2GPZA

Transthyretin-like protein from salmonella dublin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
111
structure length
110
Chain Sequence
MILSVHILDQQTGKPAPGVEVVLEQKKDGWTQLNTGHTDQDGRIKALWPEKAAAPGDYRVIFKTGQYFESKKLDTFFPEIPVEFHISKTNEHYHVPLLLSQYGYSTYRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Transthyretin-like Protein from Salmonella dublin, a Prokaryote 5-Hydroxyisourate Hydrolase.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar dublin
molecule tags Hydrolase
molecule keywords transthyretin-like protein
total genus 26
structure length 110
sequence length 111
chains with identical sequence C
ec nomenclature ec 3.5.2.17: Hydroxyisourate hydrolase.
pdb deposition date 2006-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2gpzA00
2G4GA 2B77A 3DK0A 4Q14A 3A4DA 3DJSA 1DVQA 3CN3A 2GPZA 3A4FA 3CFTA 4WNJA 1QABA 1ZCRA 5FW7A 5L4FA 4MRBA 5JIDA 1IIKA 3IMUA 3OZLA 1Z7JA 4ANKA 5AKSA 4QYAA 1DVTA 5L4MA 1IJNA 2G2PA 5AYTA 3P3RA 4PVLA 1TTAA 4PMEA 3U2JA 2B16A 4TL5A 5AKVA 3KGTA 4TQIA 1BZDA 1THAA 4L1TA 3CFMA 4Y9BA 4Y9GA 5JIMA 1KGIA 1U21A 3CN2A 1BZEA 2G4EA 2PABA 3A4EA 4FI7A 4I87A 4TLUA 4TQ8A 5CLZA 3IMWA 2H1XA 3CFQA 1OO2A 4TNEA 1KGJA 1SN2A 2G3ZA 4D7BA 3GS0A 3I9IA 3OZKA 2TRYA 5E4OA 1TT6A 1IIIA 2B15A 1E5AA 3GS7A 3GRBA 5CLXA 1X7TA 2FBRA 4IKKA 3CN0A 4HIQA 4IIZA 1ETA1 2FLMA 3FCBA 5JIQA 2H6UA 3CN1A 4PWEA 1TLMA 4N86A 4TLKA 5CR1A 4DETA 5CLYA 4I85A 4ABWA 2G3XA 1TTCA 1DVUA 5FW8A 5HJGA 1ICTA 4QRFA 1BZ8A 4PM1A 4I89A 4ABQA 4HJUA 4DERA 4PVMA 1F86A 3IMSA 3BT0A 4FI6A 1TTRA 4KY2A 1TZ8A 3DIDA 4TKWA 1THCA 4WNSA 4Y9EA 4YDNA 1E3FA 5AL8A 3NEEA 4DEUA 2QPFA 4AC2A 1SN0A 4TQPA 1RLBA 2QGEA 3U2IA 2G9KA 3CXFA 3ESPA 1ETB1 4L1SA 3W3BA 3GLZA 4AC4A 1FHNA 1X7SA 4DESA 2H0JA 2H0FA 1BMZA 2H0EA 4TQHA 2QGBA 3HJ0A 3NEXA 5L4IA 1DVZA 4IK6A 2NOYA 5FW6A 