2GPIA

Crystal structure of a protein of unknown function from duf1488 family (shew_3726) from shewanella loihica pv-4 at 1.60 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
GMNQSIIFTEQLTWDVQLSAIHFTAQQQGMVIDCYIGQKVLEHLAAEKINNSEQALSLFEQFRFDIEEQAEKLIEQEAFDVQGHIQVERVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal structure of conserved hypothetical protein (ZP_00837230.1) from Shewanella sp. PV-4 at 1.60 A resolution
rcsb
source organism Shewanella loihica
molecule tags Unknown function
total genus 24
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07369 DUF1488 Protein of unknown function (DUF1488)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.140 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Shew3726-like 2gpiA00
2GPIA
chains in the Genus database with same CATH superfamily
2JR1A 3ECRA 3BBGA 2A25A 2YTDA 2DLKA 2YTNA 4R2PA 1GQEA 1MGTA 1X6EA 2EWLA 2YTJA 1YZ9A 2VRDA 1PDAA 4Q35B 1EH6A 2K4VA 2YTPA 2MC6A 2HJJA 1HNZE 2DMIA 2L2KB 1XMQE 3JTZA 4DV5E 4R2SA 1SFEA 2JY9A 2DSYA 4DR6E 1JK1A 1X49A 4OX9E 4F9BB 4LF7E 2L3JA 5IT9C 2KONA 2ODRD 4DV7E 1YYOA 2CT1A 2EOSA 1T4LB 1NEIA 1DI2A 1B69A 4DV4E 2ENAA 3HXLA 2NA2A 4O4KA 2EM0A 2DGCA 2E72A 2YSPA 1IBME 2EOOA 4F9CB 3C6KA 4ZYEA 1P47A 1F2IG 3J7AG 4RH8A 4BC9A 2EN8A 1RC7A 3VHTB 2YZTA 1YSAC 4TUGA 2EMZA 1UHZA 3OMLA 3TQMA 4X8WA 2F8BA 1HNWE 1X5WA 2M1SA 2EPXA 1ZR9A 1N32E 1YYKA 2V8QB 4WXDA 2YTIA 4B3SE 3ADGA 2LE2A 3EPLA 2LO3A 2GHFA 1Z1BA 2YSOA 2YTQA 3AV0A 3P1XA 3LMLA 2EOIA 1RQ0A 2ENCA 4NHRA 2H36X 2G7HA 4B3ME 2EM2A 4DR5E 5KL7A 1UILA 1A1KA 2UXCE 1TF3A 4FK5C 3F6GA 5T6JA 1A1JA 4K0KE 4GKJE 1I94E 4WFTA 4DV1E 1YPNA 4MLVA 4F9AB 2EN3A 2M4IA 5BR8E 4B3TE 4JI2E 5A6KA 3ADLA 4BS9A 1BBGA 2L3CA 2YU5A 1HNXE 3EPJA 4I8OA 4BMJA 1FJGE 4IS1C 4R8OA 3KWRA 4LFAE 1XNRE 2B7VA 1GZ6A 2ADRA 5KL4A 2L92A 2L33A 2EMGA 5LLQA 2EPPA 2RPCA 5LMNE 1PJQA 2LV2A 2YTEA 1N33E 1EH7A 2N3HA 5A6BA 2JOXA 4X65E 4P78A 2YPNA 2YTGA 2ZM6E 5A69A 4R03A 2L6MA 1L4SA 2EM5A 2B3TB 1JK2A 2EL4A 1QU6A 1T38A 4DV2E 2EMIA 2JXPA 2EM3A 3RMPA 2EN7A 