A;  2KM2 A;  3PJY A;  3U0Z A;  2W92 A;  4BQ3 A;  4JQR A;  5T5J A;  4CCO A;  3DV8 A;  3KB5 A;  3H7J A;  1H1M A;  5CYY A;  5LEJ A;  1NLS A;  1W8Z A;  2ZEX A;  5BNN C;  4KG8 A;  4EN6 B;  1DGR N;  1W6Q B;  3K2O A;  1TME 3;  3OBR A;  1IQD C;  4UFM A;  2QJV A;  1LGC A;  3WNO A;  4XW3 A;  1CIY A;  3PU8 A;  2PA7 A;  4FTB A;  3GZA A;  4COV A;  2ZS6 B;  2QUO A;  4XOG A;  4KL1 A;  4X8P A;  2BNO A;  5DAV A;  3CEW A;  2VNV A;  3ETQ A;  4QKD A;  1UKG A;  4OQ8 A;  2R07 2;  2VTX J;  1RMU 3;  2HWE 1;  5HI0 A;  4BQY A;  5IVE A;  3VBU A;  4LKS A;  2YGL A;  4PDW A;  4PF5 A;  5D2A A;  5FP7 A;  4CEY A;  2O8O A;  2P37 A;  3S5A A;  3IDE A;  1OF4 A;  4AI3 A;  4J1X A;  3RRD A;  1NT0 A;  3BOP A;  2MNG A;  4MXW A;  4GB3 2;  3ZXL A;  1AR9 3;  4XET A;  1UQX A;  4IDZ A;  1AYM 1;  5ANN A;  5FZC A;  4LBQ A;  5GLU A;  3VBR C;  2KXL A;  1J84 A;  1EAH 2;  2YBP A;  1C8M 3;  1GNH A;  4KG0 A;  4LO4 B;  3LE0 A;  4Q1R A;  1W28 A;  1JHJ A;  3IMN A;  4I3P A;  2JG9 B;  3I2K A;  3M3Q A;  4MHR A;  3CHX A;  3RS6 A;  1S0C A;  5FOB B;  5F3E A;  1QY4 A;  1LOC A;  1FOD 1;  4YG6 A;  3WW2 A;  4N43 C;  4GAL A;  1EV1 2;  4KU8 A;  5GKA C;  5FPB A;  1DQ1 A;  3H8R A;  3N4M A;  4G9S B;  4XXA A;  4LTA A;  5ACA 3;  2DBI A;  1W3V A;  4N9I A;  2XUE A;  4H7M A;  3BOD A;  4LHS A;  2HWD 2;  2ZX4 A;  3KCX A;  4DS0 A;  5J36 A;  3ES1 A;  3MF9 A;  1H2N A;  4O9G A;  1LGB A;  2D5F A;  3HN1 A;  1ENS A;  4MH0 E;  5L9R A;  1XNC A;  4ZS3 A;  5BYN A;  2WT2 A;  4HN0 A;  2FMD A;  3CIH A;  4RGK A;  1H2K A;  1OLM E;  3UNP A;  2ADD A;  4D7Y A;  2XR4 A;  4O7X A;  1UD1 A;  3C7E A;  4CU7 A;  2GH2 A;  3POS A;  2YB7 A;  3GJA A;  1ASJ 3;  2HWC 3;  1HQN A;  3ACH A;  3LPG A;  3D0S A;  2RM2 2;  3PME A;  1JYW A;  2PAK A;  5FYZ A;  2WKK A;  4GMP 1;  5GZF A;  2WFF 2;  4GWM A;  4ZS2 A;  3VBS B;  3VD7 A;  4TZD A;  3C7F A;  2WA3 A;  1PZ7 A;  1JZ8 A;  4AVS A;  1DQ5 A;  1W90 A;  4OI2 A;  3AP4 A;  1IS3 A;  2DUQ A;  4JTO A;  4J6G A;  1RUC 2;  2J1S A;  4RL7 A;  3SMH A;  2VL4 A;  1KJL A;  1V6L A;  3PUR A;  4YGD A;  2GME A;  5FY1 A;  1PHM A;  1LOE A;  3ZPY A;  3RJR A;  2A7A A;  3VDD B;  5LEK A;  1RUO A;  2VCA A;  1AR9 1;  4I0A A;  3WCR A;  1QXP A;  2A5Z A;  3WDX A;  5LA1 A;  1YFY A;  1JYX A;  4KWL A;  3FN9 A;  4H2A A;  4LKD A;  4MAD A;  2QQI A;  1SLL A;  1ZZ9 A;  1VIW B;  3GGL A;  4AGG A;  1K5M B;  5JSR A;  1LOG A;  1W99 A;  3LEI A;  3MDP A;  1W2N A;  2OUH A;  2ZX2 A;  3GBG A;  4OZX A;  3TWI A;  3WOG A;  4EYU A;  3KT4 A;  2MEV 1;  5BNP B;  2R07 3;  5ABJ A;  4J25 A;  2C26 A;  2EAK A;  1KIT A;  3EXU A;  4XQW A;  3VUO A;  3CJX A;  4HAN A;  4OI0 