2GPIA

Crystal structure of a protein of unknown function from duf1488 family (shew_3726) from shewanella loihica pv-4 at 1.60 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
GMNQSIIFTEQLTWDVQLSAIHFTAQQQGMVIDCYIGQKVLEHLAAEKINNSEQALSLFEQFRFDIEEQAEKLIEQEAFDVQGHIQVERVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of conserved hypothetical protein (ZP_00837230.1) from Shewanella sp. PV-4 at 1.60 A resolution
rcsb
source organism Shewanella loihica
molecule tags Unknown function
molecule keywords conserved hypothetical protein
total genus 24
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07369 DUF1488 Protein of unknown function (DUF1488)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.140 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Shew3726-like 2gpiA00
2GPIA
chains in the Genus database with same CATH superfamily
1TN9A 4L8NA 2L2NA 4BMJA 2LCEA 2LV2A 2EOIA 5AC5A 1BB8A 1IQSA 2L33A 1G2FC 2F4VE 2YT4A 3THNA 1PJTA 2RSMA 4ZYGA 1F2IG 2V88A 5DNYA 5KL4A 1EH7A 2EPXA 4KWYA 2LTRA 4DR1E 4WSPA 5IT9C 2YSOA 2DMIA 2B3TB 2LJUA 4MLQA 4GKKE 4BBYA 2EN6A 4WXDA 2EPKX 2G7HA 1IMUA 2UUCE 2DMYA 2ADRA 2CTDA 2EMCA 4HTGA 4DUYE 3EPJA 1QNTA 2EM0A 1YYOA 2LUQA 4MLVA 1T4NA 3JAMC 2L2KB 2EMIA 3MHHC 1UILA 2EOSA 1IBKE 4R2QA 4DV7E 1ZU1A 1T39A 2E5LE 1A1GA 2M7QA 2UXBE 2MKDA 2YTQA 1UN6B 1PJQA 4JI8E 2WZOA 4F6MA 2EL4A 2H36X 2EPAA 4X9JA 2JYAA 5AE1A 2DLQA 1N3GA 2ELZA 4R03A 2HC5A 4DMIA 1T4LB 4DV2E 4JI1E 4OX9E 4X65E 2YSPA 3ECRA 3C4TA 3HPZA 2YPNA 4NHRA 4F2JC 4DR5E 3K6QA 1RC7A 3J7Yp 2EOYA 3QG5C 2K4VA 3OTOE 2EMZA 1N34E 2NABA 4B3TE 2YTGA 4B3SE 2EOZA 1YYWA 2EM6A 2N8XA 2V89A 3RMPA 4F9AB 4DV5E 2DGCA 1SR9A 2EPZA 5F3WA 2HHHE 2L6MA 2EOOA 1WHNA 3L00A 1JK2A 5IWAE 1HNWE 3J80C 1WXRA 4JI3E 2MC5A 4DV6E 3C4BA 1NEIA 4LF9E 1STUA 3P1XA 2LMZA 5A69A 4R2RA 4DV1E 4BC7A 4BHCA 2ELYA 5A6KA 2LBSB 2JXPA 2EPCA 3T1YE 4GZNC 1KJKA 2NUFA 2M1SA 4Q28A 3BIDA 2GHFA 1IQOA 3ZOQB 2EMXA 1A1FA 2ODRC 2EN7A 3LLHA 3KZYA 2I13A 1T4OA 4TUGA 2KONA 4R2CA 1I94E 2EPRA 2A25A 2N3GA 5FLXC 5IV8B 2EM9A 5KL6A 4O5GA 