2GPIA

Crystal structure of a protein of unknown function from duf1488 family (shew_3726) from shewanella loihica pv-4 at 1.60 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
GMNQSIIFTEQLTWDVQLSAIHFTAQQQGMVIDCYIGQKVLEHLAAEKINNSEQALSLFEQFRFDIEEQAEKLIEQEAFDVQGHIQVERVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of conserved hypothetical protein (ZP_00837230.1) from Shewanella sp. PV-4 at 1.60 A resolution
rcsb
molecule keywords conserved hypothetical protein
source organism Shewanella loihica
molecule tags Unknown function
total genus 24
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07369 DUF1488 Protein of unknown function (DUF1488)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.140 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Shew3726-like 2gpiA00
2GPIA
chains in the Genus database with same CATH superfamily
4DV7E 1J26A 2WBUA 2EMCA 3HPSA 4F9CB 2LJUA 2EPRA 2ENHA 4DR4E 4BC7A 4Q28A 2KOUA 1PKPA 2EMIA 2JY9A 3HPZA 2VQEE 2EQ3A 1P47A 2EE8A 2EPZA 1MGTA 2EPOA 2KONA 3ZOQB 5CFFE 1AH5A 2ELYA 4F6NA 2M9AA 1RQ0A 4HEIA 2ADRA 1WXRA 2YRMA 4BS9A 3AV0A 3ADIA 4FK5C 3KZYA 2UU9E 2CTDA 2DSYA 3MHHC 4LF4E 2B9DA 2CSHA 4R2AA 4LF8E 2VRDA 4DV4E 2EPXA 5LMUE 2RSIA 2EPNA 1YUJA 4JYAE 4BHCA 2LV2A 5KL4A 3C4TA 2UUAE 2GHFA 3P1XA 2L3CA 1XNQE 3AUZA 4B3SE 2HGHA 1BBGA 5AE2A 2EPCA 2RPCA 2V88A 1PDAA 2GLIA 1N33E 2EMWA 2DIXA 2EOYA 2L2KB 2NA2A 1HNWE 4R03A 4M0VA 1I94E 2EN6A 2HC5A 5IWAE 4DR7E 1ZBTA 4KZSA 4DR3E 1O0WA 2EMHA 3OTOE 4IS1C 2DLKA 4O4KA 2L2NA 2UUCE 1DQ3A 3VHTB 2EMKA 4DV0E 2EMZA 2KHXA 5DNYA 3BIDA 2FTXB 4JI0E 2EOIA 4O5GA 1ZAAC 2ELZA 2YSOA 2JOXA 2EPUA 4N4RB 4WXCA 3J7AG 4R2CA 4WPYA 4RH8A 2NABA 2EOOA 2LTSA 2ODRD 4JI5E 4O43A 4JI1E 1PJQA 2JWOA 2LT7A 2EM2A 1G2FC 3THOB 3M99B 4LFBE 1ZU1A 2EOXA 3ADJA 2M7QA 4DR2E 2EPPA 2L92A 2BB8A 2EOMA 5A6JA 2LUPB 4NXME 4IJDA 2FV4B 4F9BB 2EPMX 4WSGA 5KL5A 4R2EA 1RMDA 2DB2A 1X6EA 2EPKX 2LUQA 2EMLA 2IHR1 1B69A 4R2SA 4DV3E 1YYOA 4JI2E 3C6KA 1YUIA 4DV1E 1XMOE 3H09A 1X3CA 3ADLA 2EN3A 4LFAE 4BC9A 2K7IA 2N3GA 2J7JA 1X48A 2FGGA 