A;  2WQZ C;  2QQV A;  1WMX A;  1W9T A;  3T2O A;  4UFK A;  2EXH A;  4GB3 3;  3MLK A;  5FZ8 A;  3IBM A;  2X8K A;  3POB A;  3ZN6 A;  4COY A;  2CDP A;  2E6V A;  2VMH A;  2AZ5 A;  1EAH 3;  4XJW A;  3CNA A;  4FPO B;  1OA3 A;  2OA2 A;  4W6X A;  4E27 A;  3FHI B;  4M01 A;  4XJ8 A;  3N9O A;  3VKF C;  1AR7 2;  2IXH A;  4QXB A;  1ASJ 1;  4QPI A;  1CX4 A;  1KQR A;  2NYY A;  4QX0 A;  1DFQ A;  3VZK A;  1EV1 3;  2ZMN A;  3III A;  3ZXD A;  2XVK A;  4JGY A;  1W6N A;  3HNM A;  2UWC A;  2W1S A;  3QCW A;  2WNU B;  1O8P A;  2HWD 3;  5JXI A;  4NWV A;  4CDW C;  3WP4 A;  1LTE A;  5T55 A;  3O1O A;  3ZSL A;  1OH4 A;  1FT9 A;  3CF6 E;  1RXG A;  4MO3 M;  5LA0 A;  3C2U A;  2P34 A;  2VMD A;  4W65 A;  5IT6 A;  1B35 B;  2ID4 A;  3B94 A;  4PT6 A;  4AED C;  2V73 A;  4IGQ A;  1HB2 A;  4RGA A;  1JYN A;  1PX3 A;  3WP6 A;  3LDK A;  5JIA A;  4C8D A;  3BKZ A;  4OHV A;  4NOT A;  1ZRI A;  1LHW A;  3ZSJ A;  4N8M A;  4GH4 C;  2HH9 A;  4L0P A;  4RR3 A;  1VBD 1;  1ZBE 2;  4YWA A;  3UK9 A;  2RM2 3;  2WZP P;  5FY5 A;  5DAQ A;  2LRO A;  2WFF 3;  2VZR A;  5ISL A;  2FCU A;  5J37 A;  4B8E A;  2A3W A;  2Y0I A;  2X5I C;  2R07 1;  4AEK A;  1RUC 3;  3PTY A;  4QMA A;  5A3U A;  1LHU A;  1BCX A;  2HEW F;  5T5L A;  2QQO A;  3I2O A;  3ENR A;  3MZH A;  3TYJ A;  4A6S A;  4UYB A;  1RUD 2;  4RS5 C;  1X33 A;  4CCJ A;  1GWL A;  3USU A;  3T0A A;  2PEL A;  2WQ8 A;  3KZ4 C;  1JOJ A;  3ZN5 A;  1R08 1;  1V6N A;  2R0H A;  2YFU A;  1PK6 A;  1SDW A;  3CDZ B;  5I0S A;  5IK8 A;  5CFD B;  1GZT A;  4YNI A;  3HBK A;  3LA3 A;  3R4U A;  1ZBA 2;  1EV1 1;  4LE4 A;  3NV1 A;  2DTY A;  3J8F 2;  1QWR A;  1QJU 2;  5IK5 A;  5DQ0 A;  5FYU A;  4LKF A;  4C91 A;  4FTS A;  2XQR A;  5CA6 A;  1QMJ A;  2HWD 1;  1NQJ A;  1JH5 A;  3U37 A;  2QQU A;  3VD5 A;  3LSD A;  1DYK A;  4I09 A;  4YAR A;  2XDV A;  3THT A;  3TEZ A;  1K3I A;  3NKG A;  4R4X A;  4AEJ A;  4TLG A;  5JXH A;  1RJ8 A;  2D6N A;  4CDX C;  1MEC 2;  1L7Q A;  4K3U A;  5HCH A;  3RNS A;  1ZM1 A;  3D8C A;  5CG9 A;  2CY6 A;  3K51 A;  3W58 A;  1AR7 3;  3MIF A;  4BH9 A;  4K8R B;  4C0B A;  4Q8K A;  1VR3 A;  4D6Q A;  2RM2 1;  1EP0 A;  2Q30 A;  4CDQ C;  1JU3 A;  4AQS A;  2WFF 1;  3LPF A;  5C9A C;  1D2S A;  4XF0 A;  4KWJ A;  3FX3 A;  5CIS A;  1GOH A;  3B02 A;  3UL2 A;  1JXN A;  4OVE A;  3K3O A;  4YM2 A;  2LAL A;  1PNF A;  3W20 A;  4OUM A;  3LKJ A;  4CCD A;  4FAG A;  2FDK A;  4OUS A;  3KF3 A;  3AK0 A;  1JS9 A;  3KWV A;  4LR4 A;  4TYS A;  3E5X A;  1VMH A;  4D3W A;  4EWE A;  2Q1F A;  1C1L A;  3O7O A;  1F8V A;  3ACF A;  3TEX A;  3H3U A;  1XNT A;  5LA9 A;  3KT7 A;  4OQ9 A;  4XFB A;  1XU1 A;  