4MASA 2IGLA 3DO4A 5AKTA 1SOKA 1E4HA 3DJTA 1ZD6A 4IKJA 4N85A 4IK7A 1BM7A 4PWJA 5CM1A 3DJZA 4PWHA 1DVSA 4TNGA 2H4EA 4IKIA 1F41A 4N87A 3TFBA 5K1NA 5EN3A 3NEOA 3QVAA 3M1OA 2F7IA 3SSGA 3B56A 4ABVA 4ACTA 3CFNA 3IPBA 3NESA 3CBRA 4PWIA 4ABUA 2B9AA 4PWGA 1GKOA 3DK2A 4PVNA 5TTRA 1GKEA 5IHHA 3TCTA 3IMVA 2QGDA 1SOQA 3BSZA 5E23A 3ESNA 3GRGA 5E4AA 5BOJA 4Y9FA 4HISA 4HJSA 1TFPA 3IWUA 4TLTA 4TLSA 5CN3A 3DJRA 2TRHA 3D2TA 2F8IA 3GS4A 4QXVA 1QWHA 1SN5A 4PWFA 1Y1DA 3P3SA 2B14A 3KGSA 3DGDA 2QELA 4Y9CA 2G2NA 3Q1EA 4WO0A 3FC8A 3D7PA 5CNHA 3ESOA 4TM9A 3I9PA 3CN4A 1DVYA 4TL4A 3KGUA 2WQAA 5DEJA 5FO2A 1G1OA 3IPEA 5A6IA 2G5UA 4FI8A 4IKLA 1IE4A 2ROXA 5K1JA 5L4JA 3NG5A 1TSHA 3P3UA 4MRCA 1DVXA 4TNFA 4PMFA 1TYRA 5EZPA 4DEWA 2QGCA 3IMRA 1FH2A 2ROYA 3IMTA 3IWVA 5AL0A 5DWPA 2GABA 4YDMA 1TTBA 3P3TA 4PWKA 4HJTA 3I9AA 3GPSA
chains in the Genus database with same CATH superfamily
1Z9PA 3T0EA 5L2KB 5EORL 3I6LE 3NT0A 4PCSA 1R1CA 5I1AA 5ICZB 3RWJB 5LWYL 5CBEA 4H1LG 5L9DL 3HE6D 2YWZA 2VZTA 2VXVH 2VLJB 4Y16A 2D3NA 3CZKA 4J3OG 4FN0A 4KZCA 4NCC1 3TA3C 4G43B 2BNRD 4Q97A 1CFVH 3DURB 2AXFB 3ULSA 43CAB 4MMZA 1VGEL 1J86A 1IQDA 4PJBF 3C60B 4K94C 2VXSH 3ZRSA 3OHMB 2GIMA 1YEWA 4NN6B 4XXDA 1XGYH 4GO6B 5HYJE 5FGCE 2BVPB 1P9MC 4MNHB 2ZWZA 5L88H 5T3ZL 3HCVB 1QLFA 4GT7A 5A2FA 4LKCA 1EO5A 2HKFH 4XAKD 5E4EB 1GGUA 1UOVA 4NJ9L 3DXAD 4PJ7A 2BP8A 2J5LC 5E8PB 1CE6B 2E9JA 3P4MA 4PD4K 1NL0L 2YA2A 3GUTB 1G9EA 1W72B 3HE7C 1J9QA 4O5LL 3CE1A 4R4BB 5C0IA 3QUXC 1UWXH 3OKYA 5JHDA 2J73A 3NIDB 3CH1B 4MAYB 3C08L 5C3TA 1G7JA 1KYAA 4AC2A 1OF0A 1E8YA 4LVEA 4DVRL 4UU9A 2WVUA 1MJ8L 1E4XH 1RULH 2YQGA 4FQCL 3VFUA 1OPGH 3TONA 4LCCB 3WEXA 4Y5YB 2NOYA 3TZVB 3BP5B 4ENZA 1U8QB 4WGVB 3TNNA 2F7QA 2VAJA 1DUYB 1HSAB 5C09E 3FUKA 5CF3A 4TNGA 1DVSA 1FLTX 3CVHA 5MEOA 4FX5A 2KLSA 1HCZA 1NMBH 2EXTA 2P8MA 3QVAA 