2GPIA

Crystal structure of a protein of unknown function from duf1488 family (shew_3726) from shewanella loihica pv-4 at 1.60 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
b'GMNQSIIFTEQLTWDVQLSAIHFTAQQQGMVIDCYIGQKVLEHLAAEKINNSEQALSLFEQFRFDIEEQAEKLIEQEAFDVQGHIQVERVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal structure of conserved hypothetical protein (ZP_00837230.1) from Shewanella sp. PV-4 at 1.60 A resolution
rcsb
source organism Shewanella loihica
molecule tags Unknown function
total genus 24
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07369 DUF1488 Protein of unknown function (DUF1488)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.140 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Shew3726-like 2gpiA00
2GPIA
chains in the Genus database with same CATH superfamily
2ENAA 3ADLA 3KZZA 3JAMC 4P7DA 3VHTB 4X9JA 3C6MA 2GHFA 1GTKA 2YRHA 4DUYE 2UUCE 4LFAE 2EM0A 2YU8A 2EN1A 2LJHA 2YTIA 3BIDA 3HTXA 2YSPA 3FIGA 2WCC3 1QNTA 2EMKA 4DV4E 2NUEA 2K4VA 2JXPA 4JI3E 1GQEA 4F9AB 5KL3A 2EMIA 4X62E 2YRMA 3IWBA 2HHHE 2EZ6A 2B9DA 3MHSC 1HNWE 4X64E 1JK2A 4TUGA 4BHCA 4F2JC 2UUBE 1EH6A 4O43A 3MHHC 1KJKA 2NUFA 2L8TA 4NZVA 4GEQB 4LF9E 2B7VA 1HNZE 2E5LE 5IV8B 3P1XA 1DI2A 2I13A 2EMGA 3AV0A 3ECRA 4ZYEA 1UBDC 4BHBA 2EOOA 1N32E 2EM2A 1WXRA 3J7Yp 2WBUA 2EPNA 1HR0E 1DGCA 2LTRA 5TSEA 3ADGA 4R2AA 1ZR9A 2NABA 4WSGA 1MEYC 4NXME 2IHR1 4BMJA 1BB8A 1X49A 3H09A 4KZSA 5KL7A 5LMNE 2EQ0A 1AH5A 2RSIA 1T4LB 2EE8A 1A1FA 5AASA 4GKKE 5IT9C 2EPOA 2F4VE 2EOQA 1YYKA 2V8QB 4LF4E 3RMPA 3J7AG 4ZYDA 1A1JA 2EM6A 1Z1BA 2V89A 1X48A 2L2MA 1YUIA 2YSOA 2JY9A 4BCAA 4BBYA 2EM7A 2YTOA 4X66E 2M1SA 2EOMA 4IJDA 2LT7A 1NEIA 2RTXA 1YYWA 1PJSA 2ENCA 2YTDA 1EH7A 4KWYA 2EOIA 2WZOA 1RC7A 2DLQA 5LL6R 5F3WA 4DV5E 1J26A 2EMWA 5AE3A 1I94E 4M2ZA 1YZ9A 5A6AA 4R03A 4B3RE 2EOZA 2DGCA 2M9AA 4JI5E 5ADZA 2HJJA 3DF6A 2EN7A 2YRKA 2V85A 2WBTA 4OOGC 2N3HA 3QG5C 2VF1A 2EL6A 2EPRA 2EPUA 1PJTA 2E1MA 5FLXC 2EP3A 4DV2E 3VYXA 4KHPE 3THOB 2EWLA 2A25A 2JWOA 4HEIA 5LLQA 4R2RA 4JYAE 