2BGC A;  1VE0 A;  3Q8F A;  1QGL A;  1IQA A;  4TN7 A;  3T30 A;  2VPV A;  4ZXE A;  1LOA A;  2F4P A;  1ZBE 3;  3MHZ A;  3FLT A;  4KI5 M;  3HNY M;  2QQJ A;  3D82 A;  2QDN A;  3AKR A;  2RMU 1;  1UU5 A;  3OGG A;  4DFS A;  4YM0 A;  2PHD A;  4E8D A;  3HAG A;  3SLI A;  1GUI A;  2UWA A;  2EAL A;  2VCB A;  2TBV A;  4NUB A;  1W9W A;  5JI9 A;  3T2P A;  1WGP A;  3SIT A;  4HBN A;  3I3M A;  2VZO A;  3MO4 A;  4AFA A;  1MPX A;  5LRS A;  1RUD 3;  2BVB A;  2PHT A;  1ND2 B;  3ZYR A;  5JUV A;  3VBH B;  3I54 A;  5FZK A;  1UY4 A;  1JTZ X;  1J1L A;  1Q8V A;  3OYW A;  4Y1X A;  4R8H A;  2PTM A;  5J48 A;  3DEM A;  2WT0 A;  5FZM A;  5C6C A;  1LJ7 A;  2XWJ B;  5LAS A;  3JQW A;  1ZZB A;  3FMG A;  2R04 2;  3JBG 2;  4UW3 A;  3EQE A;  1FMD 1;  3OPW A;  3MIC A;  1DYO A;  1ZBA 3;  1NCQ C;  3DF0 A;  5C3O A;  3THC A;  1PZ8 A;  2TNF A;  5JSP A;  2VZ3 A;  2RJL A;  3JB4 C;  3ZFE B;  5LB6 A;  1WW5 A;  3J8F 3;  2VVE A;  1QJU 3;  4IV3 A;  1N1V A;  1ZZ6 A;  1RC6 A;  4CDU B;  2VGD A;  2Y60 A;  2RS5 2;  3POG A;  2VZS A;  5IVJ A;  5FY0 A;  4WVV A;  2VY0 A;  3IPV A;  4AWD A;  3ROU A;  5L9B A;  2RJK A;  1CES A;  1DQ6 A;  1N47 A;  2GMP A;  4S2D A;  3USS A;  1YCI A;  1MS5 A;  2PLV 1;  3HNB M;  1MEC 3;  3OUI A;  4IQP A;  4BQX A;  2IC1 A;  5IUQ A;  2VQT A;  3OGR A;  5FQ0 B;  4XAA A;  2VQU A;  2CYF A;  5IVY A;  2MHF A;  2A3Y A;  1HN0 A;  4Q4W 2;  3K48 A;  3M7A A;  4Q26 A;  1QH7 A;  2CGN A;  3T1L A;  4EWA A;  4XMA A;  2W1W A;  2WNV B;  3I2G A;  3JCI A;  1F15 A;  3PVE A;  2Y38 A;  3TN9 2;  4QAW A;  3DGT A;  3ILF A;  4QQH A;  1OT5 A;  1IPJ A;  4FOY A;  4HVR A;  3I2D A;  4BMB A;  5FMC A;  3DCQ A;  3J9S A;  4P9W A;  5DAW A;  1QDC A;  3KM5 A;  2XON A;  1RUF 2;  3FHQ A;  4QB2 A;  4OI4 A;  4KGG A;  5D21 A;  3ZYG A;  1O8S A;  2DUO A;  3WX5 A;  2XJQ A;  5C33 A;  3WF1 A;  4CXW A;  3BTY A;  2DUR A;  3IDB B;  1VBA 1;  3FC0 A;  4WM8 B;  1RVF 2;  5BNO B;  4MSV A;  4XUP A;  1MQT B;  2GMM A;  4P08 A;  3VBU C;  4PDW C;  2PHU A;  4QKF A;  2XUM A;  4CEY C;  1JYT A;  1Q5O A;  1TNF A;  4DY5 A;  3P3P A;  3P1I A;  1ZBA 1;  5GM0 A;  3ZFF A;  2Q0A A;  5DZG A;  1NXM A;  2JDM A;  5A33 A;  3T2Q A;  4AZZ A;  2WAB A;  3WF4 A;  5I0R A;  4CVU A;  3CJI B;  3MYX A;  1DQ2 A;  3J8F 1;  2JIC A;  1JZ3 A;  4IE7 A;  1X9T A;  2V72 A;  1REE A;  3KQR A;  2VG9 A;  3ZR5 A;  2RR1 1;  3WNK A;  1W0O A;  3W5M A;  2GNM A;  5FJH A;  2YG0 A;  3ZDV A;  2W9X A;  5FPU A;  1HV0 A;  3FZ3 A;  1V9U 2;  1PGL 2;  4IGP A;  2A6Z A;  1CVN A;  3E1F 1;  1MEC 1;  1LUL A;  1Q8Q A;  3MIE A;  4QPG B;  4D8M A;  2ZHN A;  2QQN A;  5JR7 B;  4NIG A;  5FZ6 A;  3OB8 A;  