2GPFA

Solution nmr structure of protein pa22412 from pseudomonas aeruginosa. northeast structural genomics consortium target pat86, ontario centre for structural proteomics target pa2412.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
72
structure length
72
Chain Sequence
MTSVFDRDDIQFQVVVNHEEQYSIWPEYKEIPQGWRAAGKSGLKKDCLAYIEEVWTDMRPLSLRQHMDKAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of PA2412 protein determined using ABACUS protocol
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein PA2412
total genus 11
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03621 MbtH MbtH-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.820.10 Alpha Beta Alpha-Beta Complex Rubredoxin-like Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 2gpfA01
4GR4A 2GPFA 5JA1B 2KHRA 2PSTX 4GR5A 1GH9A 2MYYA
chains in the Genus database with same CATH superfamily
4GR4A 2GPFA 5JA1B 2JNEA 2KHRA 2PSTX 2JRPA 4GR5A 1GH9A 2MYYA
chains in the Genus database with same CATH topology
4GR4A 2GPFA 5JA1B 2KHRA 2PSTX 4GR5A 1GH9A 2MYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GR4 A;  2GPF A;  5JA1 B;  2KHR A;  2PST X;  4GR5 A;  1GH9 A;  2MYY A; 
#chains in the Genus database with same CATH topology
 4GR4 A;  2GPF A;  5JA1 B;  2JNE A;  2KHR A;  2PST X;  2JRP A;  4GR5 A;  1GH9 A;  2MYY A; 
#chains in the Genus database with same CATH homology
 4GR4 A;  2GPF A;  5JA1 B;  2KHR A;  2PST X;  4GR5 A;  1GH9 A;  2MYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...