2GPIA

Crystal structure of a protein of unknown function from duf1488 family (shew_3726) from shewanella loihica pv-4 at 1.60 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
GMNQSIIFTEQLTWDVQLSAIHFTAQQQGMVIDCYIGQKVLEHLAAEKINNSEQALSLFEQFRFDIEEQAEKLIEQEAFDVQGHIQVERVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of conserved hypothetical protein (ZP_00837230.1) from Shewanella sp. PV-4 at 1.60 A resolution
rcsb
source organism Shewanella loihica
molecule tags Unknown function
molecule keywords conserved hypothetical protein
total genus 24
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07369 DUF1488 Protein of unknown function (DUF1488)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.140 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Shew3726-like 2gpiA00
2GPIA
chains in the Genus database with same CATH superfamily
2VRDA 2EPOA 3VYXA 2EOMA 5LL6R 4DV5E 2YTJA 2L2NA 3J7Yp 2YU8A 3FIGA 1XMQE 1IBME 2JOBA 4BC7A 2NUFA 4F9AB 2NUGA 1TF3A 3ADGA 4LF9E 2EM2A 2LO3A 2EM0A 2EOIA 3BF2A 1YPNA 4LFCE 2EM3A 2EPCA 2ODRD 1B69A 4LF6E 3BBGA 4DV4E 3J81C 2FV4B 1IMUA 2WCC3 2ODRC 2EMFA 2EL6A 4WSGA 4BCAA 4JI7E 1MGTA 4M2ZA 3JTZA 1X6FA 2JY9A 4BS9A 4R2SA 5IV8B 3OTOE 2UU9E 2L2MA 2EL5A 2EPUA 1A1LA 5BR8E 1X47A 2VF1A 2YTDA 3C6MA 2VQFE 1JK2A 3ZOQB 4L5NC 2RPCA 4JI4E 2UUAE 2EQ0A 1WHNA 4X8WA 1T4LB 2ELZA 4DR1E 3HQ1A 2LJHA 1UBDC 4ZYEA 4LF8E 4F9BB 2EL4A 4M9VC 2YTEA 2EMZA 3J80C 2UXBE 3EQ1A 2FGGA 2EN3A 4HEIA 5FLXC 3VYYA 2FTXB 2LT7A 2EPAA 1A1FA 4LU9A 4M0VA 4WYQB 4JI0E 2EMIA 4X66E 4R2DA 1YFHA 3JU0A 3TQMA 1DI2A 2D9HA 2B3TB 2EM7A 4BHBA 2EN7A 2K4VA 4MLQA 4LFAE 2EN4A 5KL2A 1X3CA 1YYWA 2DIXA 2EPLX 2YWQA 4ZYDA 1MEYC 2LTRA 4NXNE 2R1FA 2EMHA 4P78A 2EOQA 2V8QB 3KWRA 2EQ3A 4DMIA 4JI3E 1A1KA 5TSEA 2EPRA 2WBSA 1ZR9A 3KZYA 1L4SA 1A1JA 1XNRE 2DLKA 5KL3A 2EOHA 2CTDA 3OMLA 2RSMA 4O24A 4TUIA 2V86A 4F9CB 2KHXA 2ADRA 1T39A 2EN2A 2E1MA 1DQ3A 1EH6A 5ADZA 1QU6A 3KZZA 1FJGE 2EOEA 2LV2A 1F2IG 2EZ6A 2EOYA 4BC9A 2ZM6E 2EOFA 4RH8A 2EE8A 5T6JA 5IWAE 2GPIA 2L33A 4O4KA 5LMNE 1G2DC 5A6KA 