5FO9 B;  3MF6 A;  3JBG 3;  2QFE A;  2R04 3;  4M0H A;  1SHW B;  4OI1 A;  4AVB A;  3OD0 A;  3LFI A;  3MW4 A;  1FX5 A;  2FBE A;  4MG2 A;  3ACI A;  4Q0S A;  1TQ5 A;  4YFW A;  3TAY A;  5EV7 A;  4NPL A;  1W06 A;  5LBF A;  2B7Y A;  2RS5 3;  3ZYH A;  1WW6 A;  1ST8 A;  2DF7 A;  1WCS A;  4LK7 A;  4N7I A;  4XF1 A;  2ARC A;  3KCC A;  4CCC A;  1US2 A;  5K0U A;  5GLW A;  3WP5 A;  3B5L B;  5HCA A;  1LNS A;  4XBN A;  1I3H A;  3I2I A;  5FK7 A;  4WVM A;  2RJ2 A;  3NAP A;  5IWF A;  2VBB A;  5FZB A;  4CUB A;  3UKV A;  2JJ6 A;  1MS4 A;  1O4Y A;  2Y33 A;  3H3L A;  3JZV A;  4QKB A;  1F31 A;  3MUY 1;  4Q4W 3;  3VZN A;  1AYN 2;  5GZD A;  3DL3 A;  1CAV A;  3TN9 3;  4Z1V A;  1DCS A;  2VZV A;  4QM9 A;  1OD5 A;  2VJX A;  2YPJ A;  1CAU A;  4C90 A;  2VD7 A;  3EO6 A;  3BGA A;  5FJK A;  1YQ8 A;  1VLN A;  2XVL A;  5JXJ A;  3UGF A;  4ZHN A;  2CU5 A;  2I45 A;  1RUF 3;  1SDD B;  1U5X A;  1Z0H A;  4JAA A;  1AXK A;  4AFB A;  1KFU L;  5GLV A;  5KHG A;  1LRH A;  5JOX A;  2ZBJ A;  3MI8 A;  1RVF 3;  1RYY A;  1UPS A;  2ILM A;  4NIA A;  4MGZ E;  4AEM A;  5ABJ C;  1Z7S 1;  1SQ4 A;  3AZZ A;  2R06 2;  2DFC A;  3MFA A;  3JBG 1;  2R04 1;  3OGJ A;  1SFN A;  4P9Y A;  4BJ0 A;  1VBB 1;  1OA4 A;  4IE6 A;  3SH4 A;  4Y24 A;  2WNE A;  1J3P A;  2B46 X;  2F6B A;  2XJS A;  5KXC A;  2OYZ A;  1RUI 2;  2C24 A;  5H9R A;  2YU1 A;  2GP3 A;  1JYC A;  3OPZ A;  4PIZ A;  4YVW B;  2G1M A;  1VRH 1;  2VMF A;  2OQ6 A;  4QPI C;  3U14 A;  1X7N A;  3WD5 A;  3H1W A;  5JR2 A;  2VUJ A;  1V9U 3;  1OQE A;  2YUE A;  1DYP A;  2YGM A;  3DKW A;  4IE4 A;  4JGY C;  4CTE A;  1A78 A;  4YRD A;  3MV0 1;  4HSL A;  1COV 1;  4K7J A;  2B4K A;  3PIJ A;  4JQT A;  4QWN A;  5FZ4 A;  3WG2 A;  5CKQ A;  3WQ0 A;  1GQH A;  3I2F A;  1U0A A;  3VBF B;  3W5N A;  1GNY A;  4COZ A;  2XML A;  4XQ4 A;  1UYY A;  4P9L A;  5JPN B;  4F8A A;  1QJY 2;  2ET1 A;  3AP6 A;  3H1Y A;  4LA2 A;  5T50 A;  3TN9 1;  1X50 A;  1DGL A;  3NNM A;  3O14 A;  2A70 A;  3AVS A;  1QF3 A;  4LNV A;  4L11 A;  1CAX B;  5A7W B;  4BLJ A;  1ONA A;  5LY1 A;  1VB2 A;  1J83 A;  4EN8 B;  1IG0 A;  3ECQ A;  4RR3 C;  2NMO A;  4I2O A;  1PNG A;  1UPI A;  1W9S A;  3N7K A;  1DIW A;  1DDL A;  1XRU A;  3RSJ A;  4KNC A;  1UX6 A;  3ZXE A;  4I02 A;  4ARX A;  5BXX A;  1PM4 A;  3CZU A;  3ETP A;  1JHN A;  1ULP A;  2NQY A;  4FI9 A;  1AX1 A;  5CNA A;  4AFM A;  2HLE A;  3V56 A;  5IAT A;  4LBO A;  1XE7 A;  3QOP A;  1YYN A;  2IXC A;  2DCK A;  4UW4 A;  1AYN 3;  1XPW A;  1ZX5 A;  3O0W A;  4N9H A;  3IT8 A;  4S2H A;  4XQD A;  3N9Q A;  2RE9 A;  2IZW A;  2ZKL A;  3K4D A;  4NHY A;  5DDJ 1;  1CWP A;  3ZMN A;  2ZHL