4R2QA 1X48A 1ZAAC 1XMOE 4DUZE 2GPIA 5IWAE 1A1FA 3M99B 2WBUA 2UXDE 5FLXC 4BCAA 2CTDA 4R2EA 2LJHA 4MLQA 2D9HA 4X9JA 1IMUA 2M7QA 3T1YE 2Q8UA 3BF2A 1ZBTA 2EOJA 5AASA 3KZYA 1GTKA 1LLMC 1N34E 2EMHA 1WJPA 4X66E 2I13A 4O43A 5LMUE 2EJ4A 5KL5A 2N3GA 4LF4E 4NXNE 1O0WA 1EKZA 3K6QA 3JAMC 4AQYE 4GKKE 4L5NC 4ZYHA 2EMLA 2LJUA 5LL6R 2KHXA 2LUPB 2J7JA 4P7DA 2VQEE 3IWBA 5ADZA 4DV0E 2FTXB 3IWCA 1A1IA 2VE7C 2JP9A 2RTXA 3KZZA 4JI3E 4TUIA 1KYQA 4HTGA 1DQ3A 3THNA 2LUQA 4JI5E 3C6MA 2B9DA 4LFCE 2V83A 4F2JC 2WZOA 4BBYA 2L2NA 4Q28A 1IBKE 1WHNA 1UBDC 1AAYA 2EQ0A 3MHSC 2V85A 1J5EE 2V86A 3VYYA 2WBSA 1SR9A 2NUFA 4LFBE 4GZNC 3HPSA 3JU0A 2EOEA 3IWDA 5AE2A 2LCEA 4LTYA 2EPMX 4DKKA 1XNQE 2EPRA 3DF6A 2EM9A 4JI8E 3BIDA 1ZBQA 4L8NA 1QNTA 4O24A 3HPZA 2UUCE 4N4RB 2LMZA 4B3RE 4NZVA 2EE8A 4LF9E 1YUIA 4M9VC 2EOQA 4LF8E 2IHR1 1WXRA 2EMFA 1BBOA 1WRJA 2LRSA 2YTFA 4WXCA 4DV3E 5KL6A 4BHCA 2B7TA 2YRKA 3ADJA 4X62E 2EOFA 1PJSA 2EM7A 4JV5E 3FIGA 4YY3E 1AH5A 2ENHA 4DR3E 4OOGC 5IV8B 2CPNA 2ELYA 1PKPA 2LBSB 4WYQB 2UXBE 5KL2A 2YWQA 5DNYA 3AUZA 4DV6E 2GLIA 2JOBA 5A6JA 1T4NA 3C4BA 4F6NA 3MSWA 4F6MA 3DJWA 2MC5A 2JYAA 1BB8A 1A1GA 3BGHA 2JPAA 2YU8A 1A1HA 4ZYGA 4LF5E 3VK6A 2V89A 2EPUA 2EPAA 4DR1E 2EN6A 1ZU1A 2YT4A 2MDRA 2LTRA 4JI4E 2R1FA 1IBLE 2V88A 4HEIA 3J7Yp 1HR0E 2EPOA 2EPNA 4J8ZA 2EPKX 5AE3A 2VF1A 5CFFE 2UU9E 2BBGA 2LT7A 2HHHE 5AC5A 1N3GA 2F4VE 2NUEA 2R76A 1DGCA 5AC4A 2EL6A 4R2CA 2FV4B 2YRHA 4O5GA 5TSEA 4LU9A 1TF6A 2EMBA 4IJDA 3VYXA 1N36E 3EQ1A 2EMYA 4DR2E 3EPHA 3THOB 1FKAE 4WSPA 4ZYDA 4DMIA 1X3CA 1T39A 2EM8A 2EN2A 2EM6A 1TN9A 4F54A 5A2QC 2L2MA 2DLQA 2WBTA 2NUGA 2UUBE 2RS7A 2E1MA 2I9IA 5AE1A 2EMXA 1T4OA 2EMWA 2EOZA 4R2AA 2M9AA 3C4TA 5F3WA 2DIXA 2ELZA 4JI7E 4WSGA 2NABA 4LF6E 2EM4A 1X6FA 1G2DC 2L8TA 2E5LE 4M0VA 5A6BD 1J26A 4YHHE 2DRPA 4JYAE 2MKNA 1EH8A 1G2FC 2EL5A 4BC7A 2V87A 2EPZA 2EORA 1YFHA 1IQSA 2ODRC 2RSIA 1YYWA 2HC5A 2WCC3 2EPLX 1IQOA 4KWYA 1STUA 4WX9A 2N8XA 4DR7E 2EOYA 2DB2A 1PJTA 2YTOA 4R2RA 2EQ1A 2YRMA 3LLHA 2EPCA 2K7IA 3H09A 1KJKA 2EMKA 5KL3A 3OTOE 3HTXA 1YUJA 4JI6E 4M2ZA 2CSHA 