2JWOA 3QG5C 1A1HA 2JP9A 4JI2E 2CPNA 2LUPB 2A25A 2UUBE 2JR1A 2EM8A 2EP3A 2JYAA 2M4IA 5LLQA 2J7JA 4I8OA 4GKJE 1NEIA 3VHTB 4F6MA 2V88A 4X62E 2ENAA 1EKZA 2EQ1A 3EPJA 2DMYA 1GTKA 2EPMX 3DJWA 2EM9A 2EOXA 4M30A 5AASA 1HNZE 5AC4A 3EPHA 1NCSA 1PKPA 2YTQA 1T38A 4N4RB 2DGCA 4DV2E 3P1XA 3L00A 2G7HA 4WXDA 2LMZA 1O0WA 4BMJA 3JAMC 1XMOE 2N3HA 2YPNA 2EM4A 2EPZA 2RSIA 2MDGA 4DUYE 4JI5E 2YRMA 3LLHA 4DR7E 4R2EA 4KZSA 2EMCA 3ADJA 1BBOA 3IWBA 1YYOA 2EN6A 1SR9A 5KL6A 2LRSA 4B3ME 2YTGA 4WSPA 2L92A 1PDAA 5LMUE 1GQEA 2LBSB 3ADLA 1KYQA 3THNA 2WBUA 2VQEE 4WXCA 2YT4A 1X48A 3RMPA 3F6GA 4X64E 2VE7C 1HNXE 4IJDA 2HGHA 1WJPA 4OOGC 2L8TA 3LMLA 3C6KA 4NHRA 2UUCE 1UN6B 2R76A 4LFBE 4KWYA 3AUZA 2ENCA 4O43A 1UILA 2JOXA 3ECRA 5AE1A 1I94E 1ZAAC 1PJSA 1WRJA 4LTYA 3THOB 5IXMB 4DV7E 1Z1BA 1RMDA 3M99B 3MHHC 2JXPA 1BBGA 2EPKX 2K7IA 4DR5E 4Q28A 2E72A 2EM6A 2RQLA 3MHSC 4JI6E 1YUJA 1N34E 4YY3E 2DRPA 4DV1E 2EPNA 1KJKA 4ZYGA 3EPLA 4JI8E 1YZ9A 2B9DA 4LF5E 3UK3C 1PJTA 4L8NA 1X5WA 2I13A 4R8OA 4HTGA 4FK5C 2YTFA 4B3SE 5A2QC 2EOJA 3HPZA 4P7DA 4Q35B 4R2PA 1YSAC 2EORA 1JK1A 2EPXA 1BB8A 4DV6E 4WX9A 1IBKE 5AE2A 2YZTA 4NZVA 2L3JA 2EJ4A 2GHFA 2LCEA 1ZU1A 2MKNA 2V85A 2JVAA 2ENHA 2V87A 2WZOA 1N36E 4R03A 4IS1C 4JYAE 2DB2A 3F6HA 4WPYA 2YTPA 3ADIA 2EMWA 1IQOA 1WXRA 2NABA 1GZ6A 2L3CA 1LLMC 2HJJA 2YTNA 1STUA 1P47A 1X6HA 3T1HE 2M7QA 5A69A 1T4NA 1IBLE 2YTOA 4DR3E 4JV5E 3MSWA 1T4OA 3AV0A 5F3WA 3T1YE 2PRTA 4J8ZA 2MC5A 2EMGA 5A6AA 4K0KE 2JPAA 2DMIA 2MKDA 2YTIA 4TUGA 1RQ0A 2EN8A 1X6EA 4DV3E 5KL4A 5KL7A 2EMKA 5A6BD 2EM5A 2KOUA 2E5LE 3HPSA 4WFTA 4JI1E 2YRKA 1SFEA 2YRHA 1PJQA 4R2AA 2EMAA 2WBTA 2RTXA 2L6MA 3C4BA 5CFFE 5A6JA 4F2JC 1UHZA 1A1GA 4BBYA 2EMYA 1YUIA 4F54A 2BBGA 2LE2A 3EPKA 3DF6A 4MLVA 4DUZE 1TN9A 1J26A 2BB8A 1WHQA 4DR2E 1IQSA 4DR4E 3IWDA 4X65E 4B3RE 3BIDA 2M9AA 2L2KB 4LF4E 3VK6A 2UXCE 2NA2A 5KL5A 1DGCA 4RHBB 5A6BA 4LF7E 2HC5A 2CT1A 2EOSA 4R2CA 2YSOA 1TF6A 2EN1A 1RC7A 1HR0E 2HHHE 2EPPA 2EWLA 2YU5A 5IT9C 2ELYA 4ZYHA 1XNQE 5DNYA 2F4VE 2EMXA 2F8BA 2M1SA 2MDRA 5AC5A 2NUEA 4KHPE 1EH8A 1X49A 2EMBA 2MC6A 3H09A 