A;  4YFZ A;  2WWU A;  1LEN A;  4K40 A;  1MS3 A;  4NJ4 A;  3VL8 A;  4LOR A;  4N53 B;  1HRV 2;  1HXS 1;  1PK6 C;  4WM7 A;  5FMB A;  2CTV A;  1J3R A;  1US3 A;  2VQA A;  2X53 S;  3DEC A;  3NW4 A;  4BXF A;  4BK4 A;  1HW5 A;  4DY3 A;  1QQP 2;  1BLZ A;  1KDM A;  3I4I A;  5K8S A;  5DUX A;  2BNN A;  3PU3 A;  2UY8 A;  3URF A;  5CKN A;  1XE0 A;  5FKB A;  2CAV A;  1RUG 2;  2BTV C;  5HV4 A;  2W68 A;  2Y6F A;  4MGI E;  4MXV A;  2R06 3;  1VJ2 A;  2XBO 1;  3PDQ A;  4LOT A;  4KGQ A;  5FWE A;  4ATF A;  1PGW 2;  5DN2 A;  3ZMO A;  4PLN A;  2KA3 A;  3IB3 A;  4AHW A;  5J09 A;  4ASK A;  4IV1 B;  3PNA A;  1R09 2;  4E4D X;  5FYI A;  1OSG A;  3DPR B;  3NJX A;  2G9F A;  4CCE A;  5HCF A;  2V4A A;  4HPK A;  3AKS A;  2QQP A;  1DZT A;  2B9V A;  2Q1Z B;  1RUI 3;  1E5I A;  3PIG A;  5FYY A;  1W6M B;  5JAX A;  4IEZ A;  4LQR A;  1LOD A;  1VAM A;  4CU9 A;  4K1Y A;  4JGZ A;  3GCX A;  5EIY B;  3THD A;  1JU4 A;  3WNM A;  2NN8 A;  4A7K A;  3SXW A;  1LAJ A;  1OVP A;  2QQW A;  3RJ2 X;  1HB1 A;  2GC3 A;  2NP0 A;  2P17 A;  1F5F A;  1UZV A;  2ZMK A;  2HEY F;  2BQP A;  2WQ4 A;  3QD6 A;  1JYI A;  2XH6 A;  2HWF 2;  1D0G A;  1MVE A;  5A7O A;  3GCW A;  1AYN 1;  1OKQ A;  2CDO A;  3IM0 A;  3O0X A;  3R6S A;  3NV2 A;  4AOC A;  4AW7 A;  1NQD A;  4B3N A;  4CPB A;  1QJY 3;  1W6Q A;  2WAO A;  1GLH A;  2WC2 A;  4LO6 B;  5FZ1 A;  3WDV A;  4BPZ A;  2WR9 A;  5JWP A;  1HV1 A;  2X5I B;  4KMQ A;  4MET A;  4YVS A;  5IVC A;  5JMO A;  2A6X A;  3GM8 A;  3T3Y A;  3J4U H;  3WG3 A;  3LDB A;  1EUT A;  2JD9 A;  3MV1 1;  2VOT A;  4AGV A;  2D97 A;  4BYY A;  1O5U A;  1V00 A;  1GQP A;  2A6V A;  2DWR A;  2QQM A;  4RYD A;  1UZY A;  3RZL A;  1L7L A;  1ZRF A;  3NV4 A;  2Y6J A;  1FV3 A;  1CJP A;  4U36 A;  4BU2 A;  3TBD A;  5FPA A;  1G8W A;  2Q8E A;  1ENQ A;  2AYH A;  2DV9 A;  3KQ4 B;  1UX7 A;  4QHO A;  3A23 A;  4Y1U A;  3RZK A;  2NMN A;  5B4N A;  1F2N A;  3LF7 A;  3HR9 A;  1O7F A;  5FZF A;  3SC7 X;  1K5J A;  2R06 1;  3HJR A;  4XIL A;  4K20 A;  4V2W A;  1QJX 1;  1TVG A;  4JRL A;  1UXZ A;  2ZGS A;  4CPB D;  5I8Y A;  1CPN A;  5FUI A;  2JG9 A;  4OMC A;  3TNQ A;  3SKJ E;  2W39 A;  4OUE A;  1F4A A;  4AI0 A;  3S57 A;  3AC0 A;  4BOW A;  1RUI 1;  5JDB A;  5FZ3 A;  1ULE A;  4BA6 A;  1ZRR A;  3N35 A;  2QCS B;  4XXP A;  5C3Q A;  4JC1 A;  1XU2 A;  4Q4Y 2;  5F6L B;  4YGC A;  1A8D A;  5IHR A;  1QQP 3;  4URA A;  2PN5 A;  5B4X A;  2WZR 1;  4P5H A;  5FO7 B;  4IV3 C;  2P3Y A;  1RUG 3;  2RHP A;  1I6X A;  3MIB A;  3PTR B;  5KWR A;  4D7T A;  3MEP A;  4BQ4 A;  4CDQ B;  5FZA A;  2FMY A;  2ZGP A;  1QJY 1;  1SFY A;  5L19 A;  4RN5 A;  2DCT A;  5F5A