3MSWA 2EQ0A 2MDRA 4WSGA 4O4KA 2EN8A 2DIXA 2ENCA 1X6FA 1DI2A 1QU6A 2B7VA 4NZVA 4BC9A 5KL7A 2ENAA 1ZBTA 1N32E 2B7TA 1N36E 3ADLA 2RSIA 1XMOE 2V85A 4IJDA 1MGTA 2RPCA 1PDAA 2L8TA 2YTDA 2KHXA 2EM3A 4WXCA 2V83A 5LLQA 3KZZA 4BHBA 2EZ6A 2NUEA 2JPAA 5KL2A 3EPKA 4GKJE 2YRKA 2YU8A 4F9CB 4X62E 4DV0E 2EN3A 2EN4A 1BBGA 2VQEE 4I8OA 4YHHE 4K0KE 1YUIA 4F54A 2LUPB 2VRDA 4ZYHA 4DV3E 2RS7A 2BBGA 1XNRE 2LT7A 5LMNE 2EORA 5CFFE 2NUGA 2V87A 5A6AA 2RTXA 1BBOA 1PKPA 2EE8A 5A2QC 2GPIA 2RQLA 2L2MA 2CPNA 2B9DA 2MKNA 4DR4E 2YU5A 2EOHA 2WBUA 2WCC3 2EMLA 1B69A 4Q35B 2EN2A 2L3JA 3C6KA 4JV5E 4JYAE 1N33E 2I9IA 2BB8A 2CSHA 4IS1C 4LTYA 4X64E 2JY9A 1WRJA 2HJJA 4O24A 2EMFA 1A1KA 2D9HA 4P78A 2LE2A 3VK6A 4R2AA 1JK1A 2R76A 4B3ME 4TUIA 2YTFA 2IHR1 3HTXA 3AUZA 3IWDA 1A1IA 3BBGA 5IXMB 2LTSA 4X8WA 1P47A 4NXME 3HPSA 4F9BB 4M30A 3FIGA 3EQ1A 1DQ3A 1GTKA 4LFBE 4LF7E 1NCSA 1IBLE 3F6HA 5KL3A 1IBME 2EMKA 2DB2A 1A1JA 3DF6A 2UU9E 1X6EA 2WBSA 4N4RB 1A1LA 1EKZA 3J7AG 2YTNA 2EPNA 5A6JA 2KOUA 2PRTA 4DR2E 1FJGE 2EM4A 2JWOA 2JP9A 2EOJA 1ZAAC 4B3RE 2DLKA 2EOEA 2R1FA 2F8BA 4M2ZA 4LF5E 3T1HE 2EOQA 1X3CA 2YTOA 2YZTA 4WPYA 3MHSC 2HGHA 3F6GA 3ADJA 2DRPA 1HNXE 2RS6A 2EMAA 1KYQA 4DUZE 4HEIA 5AE3A 3IWBA 1X6HA 2E1MA 4R2PA 2FV4B 2EWLA 1J5EE 3AV0A 2L3CA 4JI0E 4DR6E 5LMUE 4KHPE 4BS9A 2ZM6E 1LLMC 1J26A 1YYKA 1AAYA 2J7JA 1DGCA 2V8QB 2LRSA 1WHQA 3JTZA 1YSAC 1YFHA 2EM5A 4AQYE 2EPLX 5AE2A 2M4IA 2VF1A 1T38A 5AC4A 4JI4E 2E72A 4P7DA 1TF6A 3J81C 2NA2A 5ADZA 2EM2A 2EMWA 1SFEA 4LF6E 5KL5A 1XMQE 2EJ4A 1TF3A 3BGHA 2EMBA 1GZ6A 4WFTA 5LL6R 1X47A 2EQ3A 1YZ9A 4DR7E 2V86A 2EPOA 2EMHA 2ENHA 4J8ZA 2JOXA 2MC6A 3JU0A 2EOXA 1FKAE 2YRMA 1A1HA 4X66E 5A6BA 4ZYEA 4OOGC 2LVHA 3M99B 2JR1A 4GEQB 4LF4E 2EPPA 4RH8A 4LFAE 3EPLA 4JI5E 3H09A 4R2SA 2EP3A 2K7IA 2YTEA 4WX9A 2ODRD 2YRHA 2VQFE 2EMGA 1PJSA 1X48A 2LO3A 1X5WA 2JOBA 4NXNE 2EN1A 2EOMA 3OMLA 4JI2E 5T6JA 5A6BD 1WJPA 3ADIA 2LJHA 1XNQE 1ZBQA 3THOB 2JVAA 4JI6E 5AASA 2UXCE 2FGGA 2VE7C 5TSEA 2L92A 2GLIA 1MEYC 4JI7E 4LU9A 1UBDC 1RQ0A 1O0WA 2YTPA 2EL6A 3BF2A 1EH8A 2EM7A 3C6MA 2YWQA 4F6NA 4LFCE 