2HC5A 1WJPA 4LF5E 2DMIA 3BGHA 5DNYA 2EMCA 2EM5A 3T1HE 2E72A 4HTGA 2ENHA 1XMQE 5IWAE 5AE2A 2EPCA 1WHQA 3BBGA 2EL5A 2JP9A 3T1YE 4M0VA 1IQOA 1A1IA 1FKAE 2DIXA 2V86A 2FTXB 3LMLA 1B69A 3JU0A 2LBSB 4DV0E 5A6BD 1ZBQA 5A2QC 2JR1A 1HNXE 3K6QA 1A1GA 1IBLE 2MC5A 1X3CA 2MDGA 4DKKA 2EOXA 1YFHA 1IQSA 4B3SE 3VYYA 2GPIA 2EOYA 1IBKE 1UN6B 2LMZA 4TUIA 2EM4A 2UXDE 2CT1A 1RQ0A 2EOEA 4BC7A 3HPZA 1YSAC 4Q35B 3L00A 2EMBA 3EPJA 2GLIA 4FK5C 2EPAA 2NUGA 1N36E 5KL2A 2RS6A 4LF6E 2Q8UA 4P78A 2LVHA 1EH8A 3EQ1A 4B3TE 2N3GA 3EPKA 4DR2E 2VQEE 2LJUA 2EPKX 2DSYA 2VRDA 4DR7E 4WXCA 1UHZA 3BF2A 4RH8A 2L92A 2YT4A 1X5WA 4AQYE 1ZU1A 4BC9A 1P47A 1ZAAC 2EM3A 2I9IA 5IXMB 1BBOA 4LTYA 4JI6E 2EN6A 3ZOQB 1XNQE 2DMYA 2K7IA 3C6KA 1MGTA 2ODRD 1X47A 4O5GA 5CFFE 2EM8A 2CSHA 4BS9A 1T38A 1G2FC 2YTEA 2DLKA 2ZM6E 4R2PA 1N33E 4R2SA 1O0WA 3HQ1A 4YY3E 4L5NC 2MKDA 1TF6A 2LV2A 2EQ3A 3OTOE 2JOXA 1ZBTA 4DUZE 4WXDA 2EMXA 2J7JA 1PJQA 2R1FA 3J80C 1J5EE 4R2CA 1G2DC 2MKNA 4R8OA 2V87A 4RHBB 4LF8E 3MSWA 1A1HA 2L2KB 2CTDA 2F8BA 2D9HA 1T39A 4R2QA 4K0KE 1BBGA 4WYQB 2ODRC 4YHHE 2M4IA 5KL6A 2EOSA 4R2EA 2LUPB 4JI4E 2UXBE 1PDAA 2L3JA 2FV4B 1L4SA 2ELYA 5LMUE 1PKPA 2YTPA 2EOHA 3LLHA 1X6FA 2H36X 3EPHA 1WHNA 1X6HA 2FGGA 4X65E 2BB8A 2LCEA 4MLVA 2UU9E 3THNA 1WRJA 1GZ6A 2EPMX 4F9CB 4ZYHA 4DV7E 4M30A 2HGHA 2EOFA 2UUAE 2M7QA 1SR9A 5A6KA 1JK1A 2JVAA 3JTZA 4DR6E 4JI0E 3EPLA 2L33A 2YTNA 5KL5A 4NXNE 2EM9A 2LRSA 4JI2E 1F2IG 2EMHA 4DV1E 2EN4A 4DMIA 2EPZA 5T6JA 3ADJA 2KOUA 1T4OA 4I8OA 2KHXA 2RSMA 1EKZA 2WBSA 1QU6A 4F9BB 2EN3A 2VE7C 3AUZA 2L3CA 1XNRE 4GZNC 4F6MA 4DR3E 2EMFA 1LLMC 2RPCA 1IMUA 1N34E 4L8NA 2EPPA 2CPNA 2L2NA 2EMYA 4ZYGA 2YPNA 1TF3A 3DJWA 4X8WA 4B3ME 4WFTA 2MDRA 1SFEA 2R76A 3HPSA 2JYAA 4DR5E 1T4NA 2JOBA 2EQ1A 4M9VC 2N8XA 4O4KA 4F6NA 3IWDA 2EMZA 3HXLA 4MLQA 3UK3C 4F54A 2YZTA 1FJGE 2NA2A 4Q28A 4WX9A 3C4BA 1NCSA 1YUJA 4JV5E 1DQ3A 5BR8E 2EPXA 2B3TB 1STUA 1A1LA 3C4TA 5KL4A 1AAYA 2EMLA 4LF7E 2B7TA 1YYOA 2RS7A 2YU5A 1A1KA 4LU9A 2L6MA 5AC4A 2PRTA 2V88A 4GKJE 4N4RB 5A6JA 3F6HA 1KYQA 4WSPA 1IBME 2BBGA 2EJ4A 5AE1A 2UXCE 