1A1IA 2LJUA 1EH7A 2V83A 1N33E 1AH5A 3HXLA 1N32E 4GKKE 3K6QA 2I9IA 1J5EE 4O5GA 4F6NA 2CSHA 2LUQA 4B3TE 2RS6A 2V89A 2LTSA 2N8XA 4X9JA 1G2FC 2DSYA 3J7AG 1YYKA 2GLIA 4GZNC 2KONA 2B7VA 4AQYE 2EOOA 3C4TA 4DR6E 2H36X 1FKAE 4DKKA 4BHCA 2DLQA 2LVHA 4NXME 2UXDE 3BGHA 4OX9E 2RS7A 4R2QA 4GEQB 2N3GA 5AE3A 1HNWE 1AAYA 2YSPA 4DV0E 1QNTA 1ZBTA 1ZBQA 2B7TA 2Q8UA 2EOZA 2IHR1 1N3GA 3IWCA 2EMLA 4R2RA 3HTXA 4YHHE
chains in the Genus database with same CATH topology
2GPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GPI A; 
#chains in the Genus database with same CATH topology
 2VRD A;  2EPO A;  3VYX A;  2EOM A;  5LL6 R;  4DV5 E;  2YTJ A;  2L2N A;  3J7Y p;  2YU8 A;  3FIG A;  1XMQ E;  1IBM E;  2JOB A;  4BC7 A;  2NUF A;  4F9A B;  2NUG A;  1TF3 A;  3ADG A;  4LF9 E;  2EM2 A;  2LO3 A;  2EM0 A;  2EOI A;  3BF2 A;  1YPN A;  4LFC E;  2EM3 A;  2EPC A;  2ODR D;  1B69 A;  4LF6 E;  3BBG A;  4DV4 E;  3J81 C;  2FV4 B;  1IMU A;  2WCC 3;  2ODR C;  2EMF A;  2EL6 A;  4WSG A;  4BCA A;  4JI7 E;  1MGT A;  4M2Z A;  3JTZ A;  1X6F A;  2JY9 A;  4BS9 A;  4R2S A;  5IV8 B;  3OTO E;  2UU9 E;  2L2M A;  2EL5 A;  2EPU A;  1A1L A;  5BR8 E;  1X47 A;  2VF1 A;  2YTD A;  3C6M A;  2VQF E;  1JK2 A;  3ZOQ B;  4L5N C;  2RPC A;  4JI4 E;  2UUA E;  2EQ0 A;  1WHN A;  4X8W A;  1T4L B;  2ELZ A;  4DR1 E;  3HQ1 A;  2LJH A;  1UBD C;  4ZYE A;  4LF8 E;  4F9B B;  2EL4 A;  4M9V C;  2YTE A;  2EMZ A;  3J80 C;  2UXB E;  3EQ1 A;  2FGG A;  2EN3 A;  4HEI A;  5FLX C;  3VYY A;  2FTX B;  2LT7 A;  2EPA A;  1A1F A;  4LU9 A;  4M0V A;  4WYQ B;  4JI0 E;  2EMI A;  4X66 E;  4R2D A;  1YFH A;  3JU0 A;  3TQM A;  1DI2 A;  2D9H A;  2B3T B;  2EM7 A;  4BHB A;  2EN7 A;  2K4V A;  4MLQ A;  4LFA E;  2EN4 A;  5KL2 A;  1X3C A;  1YYW A;  2DIX A;  2EPL X;  2YWQ A;  4ZYD A;  1MEY C;  2LTR A;  4NXN E;  2R1F A;  2EMH A;  4P78 A;  2EOQ A;  2V8Q B;  3KWR A;  2EQ3 A;  4DMI A;  4JI3 E;  1A1K A;  5TSE A;  2EPR A;  2WBS A;  1ZR9 A;  3KZY A;  1L4S A;  1A1J A;  1XNR E;  2DLK A;  5KL3 A;  2EOH A;  2CTD A;  3OML A;  2RSM A;  4O24 A;  4TUI A;  2V86 