3VYYA 1EH6A 2M9AA 4M0VA 2YTJA 3UK3C 1YPNA 1ZR9A 4R2DA 4R8OA 3KWRA 3VYXA 3LMLA 2DSYA 4DKKA 1HR0E 4LF8E 5BR8E 4BCAA 3TQMA 4R2EA 2UUAE 2EMYA 1L4SA 4DR3E 2EL5A 2WBTA 1G2DC 1RMDA 2YTIA 4DV4E 1Z1BA 2EPMX 4RHBB 2Q8UA 2CT1A 2EPUA 1YUJA 4WYQB 4FK5C 4L5NC 4M9VC 4YY3E 2N3HA 4KZSA 2UXDE 4O43A 1GQEA 2FTXB 4ZYDA 1HNZE 2EQ1A 2EOFA 1X49A 2MDGA 3ADGA 2UUBE 3HXLA 3HQ1A 3IWCA 1UHZA 3EPHA 1AH5A 3DJWA 3VHTB 2EM8A
chains in the Genus database with same CATH topology
2GPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GPI A; 
#chains in the Genus database with same CATH topology
 1TN9 A;  4L8N A;  2L2N A;  4BMJ A;  2LCE A;  2LV2 A;  2EOI A;  5AC5 A;  1BB8 A;  1IQS A;  2L33 A;  1G2F C;  2F4V E;  2YT4 A;  3THN A;  1PJT A;  2RSM A;  4ZYG A;  1F2I G;  2V88 A;  5DNY A;  5KL4 A;  1EH7 A;  2EPX A;  4KWY A;  2LTR A;  4DR1 E;  4WSP A;  5IT9 C;  2YSO A;  2DMI A;  2B3T B;  2LJU A;  4MLQ A;  4GKK E;  4BBY A;  2EN6 A;  4WXD A;  2EPK X;  2G7H A;  1IMU A;  2UUC E;  2DMY A;  2ADR A;  2CTD A;  2EMC A;  4HTG A;  4DUY E;  3EPJ A;  1QNT A;  2EM0 A;  1YYO A;  2LUQ A;  4MLV A;  1T4N A;  3JAM C;  2L2K B;  2EMI A;  3MHH C;  1UIL A;  2EOS A;  1IBK E;  4R2Q A;  4DV7 E;  1ZU1 A;  1T39 A;  2E5L E;  1A1G A;  2M7Q A;  2UXB E;  2MKD A;  2YTQ A;  1UN6 B;  1PJQ A;  4JI8 E;  2WZO A;  4F6M A;  2EL4 A;  2H36 X;  2EPA A;  4X9J A;  2JYA A;  5AE1 A;  2DLQ A;  1N3G A;  2ELZ A;  4R03 A;  2HC5 A;  4DMI A;  1T4L B;  4DV2 E;  4JI1 E;  4OX9 E;  4X65 E;  2YSP A;  3ECR A;  3C4T A;  3HPZ A;  2YPN A;  4NHR A;  4F2J C;  4DR5 E;  3K6Q A;  1RC7 A;  3J7Y p;  2EOY A;  3QG5 C;  2K4V A;  3OTO E;  2EMZ A;  1N34 E;  2NAB A;  4B3T E;  2YTG A;  4B3S E;  2EOZ A;  1YYW A;  2EM6 A;  2N8X A;  2V89 A;  3RMP A;  4F9A B;  4DV5 E;  2DGC A;  1SR9 A;  2EPZ A;  5F3W A;  2HHH E;  2L6M A;  2EOO A;  1WHN A;  3L00 A;  1JK2 A;  5IWA E;  1HNW E;  3J80 C;  1WXR A;  4JI3 E;  2MC5 A;  4DV6 E;  3C4B A;  1NEI A;  4LF9 E;  1STU A;  3P1X A;  2LMZ A;  5A69 A;  4R2R A;  4DV1 E;  4BC7 A;  4BHC A;  2ELY A;  5A6K A;  2LBS B;  2JXP A;  2EPC