3EQ1A 1A1KA 2YRHA 4LTYA 1EH8A 5IT9C 1UHZA 2D9HA 4DMIA 3JTZA 2L8TA 2R1FA 2EM4A 4F54A 3DJWA 1X47A 2LO3A 2EZ6A 1N34E 1J5EE 4JV5E 2EL4A 2L3JA 4AQYE 2MKNA 2I9IA 2EQ0A 1HNZE 4WXDA 5A2QC 4X65E 5A6KA 2EMBA 2EOQA 1QNTA 3DF6A 1TF6A 2V89A 4ZYHA 2F4VE 4R2RA 1IBLE 4M30A 2M1SA 1NEIA 1XNRE 2EPLX 1N3GA 1T4NA 2WZOA 2B7VA 1GTKA 2YWQA 4L8NA 1EH6A 5A69A 3QG5C 2YT4A 2EL6A 1N32E 2YRKA 3KWRA 3K6QA 1NCSA 5AE1A 2JP9A 2MC5A 4HTGA 4OOGC 1WHNA 4F6MA 1A1GA 2E5LE 3THNA 1UN6B 2CPNA 3JAMC 1DI2A 4P78A 4M9VC 5LL6R 4BCAA 2PRTA 2WBSA 4WX9A 1DGCA 4GZNC 3UK3C 3L00A 4BHBA 1X6FA 2E72A 1T39A 4YHHE 4DR1E 2I13A 1KJKA 2R76A 1JK2A 2EM3A 4ZYDA 4ZYGA 3EPLA 4WYQB 3ECRA 3TQMA 1A1LA 2EN4A 1TF3A 4YY3E 3LLHA 1MEYC 4OX9E 1X5WA 5BR8E 2EM7A 4DUZE 2ENCA 4DUYE 4O24A 2EN1A 1T4LB 5A6BD 2JR1A 3BBGA 1YZ9A 2EM5A 4BBYA 2EP3A 4R2PA 4LF7E 2LMZA 1WRJA 2HJJA 3MSWA 1GQEA 2DGCA 2UXBE 1IQSA 3BGHA 4KHPE 5A6BA 2YTJA 3FIGA 4Q35B 3T1HE 1RC7A 2RS7A 2K4VA 2DMIA 4MLVA 1IMUA 2MDRA 4GEQB 4B3ME 2CT1A 5IV8B 2UXDE 2EOSA 2YTIA 4LF5E 3IWBA 4P7DA 3VYYA 4JI6E 3C6MA 4J8ZA 1STUA 4DR5E 1IBME 2V85A 1IQOA 5KL3A 2RQLA 5AC4A 5AE3A 2EMYA 1EKZA 1PJSA 3LMLA 4ZYEA 2YTOA 2EM0A 2RTXA 5KL7A 3MHSC 1QU6A 4DV6E 1YYWA 2DMYA 2LTRA 2E1MA 1YSAC 1F2IG 2BBGA 2V8QB 4TUIA 3IWDA 2V86A 2WBTA 1IBKE 1ZBQA 2EOHA 5AC5A 1N36E 2EOZA 1Z1BA 3J80C 5F3WA 2JXPA 2A25A 2EN8A 4MLQA 4I8OA 4F9AB 4GKJE 3J81C 1HNXE 2YTNA 2YZTA 4X9JA 4JI7E 4X62E 3F6HA 5LLQA 5IXMB 2EQ1A 4WSPA 5AASA 2G7HA 4B3RE 2LVHA 3T1YE 3RMPA 2L2MA 1A1IA 2MDGA 4R2DA 2NUEA 2M4IA 1WJPA 1YFHA 2DRPA 2LE2A 1X6HA 3HQ1A 2LBSB 2YTFA 2JYAA 1ZR9A 2EOEA 4NXNE 5TSEA 4L5NC 4DR6E 4NZVA 5LMNE 2JPAA 2YTDA 1FJGE 1PJTA 4LFCE 3VYXA 3EPKA 2V87A 2YU5A 2ENAA 1FKAE 2EL5A 2EMGA 1UILA 2YTPA 4DV2E 2JOBA 2MC6A 2L33A 2EM9A 2EMAA 3EPHA 2MKDA 3IWCA 2LJHA 3ADGA 2YTEA 2RSMA 4B3TE 4X8WA 5T6JA 5A6AA 2V83A 2GPIA 1A1JA 1BB8A 2B7TA 1A1FA 4JI3E 3VK6A 1LLMC 1TN9A 4JI8E 2YPNA 4GKKE 3OMLA 1GZ6A 1SFEA 4NHRA 3JU0A 2YTGA 1YYKA 2EMXA 2YU8A 4LU9A 4JI4E 1EH7A 2Q8UA 2EWLA 1YPNA 3HXLA 2VF1A 2WCC3 4LF6E 4K0KE 2EOFA 2HHHE 2N8XA 3KZZA 2NUFA 4R2QA 