A;  4COW A;  4IET A;  1R09 3;  3RVH A;  3ZSM A;  2UYA A;  3E6C C;  1OI6 A;  1WKY A;  4GMP 0;  1QJF A;  5A7Q A;  2YBK A;  4HSJ A;  1POV 3;  4XJU A;  3VBS A;  1DZQ A;  3DUI A;  4K6B A;  2C6S A;  5DAB A;  3S6P A;  2VO5 A;  1KGY A;  3HPN A;  4Z82 A;  1STM A;  4QQP A;  1JUI A;  4QX2 A;  1AZD A;  4QPY A;  3B9C A;  1E5R A;  1NG0 A;  1ZZ8 A;  5JI7 A;  3VDD A;  2HWF 3;  3Q8C A;  3I2J A;  1C4R A;  3WHT A;  1K45 A;  2ZAB A;  4JDM A;  3H42 B;  4A41 A;  5FZO B;  3W59 A;  5D8A B;  4A2U A;  4E8C A;  3SCH A;  2VOK A;  3OPT A;  1YWK A;  3M3E A;  5L7O B;  5EFU A;  3JXS A;  4EV0 A;  2OX0 A;  2Q8C A;  3EBR A;  2WO3 A;  4DEQ A;  1JMU B;  1HRV 1;  1K5M A;  1DBN A;  3T1M A;  1CQ9 A;  4DEV A;  1G9A A;  1G6N A;  2LW8 A;  3WLU A;  3O5S A;  5I0U A;  3ZFF C;  5BNP A;  4B4R A;  1QQP 1;  2JE8 A;  4PHZ A;  3MID A;  4QHB A;  5CFC B;  3WNN A;  4UW5 A;  5FDB A;  4GWI A;  2WWJ A;  1R1Z A;  2W47 A;  1VAV A;  3A0N A;  5FYB A;  2D40 A;  1NCQ B;  1HB4 A;  1PGW 1;  4CSW A;  4P9X A;  3OBT A;  4XFH A;  1AX0 A;  3VD4 A;  1OBN A;  5G05 L;  1QOT A;  1Y9Q A;  4A42 A;  1YEW A;  2MPF A;  3MW3 A;  4XFI A;  1TME 1;  4XTP A;  3BTA A;  2WBK A;  2VOX A;  4QDQ A;  1BK1 A;  1POV 1;  3DXT A;  3ME2 A;  1IPK A;  1GFF 2;  4Q4Y 3;  3RYK A;  1KFX L;  4UFL A;  1OOP B;  1R64 A;  1LHN A;  1LHV A;  1GR3 A;  2EIG A;  2WNU A;  3NNG A;  4J1W A;  5HXV A;  5KXE A;  4B29 A;  3I3B A;  1LU1 A;  1DLC A;  3WV6 A;  2UWB A;  1RMU 1;  4PIY A;  4AFC A;  2W08 A;  3O12 A;  1XYN A;  2XKP A;  1B35 A;  3K46 A;  2K0G A;  5F3G A;  5GLZ A;  2HWF 1;  4Z2A A;  1GBG A;  3AJY A;  3T0B A;  4LLF A;  4LBM A;  1UMZ A;  2D43 A;  5K0U C;  5KHI A;  2CGO A;  1XXN A;  3ABZ A;  1ZNP A;  5CU1 A;  2NZ9 A;  1JZ4 A;  4IUG A;  5KHK A;  3AJZ A;  3MBW A;  4CCK A;  1C8M 1;  3OUH A;  3NAP C;  2IFR A;  4K9S A;  3T2T A;  3V0A B;  4YW1 A;  5C71 A;  4HET A;  4XF4 A;  5CG8 A;  5T54 A;  3GHN A;  2RS3 2;  1Q8P A;  4Y22 B;  4LBK A;  3I3Q A;  2VUA A;  4QKN A;  3WVJ A;  3VKO A;  4ZZ8 A;  1IS4 A;  3LEM A;  4MYE A;  5C7G A;  1WMD A;  1WW7 A;  2VQ0 A;  2ZAH A;  4QGN A;  1NCR B;  1SBE A;  1XNK A;  2D6P A;  4MUV A;  3ZYJ B;  5ACA 1;  4FXK B;  1LGN A;  2Z4F A;  4WV8 A;  2YRO A;  2UUR A;  1W04 A;  2Y0O A;  5ERL A;  5T5O A;  1RUN A;  2DU0 A;  5FCC A;  4AHY A;  4KU7 A;  4MZU A;  1BHG A;  4JCK A;  3D5O A;  1H9P A;  4DIN B;  1GU3 A;  3P6B A;  3GZU C;  5I8S A;  3WNP A;  4AQ2 A;  4LHK A;  2DVG A;  1UU6 A;  3TRS B;  5CFD A;  3B93 A;  2ZGN A;  3LDR A;  3LAG A;  4QXH A;  4EZH A;  5L36 A;  2PXJ A;  2HBU A;  2XJV A;  2GP5 A;  1CZS A;  1NXD 1;  3AYC A;  3H0O A;  3IDA A;  