2EN2A 2EORA 2EL4A 3VK6A 4JI1E 2G7HA 1X6EA 2EN8A 2DB2A 2YTGA 2YTJA 4LFCE 4DR4E 3OMLA 4OX9E 4J8ZA 4WPYA 2YTFA 2MC6A 4LFBE 2EMAA 2VQFE 4NHRA 4JI7E 2EPLX 2ADRA 2V83A 2KONA 4O24A 3F6GA 2LO3A 2RQLA 1N3GA 2YWQA 3IWCA 1RMDA 4IS1C 4JI8E 3KZYA 1XMOE 3ADIA 4R2DA 2JPAA 2LTSA 2LUQA 2YTQA 3J81C 5AC5A 4DR1E 2EOJA 1TN9A 4DV3E 2DRPA 3KWRA 1YPNA 3TQMA 5A69A 3M99B 2LE2A 5A6BA 4DV6E 2ELZA 1UILA
chains in the Genus database with same CATH topology
2GPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GPI A; 
#chains in the Genus database with same CATH topology
 2ENA A;  3ADL A;  3KZZ A;  3JAM C;  4P7D A;  3VHT B;  4X9J A;  3C6M A;  2GHF A;  1GTK A;  2YRH A;  4DUY E;  2UUC E;  4LFA E;  2EM0 A;  2YU8 A;  2EN1 A;  2LJH A;  2YTI A;  3BID A;  3HTX A;  2YSP A;  3FIG A;  2WCC 3;  1QNT A;  2EMK A;  4DV4 E;  2NUE A;  2K4V A;  2JXP A;  4JI3 E;  1GQE A;  4F9A B;  5KL3 A;  2EMI A;  4X62 E;  2YRM A;  3IWB A;  2HHH E;  2EZ6 A;  2B9D A;  3MHS C;  1HNW E;  4X64 E;  1JK2 A;  4TUG A;  4BHC A;  4F2J C;  2UUB E;  1EH6 A;  4O43 A;  3MHH C;  1KJK A;  2NUF A;  2L8T A;  4NZV A;  4GEQ B;  4LF9 E;  2B7V A;  1HNZ E;  2E5L E;  5IV8 B;  3P1X A;  1DI2 A;  2I13 A;  2EMG A;  3AV0 A;  3ECR A;  4ZYE A;  1UBD C;  4BHB A;  2EOO A;  1N32 E;  2EM2 A;  1WXR A;  3J7Y p;  2WBU A;  2EPN A;  1HR0 E;  1DGC A;  2LTR A;  5TSE A;  3ADG A;  4R2A A;  1ZR9 A;  2NAB A;  4WSG A;  1MEY C;  4NXM E;  2IHR 1;  4BMJ A;  1BB8 A;  1X49 A;  3H09 A;  4KZS A;  5KL7 A;  5LMN E;  2EQ0 A;  1AH5 A;  2RSI A;  1T4L B;  2EE8 A;  1A1F A;  5AAS A;  4GKK E;  5IT9 C;  2EPO A;  2F4V E;  2EOQ A;  1YYK A;  2V8Q B;  4LF4 E;  3RMP A;  3J7A G;  4ZYD A;  1A1J A;  2EM6 A;  1Z1B A;  2V89 A;  1X48 A;  2L2M A;  1YUI A;  2YSO A;  2JY9 A;  4BCA A;  4BBY A;  2EM7 A;  2YTO A;  4X66 E;  2M1S A;  2EOM A;  4IJD A;  2LT7 A;  1NEI A;  2RTX A;  1YYW A;  1PJS A;  2ENC A;  2YTD A;  1EH7 A;  4KWY A;  2EOI A;  2WZO A;  1RC7 A;  2DLQ A;  5LL6 R;  5F3W A;  4DV5 E;  1J26 A;  2EMW A;  5AE3 A;  1I94 E;  4M2Z A;  1YZ9 A;  5A6A A;  4R03 A;  4B3R E;  