A;  3T1Y E;  4GZN C;  1KJK A;  2NUF A;  2M1S A;  4Q28 A;  3BID A;  2GHF A;  1IQO A;  3ZOQ B;  2EMX A;  1A1F A;  2ODR C;  2EN7 A;  3LLH A;  3KZY A;  2I13 A;  1T4O A;  4TUG A;  2KON A;  4R2C A;  1I94 E;  2EPR A;  2A25 A;  2N3G A;  5FLX C;  5IV8 B;  2EM9 A;  5KL6 A;  4O5G A;  3MSW A;  2EQ0 A;  2MDR A;  4WSG A;  4O4K A;  2EN8 A;  2DIX A;  2ENC A;  1X6F A;  1DI2 A;  1QU6 A;  2B7V A;  4NZV A;  4BC9 A;  5KL7 A;  2ENA A;  1ZBT A;  1N32 E;  2B7T A;  1N36 E;  3ADL A;  2RSI A;  1XMO E;  2V85 A;  4IJD A;  1MGT A;  2RPC A;  1PDA A;  2L8T A;  2YTD A;  2KHX A;  2EM3 A;  4WXC A;  2V83 A;  5LLQ A;  3KZZ A;  4BHB A;  2EZ6 A;  2NUE A;  2JPA A;  5KL2 A;  3EPK A;  4GKJ E;  2YRK A;  2YU8 A;  4F9C B;  4X62 E;  4DV0 E;  2EN3 A;  2EN4 A;  1BBG A;  2VQE E;  4I8O A;  4YHH E;  4K0K E;  1YUI A;  4F54 A;  2LUP B;  2VRD A;  4ZYH A;  4DV3 E;  2RS7 A;  2BBG A;  1XNR E;  2LT7 A;  5LMN E;  2EOR A;  5CFF E;  2NUG A;  2V87 A;  5A6A A;  2RTX A;  1BBO A;  1PKP A;  2EE8 A;  5A2Q C;  2GPI A;  2RQL A;  2L2M A;  2CPN A;  2B9D A;  2MKN A;  4DR4 E;  2YU5 A;  2EOH A;  2WBU A;  2WCC 3;  2EML A;  1B69 A;  4Q35 B;  2EN2 A;  2L3J A;  3C6K A;  4JV5 E;  4JYA E;  1N33 E;  2I9I A;  2BB8 A;  2CSH A;  4IS1 C;  4LTY A;  4X64 E;  2JY9 A;  1WRJ A;  2HJJ A;  4O24 A;  2EMF A;  1A1K A;  2D9H A;  4P78 A;  2LE2 A;  3VK6 A;  4R2A A;  1JK1 A;  2R76 A;  4B3M E;  4TUI A;  2YTF A;  2IHR 1;  3HTX A;  3AUZ A;  3IWD A;  1A1I A;  3BBG A;  5IXM B;  2LTS A;  4X8W A;  1P47 A;  4NXM E;  3HPS A;  4F9B B;  4M30 A;  3FIG A;  3EQ1 A;  1DQ3 A;  1GTK A;  4LFB E;  4LF7 E;  1NCS A;  1IBL E;  3F6H A;  5KL3 A;  1IBM E;  2EMK A;  2DB2 A;  1A1J A;  3DF6 A;  2UU9 E;  1X6E A;  2WBS A;  4N4R B;  1A1L A;  1EKZ A;  3J7A G;  2YTN A;  2EPN A;  5A6J A;  2KOU A;  2PRT A;  4DR2 E;  1FJG E;  2EM4 A;  2JWO A;  2JP9 A;  2EOJ A;  1ZAA C;  4B3R E;  2DLK A;  2EOE A;  2R1F A;  2F8B A;  4M2Z A;  4LF5 E;  3T1H E;  2EOQ A;  1X3C A;  2YTO A;  2YZT A;  4WPY A;  3MHS C;  2HGH A;  3F6G A;  3ADJ A;  2DRP A;  1HNX E;  2RS6 A;  2EMA A;  1KYQ A;  