4LO7 A;  2HWC 1;  4NO4 A;  1C28 A;  4NHX A;  4EWD A;  4OHY A;  1J58 A;  3RI8 A;  3RWN A;  3SH3 A;  4N90 A;  2VNO A;  3WIN E;  3QH7 A;  5FZE A;  2OKX A;  1OC1 A;  2ATF A;  4GJY A;  5IJR A;  3AXE A;  5A32 A;  2JDP A;  3I97 A;  2ZXQ A;  1N3O A;  1O4T A;  1GAN A;  2B9U A;  2C9A A;  3ZXF A;  5F1R A;  2VTF A;  4FAH A;  2XL9 A;  1UYZ A;  2J22 A;  4UAP A;  5C8W A;  3ZOI A;  3WG4 A;  4P5Y A;  5FFO C;  3B9I A;  1AF9 A;  2D3S A;  2P3I A;  3BPS A;  5E1R A;  3RMY A;  3DYO A;  2I2S A;  1W3X A;  2FCV A;  3BU7 A;  1X8E A;  3ZYB A;  3ZFG A;  3KD4 A;  5CAZ A;  3WQ7 A;  1YFX A;  4JTN A;  1G9D A;  5FWJ A;  1NE6 A;  2P6C A;  4UI9 L;  2DFB A;  3QAC A;  2I74 A;  4FPY A;  5A7S A;  1CZT A;  3VBO B;  2R16 A;  5I93 A;  4YW4 A;  1C5H A;  2BFU S;  2PHR A;  5EJZ B;  1YXW A;  3LA7 A;  4MOA A;  2AH2 A;  3T4V A;  1FV2 A;  2J1R A;  4IEO A;  4XFC A;  5FZ7 A;  5FYS A;  1OFN A;  3BPZ A;  4TXW A;  1FXZ A;  1SPP B;  4H7L A;  1CX1 A;  3ZXA C;  2BGO A;  2YMZ A;  4GB3 1;  4BXS V;  4O65 A;  1Y7B A;  4MGS A;  2R7E B;  4FQZ A;  1EAH 1;  1S4C A;  2QE3 A;  4LT5 A;  3CL1 A;  3SEE A;  3S7E A;  1YIP A;  2RS3 3;  3GBF A;  5DXD A;  3ZPO A;  1XND A;  5A3W A;  5A80 A;  2YBS A;  3WF3 A;  4A45 A;  1PO1 2;  1OUR A;  5E6H A;  5LA2 A;  2X05 A;  4BE3 A;  3VDB A;  2A73 B;  1CON A;  1GZW A;  5FY4 A;  4NII A;  2D5H A;  4M00 A;  3LA2 A;  4SBV A;  1W2T A;  4WM7 C;  3BN6 A;  5FV3 A;  1OMI A;  5AFE A;  4RQP A;  5JZG A;  1H6X A;  5C8C B;  4QQ2 A;  5CVR A;  3PUS A;  1NLQ A;  3KVB A;  2WL1 A;  1TNR A;  3IAQ A;  5HXM A;  3M1H A;  2JWP A;  4TLF A;  4DQA A;  4IEU A;  3QH6 A;  4CA9 A;  3M3O A;  1FPN 2;  4RHV 2;  5A1F A;  4CRQ A;  1VBE 3;  3AMM A;  5EXO A;  4FPC A;  2J42 A;  3HBZ A;  4KQ7 A;  4HFS A;  3EYP A;  1GOF A;  4B1L A;  1S0F A;  1CJD A;  1U5Y A;  2XJR A;  3NMB A;  5FMD A;  3ZFE A;  2WA4 A;  4CDU A;  1G9B A;  1XC6 A;  2CGP A;  4FOV A;  5A1A A;  1PVC 2;  2IXJ A;  2DDU A;  1PM7 A;  3I59 B;  4CU8 A;  5JCT A;  1V0A A;  4UXA A;  3WCS A;  1RUC 1;  5FP4 A;  2P5B A;  1LR5 A;  2DVA A;  2WDB A;  4JGZ C;  2WS9 2;  1RED A;  3H9A A;  2W46 A;  3R0R A;  2GC1 A;  3V64 A;  3ZKY A;  5FQ0 A;  3ZYP A;  2GND A;  3POY A;  1UYP A;  3NL1 A;  2TUN A;  4EN0 A;  2RS3 1;  2WNV A;  1OA2 A;  3S7I A;  4UWD A;  1LB2 A;  2W1Q A;  5DAP A;  3IMM A;  3JD7 2;  4FP3 A;  3N7M A;  1XOY A;  2ZAC A;  4CEW B;  1QNW A;  5E8A A;  1BVP 1;  2QVS B;  2FD8 A;  4YVS C;  4NPR A;  1PIV 2;  3ORJ A;  5F6K A;  4Z8B A;  2Z2S B;  2JEN A;  4B1M A;  4E4Z A;  2D6O X;  2A1X A;  2OW4 A;  2WO2 A;  3VHN A;  2BP6 A;  2O1Q A;  4W4Z A;  4AAX A;  2JB8 A;  1OLQ A;  2GH8 A;  1K12 A;  4XFF A;  4Q29 A;  3LIH A;  1VPH A;  4V1P A;  5BNO A;  1MQT A;  1T2X A;  2YC4 A;  3LGR A;  1J59 A;  2K2S A;  1UWW A;  4LUK A;  1IHM A;  4BCU A;  3S5Q A;  4LMF A;  4ASL A;  4GWN A;  2O14 A;  4BQ2 A;  2BU9 A;  1UMH A;  1S0J A;  1V6I A;  5EPA A;  1AR7 1;  4BQ5 A;  4JDO A;  1BXH A;  3CJI A;  1CAW B; 