3CSGA 2YD1A 3NCJH 3QWRA 5GRYA 1IGCL 2OX5B 3MFFA 3UDWC 1KLUB 1HZKA 3ZHKA 4FAAB 3CVIL 2BY0A 1YYCA 2LLNA 3QZNA 1MHPL 3WTTA 3C12A 2O6EA 1PYWA 3VD5A 1MJ7H 2J8UA 1YEDB 3DX9B 1DSWA 2DI8A 3HG1B 3N1PC 3X2QB 3NRQA 4JDZA 1NMCB 2YK1L 4NN7C 4F7MA 4DIXA 1UZ8A 3GXMA 1MCRA 4HDIA 5E99L 3OGCB 4OFIA 1ZA3A 2CDEB 3QSKB 3O2WH 2Z6FA 2UY6A 1I3GL 1DANT 2IDSA 2CUAA 1BAFL 2COVD 3VQLA 2C1OA 2XWTB 3RUGF 5DD0H 4XNYH 4G6FD 5HJBA 2K70A 1K9TA 2ZAIA 3MNDA 3B9KA 4FE9A 3WG7B 3JVFC 4RFNB 4UNUA 4XP4H 2QT6A 2VLKD 3BE1L 3QORB 4MVBC 4O5LH 1NDGA 4POUB 4X8XA 3CQFA 3JVGC 1KIQB 2CBPA 2JKLA 3V95A 3MRDB 1P4BL 1OB1B 4YEFA 5DO2D 3S97C 5EU7C 5C0BB 4MJJA 2R83A 4PRPB 3EHBD 5F3BB 5JHLA 3OMAB 4H8UA 3RUGA 4HFUL 1FYHB 4P49A 5DJCB 2MCG1 1THAA 3FRUA 4YO0B 2LE9A 2YA0A 1KLGB 2WQWA 1TKWB 1HZLA 3GZKA 5E2VL 1FORH 2PWDA 4FXTA 5FXCH 1B4JL 4YHYC 2W81C 2O1AA 1UZGA 4KTEH 1KC5H 3LDBB 1I8LA 5CLXA 1F4WH 3ZHDA 4AE0A 1V3KA 2ATPA 3KBPA 5TFSL 4JFFE 4F7EA 2GY7B 4GBXD 1AC6A 5D7KE 4HD9A 2IPUK 1ORSA 2A5UA 5GS0C 5MHSE 1YJDH 4MSWB 4X4YB 2DMGA 5CS7A 3QZWG 3OAUH 3V6FA 1Y6NR 1U8KA 3TS8A 2IPKA 1ZSDA 3VXTB 2W94A 4MQSB 3CMOH 3ES6B 5EUOF 4N3TA 5IW6B 1HE7A 4NIYE 3I6GB 4P9HL 3DHPA 2O5YH 2QGBA 2VC2H 4WFED 1F11B 1C1EL 2NW2B 5JZ7D 2HT3C 5KUMA 1S9XA 3RGVB 1DCEA 4B3EA 4ATTA 2DWEB 3LH9A 4KXDA 2AKRB 4XX1E 2XTJC 1T4WA 3EJRA 3JV0A 4PJXE 5DA4A 5E8EA 1UB5B 2YA1A 1ILUA 3X1NA 4KNSA 3AT9A 2XY2A 1ZE3H 2H2SC 2BNQD 3HS0B 3NYKA 4Z8FL 1J48A 3FQUA 4P3DA 1HXMB 3OKEB 3GBMH 4YSQA 4ZFOL 4F93B 4IRZH 1MHCA 4E42B 3GMPA 4FERA 1CGYA 2C9XA 3G6DH 1GTNA 3ML9A 4E41A 2QFRA 1EEZA 1GH7A 1TU2B 4M00A 4NKDA 1Q0YL 5L2KA 1RIVL 4BFOA 3DPBA 3MLXH 5EU4A 1RURL 5CBEB 3EHBB 1A5FL 2DWDB 3DO7A 2MIZA 5INCA 3GBLA 4PJ8D 1A66A 4ISVB 5CCKH 2XN2A 5ERWA 3MUGB 4FA7B 2DQEH 3BKYH 4FFTA 4RFEA 1V3JA 2X3BA 1JNNH 4FZ8H 4EI6A 5KYNA 2APVA 5G4OA 4FKKA 1IQWH 1OGAD 