1X47A 4KHPE 2MDGA 3L00A 3ZOQB 4DUYE 1X6HA 5IXMB 5A6AA 2EN4A 2LVHA 2RSMA 2EN1A 3HQ1A 3MHHC 2EMAA 2JVAA 2EZ6A 2MKDA 4WPYA 2EP3A 3J81C 2BB8A 2EOXA 4R2DA 4KZSA 2HGHA 2DMYA 2KOUA 2UUAE 2PRTA 2RS6A 2FGGA 2RQLA 4X64E 4JI0E 3EPKA 2VQFE 3QG5C 1RMDA 3UK3C 4M30A 2EOMA 2EQ3A 4DR4E 2LTSA 2JWOA 3F6HA 4BHBA 1MEYC 3J80C 1UN6B 1NCSA 4GEQB 4RHBB 3T1HE 1A1LA 4JI1E 3ADIA 4NXME 2EOHA 2EMCA 1WHQA
chains in the Genus database with same CATH topology
2GPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GPI A; 
#chains in the Genus database with same CATH topology
 2JR1 A;  3ECR A;  3BBG A;  2A25 A;  2YTD A;  2DLK A;  2YTN A;  4R2P A;  1GQE A;  1MGT A;  1X6E A;  2EWL A;  2YTJ A;  1YZ9 A;  2VRD A;  1PDA A;  4Q35 B;  1EH6 A;  2K4V A;  2YTP A;  2MC6 A;  2HJJ A;  1HNZ E;  2DMI A;  2L2K B;  1XMQ E;  3JTZ A;  4DV5 E;  4R2S A;  1SFE A;  2JY9 A;  2DSY A;  4DR6 E;  1JK1 A;  1X49 A;  4OX9 E;  4F9B B;  4LF7 E;  2L3J A;  5IT9 C;  2KON A;  2ODR D;  4DV7 E;  1YYO A;  2CT1 A;  2EOS A;  1T4L B;  1NEI A;  1DI2 A;  1B69 A;  4DV4 E;  2ENA A;  3HXL A;  2NA2 A;  4O4K A;  2EM0 A;  2DGC A;  2E72 A;  2YSP A;  1IBM E;  2EOO A;  4F9C B;  3C6K A;  4ZYE A;  1P47 A;  1F2I G;  3J7A G;  4RH8 A;  4BC9 A;  2EN8 A;  1RC7 A;  3VHT B;  2YZT A;  1YSA C;  4TUG A;  2EMZ A;  1UHZ A;  3OML A;  3TQM A;  4X8W A;  2F8B A;  1HNW E;  1X5W A;  2M1S A;  2EPX A;  1ZR9 A;  1N32 E;  1YYK A;  2V8Q B;  4WXD A;  2YTI A;  4B3S E;  3ADG A;  2LE2 A;  3EPL A;  2LO3 A;  2GHF A;  1Z1B A;  2YSO A;  2YTQ A;  3AV0 A;  3P1X A;  3LML A;  2EOI A;  1RQ0 A;  2ENC A;  4NHR A;  2H36 X;  2G7H A;  4B3M E;  2EM2 A;  4DR5 E;  5KL7 A;  1UIL A;  1A1K A;  2UXC E;  1TF3 A;  4FK5 C;  3F6G A;  5T6J A;  1A1J A;  4K0K E;  4GKJ E;  1I94 E;  4WFT A;  4DV1 E;  1YPN A;  4MLV A;  4F9A B;  2EN3 A;  2M4I A;  5BR8 E;  4B3T E;  4JI2 E;  5A6K A;  3ADL A;  4BS9 A;  1BBG A;  2L3C A;  2YU5 A;  1HNX E;  3EPJ A;  4I8O A;  4BMJ A;  1FJG E;  4IS1 C;  4R8O A;  3KWR A;  4LFA E;  1XNR E;  2B7V A;  1GZ6 A;  2ADR A;  5KL4 A;  2L92 A;  2L33 A;  2EMG A;  