#chains in the Genus database with same CATH homology
 5A7N A;  2WWJ A;  5A7O A;  1VRB A;  3PUR A;  5FYU A;  2W2I A;  5FYB A;  5FY1 A;  5FXZ A;  4Y4R A;  5KR7 A;  4XDP A;  5FPV A;  3ZLI A;  3KV6 A;  4CSW A;  5FZ1 A;  5FZ7 A;  5FYS A;  3DXU A;  5IVC A;  2XDV A;  5FYC A;  4EZ4 A;  2YU1 A;  4LXL A;  4V2V A;  3LDB A;  3N9L A;  3KV5 A;  2GP3 A;  3AL5 A;  4GD4 A;  2OQ6 A;  3AVR A;  4CCL A;  4CCN A;  2OT7 A;  5A7P A;  2OS2 A;  2Q8D A;  3LD8 A;  3DXT A;  5F32 A;  3U4S A;  5A3P A;  5CEH A;  3ZPO A;  4BU2 A;  5FPA A;  2Q8E A;  3PUQ A;  4D6Q A;  4QWN A;  3KV4 A;  5A3W A;  5A80 A;  4EYU A;  2YBS A;  4QU1 A;  5FZ4 A;  4LIT A;  5FZF A;  2XML A;  5E6H A;  4CCO A;  4V2W A;  5FUN A;  5F3G A;  3K3O A;  5FY4 A;  5FV3 A;  5A7W A;  5FUP A;  5FZ8 A;  3AVS A;  4Y33 A;  5A7W B;  4LIV A;  5FZD A;  3PUS A;  5FJH A;  5LY1 A;  3K2O A;  3KVB A;  4CCK A;  5FPU A;  3N9M A;  3KVA A;  5ANQ A;  4IGP A;  5FZ3 A;  3PU8 A;  5K4L A;  3PUA A;  4AI9 A;  5A1F A;  3N9O A;  4CCM A;  4UF0 A;  4QXB A;  5FY8 A;  5LWB A;  4TN7 A;  5FZ6 A;  4URA A;  4CUG A;  5F3C A;  5IVE A;  5FYT A;  5A1L A;  5A3N A;  5FP7 A;  3PTR B;  5F39 A;  5FYV A;  4NUB A;  5F5I A;  5FZO A;  5FPL A;  3N9Q A;  5F2W A;  5F5C A;  5FZA A;  5FP4 A;  2P5B A;  5FZC A;  3UYJ A;  2YPD A;  2WWU A;  5F2S A;  2YBP A;  4IGQ A;  5F5A A;  5FYM A;  3RVH A;  5FZ0 A;  5FZG A;  4C8D A;  5FZK A;  4LIU A;  5IVF A;  3N9P A;  5A7Q A;  4QXC A;  2YBK A;  5F3E A;  4XDO A;  4BXF A;  4QXH A;  4EZH A;  2OQ7 A;  2PXJ A;  5FZM A;  4DIQ A;  4HON A;  5FBJ A;  2GP5 A;  5FZB A;  5IWF A;  4AAP A;  4DO0 A;  5FPB A;  3PU3 A;  5FP8 A;  5IVV A;  5FY5 A;  2XXZ A;  4UF0 B;  5F3I A;  5A3T A;  3OPW A;  2YU2 A;  5FZ9 A;  5F37 A;  5ISL A;  5FYH A;  2XUE A;  4GAZ A;  5FZE A;  3PDQ A;  5FWE A;  4E4H A;  4GJY A;  4HOO A;  4QX7 A;  3NJY A;  2VD7 A;  4D6R A;  5FJK A;  4ASK A;  5IVJ A;  5FY0 A;  5FZO B;  5FY7 A;  5FYI A;  4CCJ A;  3KV9 A;  5FP3 A;  5FZH A;  3OPT A;  4D6S A;  5FXV A;  5FXX A;  5FYY A;  5IVB A;  3N9N A;  2OX0 A;  2Q8C A;  3U78 A;  3AL6 A;  5LY2 A;  4Y3O A;  5LW9 A;  5FZI A;  5FZL A;  3K3N A;  4QX8 A;  5FYZ A;  5IVY A;  5FP9 A;  5FXW A;  5IW0 A;  5FY9 A;  4BIS A;  4IGO A;  4GJZ A;  5FWJ A;  5A7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...