2DJSA 4G6KH 4JREB 3VW3H 1NCDL 1DVTA 2EDWA 1MHHA 1PG7W 1JIBA 4CMHB 4TQIA 5E8PA 3GMLB 3P0YH 3ZT5A 1O7SA 2Y07L 5HDWA 3O6FA 3KS0H 1BZEA 1VADB 2A6JA 1GC1L 1KYOK 4JO5A 1NANH 1RPQA 1UENA 3IDIB 5C2BH 1X4ZA 1KG0B 2N0KA 5JHDB 3EADA 2YIHA 4IEFB 2EC8A 1GVIA 2ZWYA 4PLKD 1HK6A 3G6JF 5EZLB 1E0OB 1AQKL 1KCKA 2NUPA 1VB9A 3LMJL 5ANHA 2DYRB 2HTLC 4RGNB 1AKJD 5F7MC 1TQCC 3LZOA 4HKJA 3BKCL 3K71A 3D4YA 1LO2H 3LNEA 3ULUF 5EZJB 2CJSA 1WBZB 4MB3A 3FFDA 2CCWA 4K5MA 1TZGH 1TCRA 3EH2A 3TO4D 3GNMH 2ZKMX 4WTWA 1D2PA 2CR3A 4MA7H 2EIKB 1KYFA 4YC2B 1X7SA 1QW9A 1KB5A 2HN7B 4WHTA 2DH2A 4KHTH 4TQHA 4W9LC 2WAHA 1OARH 2VW6A 5CJQL 4DP7X 1MDAA 2ZG1A 3EBHA 5J12C 2XPGB 4KROB 5E7FA 4M1DL 3DX3A 5T3XE 3EZJB 1DSYA 1IM3D 2P1YA 4KFZC 1WFMA 5K33A 3AUVA 4JO2L 2R4RL 1JSYA 4HDIB 2V3DA 1S7VA 1QKZH 3QFJB 4YIQA 1MLCA 4ZNEA 1QR1A 4N0UE 3MROA 4LDLB 4PS4H 4MNGA 5ISZE 1BXAA 3UJIH 4FQXA 4U3SA 4YWGL 3U7WH 1IQWL 5BOJA 3UERA 2H26B 2UZYA 1DQML 1TZOA 5EC1A 1QZ1A 4YJZL 1WV7T 2CCVA 3L3IB 5EEUA 4XMKL 5ETUA 5F7DB 4K73A 5IQOA 4RMVA 4YH6A 3U9PL 1C1EH 2MWCA 2ZX7A 5ICZA 4DP9X 3BLPX 3R1GH 3R7QA 3WIAA 4M3KB 1WAEA 5FUCC 4E9WA 1F3JB 2KDYA 3C8KA 1WTGT 2EDJA 3HAEH 3GHEL 4Y16B 5K1JA 4BWWA 5CCJA 5EZPA 1RUKH 1KXVC 5BZZA 2V17H 4HPHA 3MLUL 5ACZA 4JO4H 4MJID 3P3TA 3DBXB 1IVLA 4N9GA 5LHDA 5JHDD 4PYGA 2DWYA 4V2CB 1NBQA 2JNZA 1HNFA 32C2B 2CGRH 5AZ2H 4F9PA 4NRZA 3P3YA 1LYQA 4ZW5A 2QTEA 4GG8A 2CBMA 1QLFB 1IJNA 4OBSA 1I1CA 1U4FA 3A47A 3RJOA 4BWUA 1KTRL 4O2EB 1KBPA 3CXDL 3O2DH 4O2CA 3GM8A 1NEZA 2BRRL 4WEBL 2QV4A 1ECZA 3KPNB 3EGSA 3UBXI 3N50A 2ARJQ 4NWUL 3BZEA 4PP1D 1BIIA 4X7DC 1Z9SB 1T0MA 3L9RB 2NRDA 2OW6A 4KTYA 4YVNA 1XGPA 4L05A 1E5AA 3OSKA 3TPUA 3C75A 3INOA 1XF1A 1A1MA 5DHMC 2EYRA 3U7YL 2F54A 1F11A 2DQTL 4M6OH 4ZODA 5EEXA 5C7ZA 2DJ4A 1Q4NX 5DZPA 3EYQD 5J11B 4KU1A 3ALXA 3HC0A 3CC5A 5C3IA 1CD8A 1UB5A 1XEDA 