4DKKA 1T38A 2EORA 2DLQA 3BF2A 5ADZA 2EJ4A 1G2DC 1X49A 4BMJA 2VE7C 2JVAA 4X64E 2LCEA 2EMFA 4WFTA 2ZM6E 5FLXC 2UUBE 2L6MA 2EN2A 1T4OA 4R8OA 4F2JC 3EPJA 4KWYA 2UXCE 1A1HA 4DV5E 3HTXA 2EN7A 1AAYA 1KYQA 5KL6A 1L4SA 1XMQE 1SR9A 2N3HA 2EOJA 4X66E 1WHQA 2EPAA 2RS6A 3C4BA 2NUGA 3J7Yp 2YSPA 3F6GA 2EM6A 5KL2A 2ODRC 2B3TB 1JK1A 4M2ZA 2LRSA 2H36X 2VQFE 1HR0E 4RHBB 1BBOA 1UBDC 2YTQA 4LF9E 2EM8A 4TUGA 2F8BA
chains in the Genus database with same CATH topology
2GPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GPI A; 
#chains in the Genus database with same CATH topology
 4DV7 E;  1J26 A;  2WBU A;  2EMC A;  3HPS A;  4F9C B;  2LJU A;  2EPR A;  2ENH A;  4DR4 E;  4BC7 A;  4Q28 A;  2KOU A;  1PKP A;  2EMI A;  2JY9 A;  3HPZ A;  2VQE E;  2EQ3 A;  1P47 A;  2EE8 A;  2EPZ A;  1MGT A;  2EPO A;  2KON A;  3ZOQ B;  5CFF E;  1AH5 A;  2ELY A;  4F6N A;  2M9A A;  1RQ0 A;  4HEI A;  2ADR A;  1WXR A;  2YRM A;  4BS9 A;  3AV0 A;  3ADI A;  4FK5 C;  3KZY A;  2UU9 E;  2CTD A;  2DSY A;  3MHH C;  4LF4 E;  2B9D A;  2CSH A;  4R2A A;  4LF8 E;  2VRD A;  4DV4 E;  2EPX A;  5LMU E;  2RSI A;  2EPN A;  1YUJ A;  4JYA E;  4BHC A;  2LV2 A;  5KL4 A;  3C4T A;  2UUA E;  2GHF A;  3P1X A;  2L3C A;  1XNQ E;  3AUZ A;  4B3S E;  2HGH A;  1BBG A;  5AE2 A;  2EPC A;  2RPC A;  2V88 A;  1PDA A;  2GLI A;  1N33 E;  2EMW A;  2DIX A;  2EOY A;  2L2K B;  2NA2 A;  1HNW E;  4R03 A;  4M0V A;  1I94 E;  2EN6 A;  2HC5 A;  5IWA E;  4DR7 E;  1ZBT A;  4KZS A;  4DR3 E;  1O0W A;  2EMH A;  3OTO E;  4IS1 C;  2DLK A;  4O4K A;  2L2N A;  2UUC E;  1DQ3 A;  3VHT B;  2EMK A;  4DV0 E;  2EMZ A;  2KHX A;  5DNY A;  3BID A;  2FTX B;  4JI0 E;  2EOI A;  4O5G A;  1ZAA C;  2ELZ A;  2YSO A;  2JOX A;  2EPU A;  4N4R B;  4WXC A;  3J7A G;  4R2C A;  4WPY A;  4RH8 A;  2NAB A;  2EOO A;  2LTS A;  2ODR D;  4JI5 E;  4O43 A;  4JI1 E;  1PJQ A;  2JWO A;  2LT7 A;  2EM2 A;  1G2F C;  3THO B;  3M99 B;  4LFB E;  1ZU1 A;  2EOX A;  3ADJ A;  2M7Q A;  4DR2 E;  2EPP A;  2L92 A;  2BB8 A;  2EOM A;  5A6J A;  2LUP B;  4NXM E;  4IJD A;  2FV4 B;  4F9B B;  2EPM