2EOZ A;  2DGC A;  2M9A A;  4JI5 E;  5ADZ A;  2HJJ A;  3DF6 A;  2EN7 A;  2YRK A;  2V85 A;  2WBT A;  4OOG C;  2N3H A;  3QG5 C;  2VF1 A;  2EL6 A;  2EPR A;  2EPU A;  1PJT A;  2E1M A;  5FLX C;  2EP3 A;  4DV2 E;  3VYX A;  4KHP E;  3THO B;  2EWL A;  2A25 A;  2JWO A;  4HEI A;  5LLQ A;  4R2R A;  4JYA E;  2HC5 A;  1WJP A;  4LF5 E;  2DMI A;  3BGH A;  5DNY A;  2EMC A;  2EM5 A;  3T1H E;  2E72 A;  4HTG A;  2ENH A;  1XMQ E;  5IWA E;  5AE2 A;  2EPC A;  1WHQ A;  3BBG A;  2EL5 A;  2JP9 A;  3T1Y E;  4M0V A;  1IQO A;  1A1I A;  1FKA E;  2DIX A;  2V86 A;  2FTX B;  3LML A;  1B69 A;  3JU0 A;  2LBS B;  4DV0 E;  5A6B D;  1ZBQ A;  5A2Q C;  2JR1 A;  1HNX E;  3K6Q A;  1A1G A;  1IBL E;  2MC5 A;  1X3C A;  2MDG A;  4DKK A;  2EOX A;  1YFH A;  1IQS A;  4B3S E;  3VYY A;  2GPI A;  2EOY A;  1IBK E;  1UN6 B;  2LMZ A;  4TUI A;  2EM4 A;  2UXD E;  2CT1 A;  1RQ0 A;  2EOE A;  4BC7 A;  3HPZ A;  1YSA C;  4Q35 B;  3L00 A;  2EMB A;  3EPJ A;  2GLI A;  4FK5 C;  2EPA A;  2NUG A;  1N36 E;  5KL2 A;  2RS6 A;  4LF6 E;  2Q8U A;  4P78 A;  2LVH A;  1EH8 A;  3EQ1 A;  4B3T E;  2N3G A;  3EPK A;  4DR2 E;  2VQE E;  2LJU A;  2EPK X;  2DSY A;  2VRD A;  4DR7 E;  4WXC A;  1UHZ A;  3BF2 A;  4RH8 A;  2L92 A;  2YT4 A;  1X5W A;  4AQY E;  1ZU1 A;  4BC9 A;  1P47 A;  1ZAA C;  2EM3 A;  2I9I A;  5IXM B;  1BBO A;  4LTY A;  4JI6 E;  2EN6 A;  3ZOQ B;  1XNQ E;  2DMY A;  2K7I A;  3C6K A;  1MGT A;  2ODR D;  1X47 A;  4O5G A;  5CFF E;  2EM8 A;  2CSH A;  4BS9 A;  1T38 A;  1G2F C;  2YTE A;  2DLK A;  2ZM6 E;  4R2P A;  1N33 E;  4R2S A;  1O0W A;  3HQ1 A;  4YY3 E;  4L5N C;  2MKD A;  1TF6 A;  2LV2 A;  2EQ3 A;  3OTO E;  2JOX A;  1ZBT A;  4DUZ E;  4WXD A;  2EMX A;  2J7J A;  1PJQ A;  2R1F A;  3J80 C;  1J5E E;  4R2C A;  1G2D C;  2MKN A;  4R8O A;  2V87 A;  4RHB B;  4LF8 E;  3MSW A;  1A1H A;  2L2K B;  2CTD A;  2F8B A;  2D9H A;  1T39 A;  4R2Q A;  4K0K E;  1BBG A;  4WYQ B;  2ODR C;  4YHH E;  2M4I A;  5KL6 A;  2EOS A;  4R2E A;  2LUP B;  4JI4 E;  2UXB E;  1PDA A;  2L3J A;  2FV4 B;  1L4S A;  2ELY A;  5LMU E;  1PKP A;  2YTP