3CFEA 1BD2D 3CVHB 5I71B 1CIDA 3UZEA 1Z0MA 4JHAL 4GYBA 5HYSA 5J4MA 1QSFD 1MCSA 4HUXA 4G5ZL 1ZHNA 2H0EA 3GTTA 3CQQA 4RMUA 3MBEA 4NQXA 4Y5YC 4LLDA 5JXAH 2VR6A 4U3XA 3F7VB 3AREA 1KTKE 2DWXA 1T83A 4DGVL 5KSBA 3HG1A 3M17B 5IEKA 5D2NA 2VDKB 4MLIA 2MNWA 2J8HA 3CD4A 1P7KA 2H3KA 2VZSA 3B56A 4N1HB 4CDHA 4NM4H 1AG0A 2ERJC 4LPXA 3QI9A 3J8F7 4NO3A 5IOPB 3TIDA 2VQUA 1SFDA 2ZIDA 3MUY1 5LXGH 1TTUA 1G7MB 1MOEA 2J56A 1EZVY 4EOWL 4BINA 1NUNB 4PR5A 2JXMA 4XC3L 3B9KB 2F1BA 2ZKHL 2XJLA 5HHXH 4BWTA 1RZKC 3ARDB 2QR0B 2VO5A 3P1VA 4JGUA 4M56A 3QXUA 2JI1A 2YRBA 4Z7OE 4WWKC 1NCWL 4QT5B 3T8XA 3VXMB 4KQ4H 3NG5A 4DVRH 1ZTMA 4UQ2B 4UCFA 4PV1C 2YQBA 5GGRA 3TPKA 3SBRA 8CGTA 3IWVA 3QJHA 4A1RA 4HMEA 5J1AB 4ZOAA 2RAMA 5J89A 4ESKA 2R27A 4ETQA 5GGRY 1BYPA 3OKMA 4RMQA 4Y5YA 5CJOL 5D2NC 1EANA 1XAKA 4NT6B 1LEKB 2HLFC 2PR4L 4WNJA 3IJEB 2HKHH 3CVIH 2PYED 3HE7D 1B2WH 1DUYA 1HSAA 1NC4A 1ZHBB 4UILH 2Q76B 3N43B 3JWNE 2NMSA 2BINA 4NC0B 1CDGA 5B1KA 5I75C 5EEVA 2Z7WA 4NPYB 4G80B 2QVTA 3LXBA 3NZHH 2NY0C 3PQYA 1JPEA 4HW6A 3U0TB 1MFNA 2ZX5A 5F7EH 4F7CB 3C2AH 2AI0H 2HG0A 2CGZA 1U3ZA 3ECUA 3GI9H 3HPLA 3O41A 2P28B 4HHGA 4B9YA 5GIRB 5HYFA 3D0VA 1XCQB 1TT6A 3DX9A 3FU5A 5IESL 4OGZA 4Y1SA 2IAAC 2ADFH 3ZHNA 1OSZB 1WO2A 5C6WH 2LQRA 2VXVL 3SDXF 5JPMC 1JJUA 1TEYA 2XX0A 3RY4A 1C5CL 1ZWIB 4EUPH 1JZ8A 1NBVL 3VFRA 4Y1AB 3ABZA 2VIRA 2XWDA 4OD1H 3GXNA 2X44D 3QJFA 5E51A 1N5AA 4WW2B 1NL0H 5D1QE 1CWVA 4J3WA 4GLRH 5FHAH 3BH9A 3ZZQA 2OJZH 5GPRA 2DEYX 5B1JA 5ICXB 1FO0L 1PZBA 2PETA 2MHAA 2WQUA 3MLVH 2OTUB 1MVYA 1IARB 3VJ6B 5D7LA 4K2UH 3QORA 3A5VA 5BV7H 5I1LB 5B1CA 2QLYA 3CXDH 4WNQB 1OTTC 1BFVL 1XX9C 2WMPB 3QUKB 4GXVL 2Z3FA 5JPMB 3KPLA 4PRHE 2NZIA 3CZLA 1TMQA 4U6XA 3VXUE 4ZAKC 5FW6A 3AM8A 5IY5B 1TVDA 2Z92A 5ICUA 4CADB 4AGNA 3V5KB 1B0IA 4WHDA 1CG9A 1JDCA 4P4KA 1S5HB 4TNVF 4PJ9D 5ITBL 4PWHA 