4DUZ E;  4HEI A;  5AE3 A;  3IWB A;  1X6H A;  2E1M A;  4R2P A;  2FV4 B;  2EWL A;  1J5E E;  3AV0 A;  2L3C A;  4JI0 E;  4DR6 E;  5LMU E;  4KHP E;  4BS9 A;  2ZM6 E;  1LLM C;  1J26 A;  1YYK A;  1AAY A;  2J7J A;  1DGC A;  2V8Q B;  2LRS A;  1WHQ A;  3JTZ A;  1YSA C;  1YFH A;  2EM5 A;  4AQY E;  2EPL X;  5AE2 A;  2M4I A;  2VF1 A;  1T38 A;  5AC4 A;  4JI4 E;  2E72 A;  4P7D A;  1TF6 A;  3J81 C;  2NA2 A;  5ADZ A;  2EM2 A;  2EMW A;  1SFE A;  4LF6 E;  5KL5 A;  1XMQ E;  2EJ4 A;  1TF3 A;  3BGH A;  2EMB A;  1GZ6 A;  4WFT A;  5LL6 R;  1X47 A;  2EQ3 A;  1YZ9 A;  4DR7 E;  2V86 A;  2EPO A;  2EMH A;  2ENH A;  4J8Z A;  2JOX A;  2MC6 A;  3JU0 A;  2EOX A;  1FKA E;  2YRM A;  1A1H A;  4X66 E;  5A6B A;  4ZYE A;  4OOG C;  2LVH A;  3M99 B;  2JR1 A;  4GEQ B;  4LF4 E;  2EPP A;  4RH8 A;  4LFA E;  3EPL A;  4JI5 E;  3H09 A;  4R2S A;  2EP3 A;  2K7I A;  2YTE A;  4WX9 A;  2ODR D;  2YRH A;  2VQF E;  2EMG A;  1PJS A;  1X48 A;  2LO3 A;  1X5W A;  2JOB A;  4NXN E;  2EN1 A;  2EOM A;  3OML A;  4JI2 E;  5T6J A;  5A6B D;  1WJP A;  3ADI A;  2LJH A;  1XNQ E;  1ZBQ A;  3THO B;  2JVA A;  4JI6 E;  5AAS A;  2UXC E;  2FGG A;  2VE7 C;  5TSE A;  2L92 A;  2GLI A;  1MEY C;  4JI7 E;  4LU9 A;  1UBD C;  1RQ0 A;  1O0W A;  2YTP A;  2EL6 A;  3BF2 A;  1EH8 A;  2EM7 A;  3C6M A;  2YWQ A;  4F6N A;  4LFC E;  3VYY A;  1EH6 A;  2M9A A;  4M0V A;  2YTJ A;  3UK3 C;  1YPN A;  1ZR9 A;  4R2D A;  4R8O A;  3KWR A;  3VYX A;  3LML A;  2DSY A;  4DKK A;  1HR0 E;  4LF8 E;  5BR8 E;  4BCA A;  3TQM A;  4R2E A;  2UUA E;  2EMY A;  1L4S A;  4DR3 E;  2EL5 A;  2WBT A;  1G2D C;  1RMD A;  2YTI A;  4DV4 E;  1Z1B A;  2EPM X;  4RHB B;  2Q8U A;  2CT1 A;  2EPU A;  1YUJ A;  4WYQ B;  4FK5 C;  4L5N C;  4M9V C;  4YY3 E;  2N3H A;  4KZS A;  2UXD E;  4O43 A;  1GQE A;  2FTX B;  4ZYD A;  1HNZ E;  2EQ1 A;  2EOF A;  1X49 A;  2MDG A;  3ADG A;  2UUB E;  3HXL A;  3HQ1 A;  3IWC A;  1UHZ A;  3EPH A;  1AH5 A;  3DJW A;  3VHT B;  2EM8 A; 
#chains in the Genus database with same CATH homology
 2GPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...