5LLQ A;  2EPP A;  2RPC A;  5LMN E;  1PJQ A;  2LV2 A;  2YTE A;  1N33 E;  1EH7 A;  2N3H A;  5A6B A;  2JOX A;  4X65 E;  4P78 A;  2YPN A;  2YTG A;  2ZM6 E;  5A69 A;  4R03 A;  2L6M A;  1L4S A;  2EM5 A;  2B3T B;  1JK2 A;  2EL4 A;  1QU6 A;  1T38 A;  4DV2 E;  2EMI A;  2JXP A;  2EM3 A;  3RMP A;  2EN7 A;  4R2Q A;  1X48 A;  1ZAA C;  1XMO E;  4DUZ E;  2GPI A;  5IWA E;  1A1F A;  3M99 B;  2WBU A;  2UXD E;  5FLX C;  4BCA A;  2CTD A;  4R2E A;  2LJH A;  4MLQ A;  2D9H A;  4X9J A;  1IMU A;  2M7Q A;  3T1Y E;  2Q8U A;  3BF2 A;  1ZBT A;  2EOJ A;  5AAS A;  3KZY A;  1GTK A;  1LLM C;  1N34 E;  2EMH A;  1WJP A;  4X66 E;  2I13 A;  4O43 A;  5LMU E;  2EJ4 A;  5KL5 A;  2N3G A;  4LF4 E;  4NXN E;  1O0W A;  1EKZ A;  3K6Q A;  3JAM C;  4AQY E;  4GKK E;  4L5N C;  4ZYH A;  2EML A;  2LJU A;  5LL6 R;  2KHX A;  2LUP B;  2J7J A;  4P7D A;  2VQE E;  3IWB A;  5ADZ A;  4DV0 E;  2FTX B;  3IWC A;  1A1I A;  2VE7 C;  2JP9 A;  2RTX A;  3KZZ A;  4JI3 E;  4TUI A;  1KYQ A;  4HTG A;  1DQ3 A;  3THN A;  2LUQ A;  4JI5 E;  3C6M A;  2B9D A;  4LFC E;  2V83 A;  4F2J C;  2WZO A;  4BBY A;  2L2N A;  4Q28 A;  1IBK E;  1WHN A;  1UBD C;  1AAY A;  2EQ0 A;  3MHS C;  2V85 A;  1J5E E;  2V86 A;  3VYY A;  2WBS A;  1SR9 A;  2NUF A;  4LFB E;  4GZN C;  3HPS A;  3JU0 A;  2EOE A;  3IWD A;  5AE2 A;  2LCE A;  4LTY A;  2EPM X;  4DKK A;  1XNQ E;  2EPR A;  3DF6 A;  2EM9 A;  4JI8 E;  3BID A;  1ZBQ A;  4L8N A;  1QNT A;  4O24 A;  3HPZ A;  2UUC E;  4N4R B;  2LMZ A;  4B3R E;  4NZV A;  2EE8 A;  4LF9 E;  1YUI A;  4M9V C;  2EOQ A;  4LF8 E;  2IHR 1;  1WXR A;  2EMF A;  1BBO A;  1WRJ A;  2LRS A;  2YTF A;  4WXC A;  4DV3 E;  5KL6 A;  4BHC A;  2B7T A;  2YRK A;  3ADJ A;  4X62 E;  2EOF A;  1PJS A;  2EM7 A;  4JV5 E;  3FIG A;  4YY3 E;  1AH5 A;  2ENH A;  4DR3 E;  4OOG C;  5IV8 B;  2CPN A;  2ELY A;  1PKP A;  2LBS B;  4WYQ B;  2UXB E;  5KL2 A;  2YWQ A;  5DNY A;  3AUZ A;  4DV6 E;  2GLI A;  2JOB A;  5A6J A;  1T4N A;  3C4B A;  4F6N A;  3MSW A;  4F6M A;  3DJW A;  2MC5 A;  2JYA A;  1BB8 A;  1A1G A;  3BGH A;  2JPA A;  2YU8 A;  1A1H A;  