4QF1A 1J9CT 1A7OL 2K3HA 4HGKC 3TFKC 3U1SH 5J0BA 4Q9QL 1II4E 4XP5L 3FYEB 3HC3H 4NI3A 3VXRA 1Y0LB 1IL1B 1WT5A 4L3AA 1AS8A 4BKLA 3UBGA 4LEEA 1CU4L 1ESOA 4ZXBC 3FHAA 4M29A 1I7TA 3TO4C 4H8WL 3MLZH 3GINA 2DLIA 2DQFA 2PCYA 3EFFA 2QADB 1FDLL 5TQ0H 3I9GL 1E50A 3VDAA 2ARJA 5CD3A 3IU4L 3ZRFC 4FQQA 2OYPA 4I18B 2NW3B 3TN0A 3VE0A 4FQ2H 1MFCH 5D2NE 3DMMB 2EEBA 4B7IA 1KT2A 2KZ1B 1CT8A 4GS7B 4Y8AA 1KELL 4K7FB 5E5MB 2ORBH 3BXNA 3ROLB 1CE1L 3ULVD 4N6QA 3T2NL 1NDMA 4JPKL 4PRIB 2OMYA 4QRAA 1EGJH 1XGTB 4KI5D 3LN5A 5GS0D 2Q7AA 5GHWH 4OBRA 4JCMA 4P23A 4H20H 5ESVB 5CFAA 3BZDA 4G8GD 1AE6H 1DQDH 1FG2B 5FYKE 5F9JB 4GB9A 2E7CA 5EZLA 2IGTA 4NP9A 4NO5A 4JM2A 4TL5A 1PZSA 4X5WB 3EH5B 1QLEB 3HA0A 3KXFE 3SE9L 3GUFA 5LQBL 2EXYC 1UQSA 3S35X 3EYSL 3WI9A 1HU8A 1FIEA 4DP4X 5IZ7A 4RWYH 5ALBH 4HLZG 4PJCE 1Z1WA 1SRDA 3PHQB 3FFDB 4AEHL 1R5VB 3KHOA 5C0EA 1S4IA 3LRHA 1CL7L 4Y5VA 5DFWH 1YEEL 1RJYB 3MOQA 2EJ1A 4QRUB 2BIQA 3RU8L 2I69A 4I13B 3SY0A 4MA7L 1GW6A 2XOTA 3MBEB 4JBSA 1U41A 4NQXB 1SMDA 3RNKA 1ZVNA 2X2HA 2R1WB 1TIUA 2QVKA 4MD4B 1LO5A 5FM5M 1ZT7A 2NZ1A 5K9KB 1WP6A 1C8QA 2I27N 3F01A 1QWNA 3HRZB 2ZCZA 2GIXA 2WZ5A 3BZFB 2EYSA 1TQWA 3ARBC 1M6OB 2JQAA 3EYSH 4PGDB 1YAIA 3W9DB 3EYFB 3HG0A 3G5YA 4HJ0C 3VA6A 1OSYA 3QH3B 4G5AA 1P7QB 4HXBL 1D9KB 3M6DA 4EE2A 1U8NB 1YC8A 3FQNB 3WO4C 3SPJA 3LNDA 4Q9RH 4C83B 4XBPA 2BXYA 5D1QC 3UG5A 4HKXA 2B4CC 5DD6A 2PN5A 1YN6B 4Z7VF 3BSGA 4ONGH 5D4QA 4GSQA 2FEDC 1LO0H 1F58L 3GMLA 5I6LA 1XF2A 3MNWA 3RX7A 3VWKB 1QFOA 1EJFA 1XH3B 2DAVA 1RU9L 1AFVH 2Y1VA 3QUYC 4PGBA 5IFHL 1U2YA 5IROA 1MH5B 1O6SB 4KROD 5CINH 2KYIA 5HPMA 4CC4C 3TCTA 5FYKL 2OKMA 3JT0A 4UQ2A 5FX3A 4QJ4B 1PY4A 4N2DA 1MCJA 2YGNA 1M71B 3LS5H 1NAMH 2YLHA 1E4KC 3W11D 4DQOL 1CFNA 1G1YA 1IC7H 1X5JA 4M9PA 4NZFA 4KO6A 5FWQA 3GZPA 4N0FB 1MFAL 4FG0A 4YDIL 1FAIL 3IN2A 4ZTOL 1D7DA 1QUNB 5TQ0L 