A;  4F9C B;  2KHX A;  2ADR A;  1T39 A;  2EN2 A;  2E1M A;  1DQ3 A;  1EH6 A;  5ADZ A;  1QU6 A;  3KZZ A;  1FJG E;  2EOE A;  2LV2 A;  1F2I G;  2EZ6 A;  2EOY A;  4BC9 A;  2ZM6 E;  2EOF A;  4RH8 A;  2EE8 A;  5T6J A;  5IWA E;  2GPI A;  2L33 A;  4O4K A;  5LMN E;  1G2D C;  5A6K A;  2JWO A;  3QG5 C;  1A1H A;  2JP9 A;  4JI2 E;  2CPN A;  2LUP B;  2A25 A;  2UUB E;  2JR1 A;  2EM8 A;  2EP3 A;  2JYA A;  2M4I A;  5LLQ A;  2J7J A;  4I8O A;  4GKJ E;  1NEI A;  3VHT B;  4F6M A;  2V88 A;  4X62 E;  2ENA A;  1EKZ A;  2EQ1 A;  3EPJ A;  2DMY A;  1GTK A;  2EPM X;  3DJW A;  2EM9 A;  2EOX A;  4M30 A;  5AAS A;  1HNZ E;  5AC4 A;  3EPH A;  1NCS A;  1PKP A;  2YTQ A;  1T38 A;  4N4R B;  2DGC A;  4DV2 E;  3P1X A;  3L00 A;  2G7H A;  4WXD A;  2LMZ A;  1O0W A;  4BMJ A;  3JAM C;  1XMO E;  2N3H A;  2YPN A;  2EM4 A;  2EPZ A;  2RSI A;  2MDG A;  4DUY E;  4JI5 E;  2YRM A;  3LLH A;  4DR7 E;  4R2E A;  4KZS A;  2EMC A;  3ADJ A;  1BBO A;  3IWB A;  1YYO A;  2EN6 A;  1SR9 A;  5KL6 A;  2LRS A;  4B3M E;  2YTG A;  4WSP A;  2L92 A;  1PDA A;  5LMU E;  1GQE A;  2LBS B;  3ADL A;  1KYQ A;  3THN A;  2WBU A;  2VQE E;  4WXC A;  2YT4 A;  1X48 A;  3RMP A;  3F6G A;  4X64 E;  2VE7 C;  1HNX E;  4IJD A;  2HGH A;  1WJP A;  4OOG C;  2L8T A;  3LML A;  3C6K A;  4NHR A;  2UUC E;  1UN6 B;  2R76 A;  4LFB E;  4KWY A;  3AUZ A;  2ENC A;  4O43 A;  1UIL A;  2JOX A;  3ECR A;  5AE1 A;  1I94 E;  1ZAA C;  1PJS A;  1WRJ A;  4LTY A;  3THO B;  5IXM B;  4DV7 E;  1Z1B A;  1RMD A;  3M99 B;  3MHH C;  2JXP A;  1BBG A;  2EPK X;  2K7I A;  4DR5 E;  4Q28 A;  2E72 A;  2EM6 A;  2RQL A;  3MHS C;  4JI6 E;  1YUJ A;  1N34 E;  4YY3 E;  2DRP A;  4DV1 E;  2EPN A;  1KJK A;  4ZYG A;  3EPL A;  4JI8 E;  1YZ9 A;  2B9D A;  4LF5 E;  3UK3 C;  1PJT A;  4L8N A;  1X5W A;  2I13 A;  4R8O A;  4HTG A;  4FK5 C;  2YTF A;  4B3S E;  5A2Q C;  2EOJ A;  3HPZ A;  4P7D A;  4Q35 B;  4R2P A;  1YSA C;  2EOR A;  1JK1 A;  2EPX A;  1BB8 A;  4DV6 E;  4WX9 A;  1IBK E;  5AE2 A;  2YZT A;  4NZV A;  2L3J A;  2EJ4 A;  2GHF A;  2LCE A;  1ZU1 A;  2MKN A;  2V85 A;  2JVA A;  