A;  2EOH A;  3LLH A;  1X6F A;  2H36 X;  3EPH A;  1WHN A;  1X6H A;  2FGG A;  4X65 E;  2BB8 A;  2LCE A;  4MLV A;  2UU9 E;  3THN A;  1WRJ A;  1GZ6 A;  2EPM X;  4F9C B;  4ZYH A;  4DV7 E;  4M30 A;  2HGH A;  2EOF A;  2UUA E;  2M7Q A;  1SR9 A;  5A6K A;  1JK1 A;  2JVA A;  3JTZ A;  4DR6 E;  4JI0 E;  3EPL A;  2L33 A;  2YTN A;  5KL5 A;  4NXN E;  2EM9 A;  2LRS A;  4JI2 E;  1F2I G;  2EMH A;  4DV1 E;  2EN4 A;  4DMI A;  2EPZ A;  5T6J A;  3ADJ A;  2KOU A;  1T4O A;  4I8O A;  2KHX A;  2RSM A;  1EKZ A;  2WBS A;  1QU6 A;  4F9B B;  2EN3 A;  2VE7 C;  3AUZ A;  2L3C A;  1XNR E;  4GZN C;  4F6M A;  4DR3 E;  2EMF A;  1LLM C;  2RPC A;  1IMU A;  1N34 E;  4L8N A;  2EPP A;  2CPN A;  2L2N A;  2EMY A;  4ZYG A;  2YPN A;  1TF3 A;  3DJW A;  4X8W A;  4B3M E;  4WFT A;  2MDR A;  1SFE A;  2R76 A;  3HPS A;  2JYA A;  4DR5 E;  1T4N A;  2JOB A;  2EQ1 A;  4M9V C;  2N8X A;  4O4K A;  4F6N A;  3IWD A;  2EMZ A;  3HXL A;  4MLQ A;  3UK3 C;  4F54 A;  2YZT A;  1FJG E;  2NA2 A;  4Q28 A;  4WX9 A;  3C4B A;  1NCS A;  1YUJ A;  4JV5 E;  1DQ3 A;  5BR8 E;  2EPX A;  2B3T B;  1STU A;  1A1L A;  3C4T A;  5KL4 A;  1AAY A;  2EML A;  4LF7 E;  2B7T A;  1YYO A;  2RS7 A;  2YU5 A;  1A1K A;  4LU9 A;  2L6M A;  5AC4 A;  2PRT A;  2V88 A;  4GKJ E;  4N4R B;  5A6J A;  3F6H A;  1KYQ A;  4WSP A;  1IBM E;  2BBG A;  2EJ4 A;  5AE1 A;  2UXC E;  2EN2 A;  2EOR A;  2EL4 A;  3VK6 A;  4JI1 E;  2G7H A;  1X6E A;  2EN8 A;  2DB2 A;  2YTG A;  2YTJ A;  4LFC E;  4DR4 E;  3OML A;  4OX9 E;  4J8Z A;  4WPY A;  2YTF A;  2MC6 A;  4LFB E;  2EMA A;  2VQF E;  4NHR A;  4JI7 E;  2EPL X;  2ADR A;  2V83 A;  2KON A;  4O24 A;  3F6G A;  2LO3 A;  2RQL A;  1N3G A;  2YWQ A;  3IWC A;  1RMD A;  4IS1 C;  4JI8 E;  3KZY A;  1XMO E;  3ADI A;  4R2D A;  2JPA A;  2LTS A;  2LUQ A;  2YTQ A;  3J81 C;  5AC5 A;  4DR1 E;  2EOJ A;  1TN9 A;  4DV3 E;  2DRP A;  3KWR A;  1YPN A;  3TQM A;  5A69 A;  3M99 B;  2LE2 A;  5A6B A;  4DV6 E;  2ELZ A;  1UIL A; 
#chains in the Genus database with same CATH homology
 2GPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...