1YEKL 5F7LB 4CKQA 3PY9A 2QELA 2ODIA 3CFBB 4IMLA 5DURD 1NC4B 3QJSB 4F20A 4FDWA 1L5GB 1N59B 2XFGB 3ARGD 3R4RA 4HALA 4OZHF 4H44C 2B2XH 2CK0H 3H85A 3PJSA 1J0KA 5K9JL 1KNOA 4PLKC 2QVMA 2HLAB 3SCMA 1B4RA 4LCUB 5C0JA 2XZAL 1FGVH 1OQXA 1QSEB 1UXSB 2ROYA 1WIOA 4IRSD 3QARA 5D5MF 4UQIM 1VSCA 4HC1H 2OZ4A 2XDHA 2BSRA 4LDOB 2P7TA 3K8KA 1BX2A 3C6LA 4OCLC 1H6UA 3HFFA 4MX7A 3WFCL 2XA8L 4PRAB 3GO1L 3C2SA 2VGLM 3NIGB 4FC3E 3TT1L 3INUH 1S7VB 2E6QA 3AB0C 4PJ7F 3QPXL 2ZOLA 3RWHB 3CFMA 5HHNA 3TJEL 1KXQE 5IMLB 4MNGB 5EF2A 5LN4A 1JZDC 3MX0A 1FO0H 5J11C 3QWNA 4NHUA 1YNTB 2P80D 4FP8L 4H7VA 1CDIA 4X6CA 3OMIB 4P2YA 1IO4C 1BFVH 4LHJB 4MS8C 1CLOH 3T2PA 4X6CE 1DVFD 1I7ZB 5JPMA 4JM2D 4R97C 5HGAB 4ZDHB 3SGEH 3I6KB 4UTBL 3BUIA 2K9FB 5ILTL 3LPPA 3L3GB 4E41D 1G7PB 1SF5A 3DX6B 4KKLC 1YNLL 5HHOA 1B6UA 1YEGL 4KH9A 3ULVL 1O0VA 3QQDB 5D2NB 1JRHI 4OLWH 1U2HA 1ZTXE 1IGFL 4UINL 1SHSA 1SN0A 4BD4A 4OFDA 3NACL 1GGYA 1AMYA 3EDKA 3X3GL 4OF0A 3ZPDA 1LK2B 1CDUA 4YL9A 1IMHC 4OVUA 1CIUA 2F7PA 3MRRA 2ZZUT 3N40P 4G43A 4N2BA 4NAMA 4WU5B 1ROCA 3BSZH 4GG8B 5SWZB 4JFEA 4BUQA 2XG4A 5J56B 3WFDH 3CSTA 4KKRA 4DP8X 1ED3A 1P5VB 2CGYA 4LF3B 3BGMB 1W0VA 2HRGA 2ENPA 3ARDC 1EDYA 2HT2D 5BRZD 1UD8A 3EO9L 3B9KC 4O02L 4QHKI 2A0LD 4EI5A 3DMMA 1EO8L 2WW8A 3BX7C 4Q6IA 2DI9A 5AVQB 4HJIA 4L0PB 4UV7L 2XXGA 3MV7B 2UYLB 1M56B 4P23C 4NQCE 2KT6A 4W9KC 4E9RA 5LNGA 3KLLA 4JRXB 2ITDA 2WCPA 3BE1H 2PCFB 2FDBP 1ZPLA 1PVHA 2DBJA 4OSUH 2Y1ZA 5A2AA 4N90E 5JYMA 3S3CB 2FJSA 2D7NA 4TPRH 3CMGA 4FQCH 1K2DA 1I1RA 1NCHA 3PAUA 4JFHE 1XXFC 2CSPA 2ODHA 4RZCA 2NSXA 3PNWA 1Y18A 3V7AG 2BXZA 4QI3A 3T3PB 4ZMLA 3EFDH 2C9RA 3MJ8B 2XBZA 5MI0C 4HWEL 3BDXA 4UOJA 4CN6A 3HE6C 2AK1H 2GEEA 5DJ2B 4L9LB 4HU2A 4ZMTA 2ITCB 1NGPH 3ILQC 3UTSE 2IAND 4HWEH 4JPSA 1P7BA 4PB9L 1L9QA 5EBLB 3IU3B 4MXQD 2WM0A 5JMRA 1XGRA 3MJ9A 4NDMA 4KTDH 