2ENH A;  2V87 A;  2WZO A;  1N36 E;  4R03 A;  4IS1 C;  4JYA E;  2DB2 A;  3F6H A;  4WPY A;  2YTP A;  3ADI A;  2EMW A;  1IQO A;  1WXR A;  2NAB A;  1GZ6 A;  2L3C A;  1LLM C;  2HJJ A;  2YTN A;  1STU A;  1P47 A;  1X6H A;  3T1H E;  2M7Q A;  5A69 A;  1T4N A;  1IBL E;  2YTO A;  4DR3 E;  4JV5 E;  3MSW A;  1T4O A;  3AV0 A;  5F3W A;  3T1Y E;  2PRT A;  4J8Z A;  2MC5 A;  2EMG A;  5A6A A;  4K0K E;  2JPA A;  2DMI A;  2MKD A;  2YTI A;  4TUG A;  1RQ0 A;  2EN8 A;  1X6E A;  4DV3 E;  5KL4 A;  5KL7 A;  2EMK A;  5A6B D;  2EM5 A;  2KOU A;  2E5L E;  3HPS A;  4WFT A;  4JI1 E;  2YRK A;  1SFE A;  2YRH A;  1PJQ A;  4R2A A;  2EMA A;  2WBT A;  2RTX A;  2L6M A;  3C4B A;  5CFF E;  5A6J A;  4F2J C;  1UHZ A;  1A1G A;  4BBY A;  2EMY A;  1YUI A;  4F54 A;  2BBG A;  2LE2 A;  3EPK A;  3DF6 A;  4MLV A;  4DUZ E;  1TN9 A;  1J26 A;  2BB8 A;  1WHQ A;  4DR2 E;  1IQS A;  4DR4 E;  3IWD A;  4X65 E;  4B3R E;  3BID A;  2M9A A;  2L2K B;  4LF4 E;  3VK6 A;  2UXC E;  2NA2 A;  5KL5 A;  1DGC A;  4RHB B;  5A6B A;  4LF7 E;  2HC5 A;  2CT1 A;  2EOS A;  4R2C A;  2YSO A;  1TF6 A;  2EN1 A;  1RC7 A;  1HR0 E;  2HHH E;  2EPP A;  2EWL A;  2YU5 A;  5IT9 C;  2ELY A;  4ZYH A;  1XNQ E;  5DNY A;  2F4V E;  2EMX A;  2F8B A;  2M1S A;  2MDR A;  5AC5 A;  2NUE A;  4KHP E;  1EH8 A;  1X49 A;  2EMB A;  2MC6 A;  3H09 A;  1A1I A;  2LJU A;  1EH7 A;  2V83 A;  1N33 E;  1AH5 A;  3HXL A;  1N32 E;  4GKK E;  3K6Q A;  2I9I A;  1J5E E;  4O5G A;  4F6N A;  2CSH A;  2LUQ A;  4B3T E;  2RS6 A;  2V89 A;  2LTS A;  2N8X A;  4X9J A;  1G2F C;  2DSY A;  3J7A G;  1YYK A;  2GLI A;  4GZN C;  2KON A;  2B7V A;  4AQY E;  2EOO A;  3C4T A;  4DR6 E;  2H36 X;  1FKA E;  4DKK A;  4BHC A;  2DLQ A;  2LVH A;  4NXM E;  2UXD E;  3BGH A;  4OX9 E;  2RS7 A;  4R2Q A;  4GEQ B;  2N3G A;  5AE3 A;  1HNW E;  1AAY A;  2YSP A;  4DV0 E;  1QNT A;  1ZBT A;  1ZBQ A;  2B7T A;  2Q8U A;  2EOZ A;  2IHR 1;  1N3G A;  3IWC A;  2EML A;  4R2R A;  3HTX A;  4YHH E; 
#chains in the Genus database with same CATH homology
 2GPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...