4ZYG A;  4LF5 E;  3VK6 A;  2V89 A;  2EPU A;  2EPA A;  4DR1 E;  2EN6 A;  1ZU1 A;  2YT4 A;  2MDR A;  2LTR A;  4JI4 E;  2R1F A;  1IBL E;  2V88 A;  4HEI A;  3J7Y p;  1HR0 E;  2EPO A;  2EPN A;  4J8Z A;  2EPK X;  5AE3 A;  2VF1 A;  5CFF E;  2UU9 E;  2BBG A;  2LT7 A;  2HHH E;  5AC5 A;  1N3G A;  2F4V E;  2NUE A;  2R76 A;  1DGC A;  5AC4 A;  2EL6 A;  4R2C A;  2FV4 B;  2YRH A;  4O5G A;  5TSE A;  4LU9 A;  1TF6 A;  2EMB A;  4IJD A;  3VYX A;  1N36 E;  3EQ1 A;  2EMY A;  4DR2 E;  3EPH A;  3THO B;  1FKA E;  4WSP A;  4ZYD A;  4DMI A;  1X3C A;  1T39 A;  2EM8 A;  2EN2 A;  2EM6 A;  1TN9 A;  4F54 A;  5A2Q C;  2L2M A;  2DLQ A;  2WBT A;  2NUG A;  2UUB E;  2RS7 A;  2E1M A;  2I9I A;  5AE1 A;  2EMX A;  1T4O A;  2EMW A;  2EOZ A;  4R2A A;  2M9A A;  3C4T A;  5F3W A;  2DIX A;  2ELZ A;  4JI7 E;  4WSG A;  2NAB A;  4LF6 E;  2EM4 A;  1X6F A;  1G2D C;  2L8T A;  2E5L E;  4M0V A;  5A6B D;  1J26 A;  4YHH E;  2DRP A;  4JYA E;  2MKN A;  1EH8 A;  1G2F C;  2EL5 A;  4BC7 A;  2V87 A;  2EPZ A;  2EOR A;  1YFH A;  1IQS A;  2ODR C;  2RSI A;  1YYW A;  2HC5 A;  2WCC 3;  2EPL X;  1IQO A;  4KWY A;  1STU A;  4WX9 A;  2N8X A;  4DR7 E;  2EOY A;  2DB2 A;  1PJT A;  2YTO A;  4R2R A;  2EQ1 A;  2YRM A;  3LLH A;  2EPC A;  2K7I A;  3H09 A;  1KJK A;  2EMK A;  5KL3 A;  3OTO E;  3HTX A;  1YUJ A;  4JI6 E;  4M2Z A;  2CSH A;  1X47 A;  4KHP E;  2MDG A;  3L00 A;  3ZOQ B;  4DUY E;  1X6H A;  5IXM B;  5A6A A;  2EN4 A;  2LVH A;  2RSM A;  2EN1 A;  3HQ1 A;  3MHH C;  2EMA A;  2JVA A;  2EZ6 A;  2MKD A;  4WPY A;  2EP3 A;  3J81 C;  2BB8 A;  2EOX A;  4R2D A;  4KZS A;  2HGH A;  2DMY A;  2KOU A;  2UUA E;  2PRT A;  2RS6 A;  2FGG A;  2RQL A;  4X64 E;  4JI0 E;  3EPK A;  2VQF E;  3QG5 C;  1RMD A;  3UK3 C;  4M30 A;  2EOM A;  2EQ3 A;  4DR4 E;  2LTS A;  2JWO A;  3F6H A;  4BHB A;  1MEY C;  3J80 C;  1UN6 B;  1NCS A;  4GEQ B;  4RHB B;  3T1H E;  1A1L A;  4JI1 E;  3ADI A;  4NXM E;  2EOH A;  2EMC A;  1WHQ A; 
#chains in the Genus database with same CATH homology
 2GPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...