X;  4WSG A;  5KL5 A;  4R2E A;  1RMD A;  2DB2 A;  1X6E A;  2EPK X;  2LUQ A;  2EML A;  2IHR 1;  1B69 A;  4R2S A;  4DV3 E;  1YYO A;  4JI2 E;  3C6K A;  1YUI A;  4DV1 E;  1XMO E;  3H09 A;  1X3C A;  3ADL A;  2EN3 A;  4LFA E;  4BC9 A;  2K7I A;  2N3G A;  2J7J A;  1X48 A;  2FGG A;  3EQ1 A;  1A1K A;  2YRH A;  4LTY A;  1EH8 A;  5IT9 C;  1UHZ A;  2D9H A;  4DMI A;  3JTZ A;  2L8T A;  2R1F A;  2EM4 A;  4F54 A;  3DJW A;  1X47 A;  2LO3 A;  2EZ6 A;  1N34 E;  1J5E E;  4JV5 E;  2EL4 A;  2L3J A;  4AQY E;  2MKN A;  2I9I A;  2EQ0 A;  1HNZ E;  4WXD A;  5A2Q C;  4X65 E;  5A6K A;  2EMB A;  2EOQ A;  1QNT A;  3DF6 A;  1TF6 A;  2V89 A;  4ZYH A;  2F4V E;  4R2R A;  1IBL E;  4M30 A;  2M1S A;  1NEI A;  1XNR E;  2EPL X;  1N3G A;  1T4N A;  2WZO A;  2B7V A;  1GTK A;  2YWQ A;  4L8N A;  1EH6 A;  5A69 A;  3QG5 C;  2YT4 A;  2EL6 A;  1N32 E;  2YRK A;  3KWR A;  3K6Q A;  1NCS A;  5AE1 A;  2JP9 A;  2MC5 A;  4HTG A;  4OOG C;  1WHN A;  4F6M A;  1A1G A;  2E5L E;  3THN A;  1UN6 B;  2CPN A;  3JAM C;  1DI2 A;  4P78 A;  4M9V C;  5LL6 R;  4BCA A;  2PRT A;  2WBS A;  4WX9 A;  1DGC A;  4GZN C;  3UK3 C;  3L00 A;  4BHB A;  1X6F A;  2E72 A;  1T39 A;  4YHH E;  4DR1 E;  2I13 A;  1KJK A;  2R76 A;  1JK2 A;  2EM3 A;  4ZYD A;  4ZYG A;  3EPL A;  4WYQ B;  3ECR A;  3TQM A;  1A1L A;  2EN4 A;  1TF3 A;  4YY3 E;  3LLH A;  1MEY C;  4OX9 E;  1X5W A;  5BR8 E;  2EM7 A;  4DUZ E;  2ENC A;  4DUY E;  4O24 A;  2EN1 A;  1T4L B;  5A6B D;  2JR1 A;  3BBG A;  1YZ9 A;  2EM5 A;  4BBY A;  2EP3 A;  4R2P A;  4LF7 E;  2LMZ A;  1WRJ A;  2HJJ A;  3MSW A;  1GQE A;  2DGC A;  2UXB E;  1IQS A;  3BGH A;  4KHP E;  5A6B A;  2YTJ A;  3FIG A;  4Q35 B;  3T1H E;  1RC7 A;  2RS7 A;  2K4V A;  2DMI A;  4MLV A;  1IMU A;  2MDR A;  4GEQ B;  4B3M E;  2CT1 A;  5IV8 B;  2UXD E;  2EOS A;  2YTI A;  4LF5 E;  3IWB A;  4P7D A;  3VYY A;  4JI6 E;  3C6M A;  4J8Z A;  1STU A;  4DR5 E;  1IBM E;  2V85 A;  1IQO A;  5KL3 A;  2RQL A;  5AC4 A;  5AE3 A;  2EMY A;  1EKZ A;  1PJS A;  3LML A;  4ZYE A;  2YTO A;  2EM0 A;  2RTX A;  5KL7 A;  3MHS C;  1QU6 A;  4DV6 E;  1YYW A;  2DMY A;  2LTR A;  2E1M A;  1YSA C;  1F2I G;  2BBG A;  2V8Q B;  4TUI A;  3IWD A;  2V86 A;  2WBT A;  1IBK E;  1ZBQ A;  2EOH A;  5AC5 A;  1N36 E;  2EOZ A;  1Z1B A;  3J80 C;  5F3W A;  2JXP A;  2A25 A;  2EN8 A;  4MLQ A;  4I8O A;  4F9A B;  4GKJ E;  3J81 C;  1HNX E;  2YTN A;  2YZT A;  4X9J A;  4JI7 E;  4X62 E;  3F6H A;  5LLQ A;  5IXM B;  2EQ1 A;  4WSP A;  5AAS A;  2G7H A;  4B3R E;  2LVH A;  3T1Y E;  3RMP A;  2L2M A;  1A1I A;  2MDG A;  4R2D A;  2NUE A;  2M4I A;  1WJP A;  1YFH A;  2DRP A;  2LE2 A;  1X6H A;  3HQ1 A;  2LBS B;  2YTF A;  2JYA A;  1ZR9 A;  2EOE A;  4NXN E;  5TSE A;  4L5N C;  4DR6 E;  4NZV A;  5LMN E;  2JPA A;  2YTD A;  1FJG E;  1PJT A;  4LFC E;  3VYX A;  3EPK A;  2V87 A;  2YU5 A;  2ENA A;  1FKA E;  2EL5 A;  2EMG A;  1UIL A;  2YTP A;  4DV2 E;  2JOB A;  2MC6 A;  2L33 A;  2EM9 A;  2EMA A;  3EPH A;  2MKD A;  3IWC A;  2LJH A;  3ADG A;  2YTE A;  2RSM A;  4B3T E;  4X8W A;  5T6J A;  5A6A A;  2V83 A;  2GPI A;  1A1J A;  1BB8 A;  2B7T A;  1A1F A;  4JI3 E;  3VK6 A;  1LLM C;  1TN9 A;  4JI8 E;  2YPN A;  4GKK E;  3OML A;  1GZ6 A;  1SFE A;  4NHR A;  3JU0 A;  2YTG A;  1YYK A;  2EMX A;  2YU8 A;  4LU9 A;  4JI4 E;  1EH7 A;  2Q8U A;  2EWL A;  1YPN A;  3HXL A;  2VF1 A;  2WCC 3;  4LF6 E;  4K0K E;  2EOF A;  2HHH E;  2N8X A;  3KZZ A;  2NUF A;  4R2Q A;  4DKK A;  1T38 A;  2EOR A;  2DLQ A;  3BF2 A;  5ADZ A;  2EJ4 A;  1G2D C;  1X49 A;  4BMJ A;  2VE7 C;  2JVA A;  4X64 E;  2LCE A;  2EMF A;  4WFT A;  2ZM6 E;  5FLX C;  2UUB E;  2L6M A;  2EN2 A;  1T4O A;  4R8O A;  4F2J C;  3EPJ A;  4KWY A;  2UXC E;  1A1H A;  4DV5 E;  3HTX A;  2EN7 A;  1AAY A;  1KYQ A;  5KL6 A;  1L4S A;  1XMQ E;  1SR9 A;  2N3H A;  2EOJ A;  4X66 E;  1WHQ A;  2EPA A;  2RS6 A;  3C4B A;  2NUG A;  3J7Y p;  2YSP A;  3F6G A;  2EM6 A;  5KL2 A;  2ODR C;  2B3T B;  1JK1 A;  4M2Z A;  2LRS A;  2H36 X;  2VQF E;  1HR0 E;  4RHB B;  1BBO A;  1UBD C;  2YTQ A;  4LF9 E;  2EM8 A;  4TUG A;  2F8B A; 
#chains in the Genus database with same CATH homology
 2GPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...