3M46A 4Y7OC 3RNKB 5E4EC 1D5XA 4LCWD 4U49A 4NSKA 4Y9GA 4KH2A 2J8UB 3MJ9H 4HUUA 2WWMC 3BEVB 2YD3A 3BPLC 1OO2A 2GSGA 3OPUA 5FDWB 5KZCD 1UXMA 4R7LA 3OHXB 4XC3H 3QEGH 4H2AA 2BRRH 3MYJA 4KMTL 3BUPA 3VJ6A 1Q9KA 4PBVC 1U8OA 3VSVA 3U7YH 2BIOA 2WMPA 5FHBL 5IQ9A 4XPGH 5CBAA 1J5OH 3O4OB 4OIBA 4S2SA 2O6DA 1YN6A 9PCYA 4CADA 3PWUA 3WUWA 2LFEA 4GXUN 2F54D 4L8DB 4O4YL 3C5ZA 4JO3H 5I1GH 4GIAA 1JGUH 4AGOA 3MRDA 3C8DA 4JPQA 3IFNH 1CDYA 3DV4B 3GHEH 1EEYB 1HQ4A 2WKOF 4WGWB 3FU8A 2N7BA 3Q13A 2H0FA 3U6XS 1GAFH 3VFVB 2CD0A 1UH4A 3F04A 3RUGB 4U1IB 3BOVA 2B59B 2GBUA 4MB5A 1L9NA 2Y06H 2UUDH 1G9HA 3SE8L 3ZJAA 2BSTA 1S7WA 1T5WB 2GHWB 3QDHA 5LB1A 2P9RA 4V1DD 5AAWC 1DEEA 1P4UA 3LNHA 3PXJA 1A6PA 1IBBA 1IEBB 4ZO9A 3QRBA 3QR0A 4BIKA 5F9AC 1IEAB 2Y0SA 3D4GA 5LGHL 3KPRE 5E4AA 4J3BA 1ZMYA 2JB6B 3AQZA 4Z7UB 2AFNA 4UOQA 1K4CB 1U8HB 1VPOL 1EBPA 2PP7A 1XIWD 4JEGB 2VXQL 4LRNH 1AGFB 1YYLH 2PXYC 3BUTA 4H26A 5B38G 1ZGLA 2HFGH 2NY0D 4P05A 1IC7L 3VXSD 4WI3A 3WHE0 3ATDA 2B7DT 4QKTA 1JZJA 1MFBH 2IANE 3FCSA 3QZWA 5AVRB 1V7MH 4U0QB 4YXKL 3BSHA 4GMSL 2MHAB 2NW2A 1E5ZA 3D85B 2IPTL 2YO3A 4PJXF 2I7OA 1KPUA 4YE4H 4YSUA 3QXWA 3SKMB 5K9OB 3N85L 5EWIH 3MCKA 4NGHH 1I1YA 4NZ8A 5KSVA 5LDSA 5D7SH 3IJ7A 4NKIH 4N8CL 1G6RH 3V4VL 4YAQB 3P9WB 4TUUA 3U4AA 4Z78B 2J6EL 5EUOA 3N43F 3OKDA 4NAJA 1IKFL 2VLJD 2EDHA 3FN0L 4M8VA 5FEBA 1HH6B 1MEXH 1DHKA 1WRFA 4CRPA 1ROWA 5L2KD 1J1OH 4DN4H 1CYXA 1A9EB 1FL3A 3GMPB 2F2HA 4MZRA 2BP0B 1ZT7B 5CLZA 5B4MD 2UXGA 3AWGA 3KYMA 4RX4D 4ELKB 1T66C 4D7BA 2W38A 4NX0A 4XWOC 1A7PH 2AXFA 3MV8E 2E4TA 4IBTA 3VXQA 1TJHH 1H3VA 3LS5L 5CD5C 1TJIL 4P5SA 2BS9A 4FNLH 4DOHE 3FRPB 1BFTA 3M07A 3QIUC 4M6AA 3V5DB 3HG1E 4HEMA 3U83A 3QNZB 2W92A 1JWMB 4FCHA 2PNDA 5IQNA 3MACH 2ZXBA 5DD6B 2A9DA 3RWFA 2P5WD 4RFEB 4LRIC 4QCIB 4GG6B 5F9DC 1S6NA 3KH3A 1OSPL 5I5MA 3ROLA 5CGTA 1TLKA 3CG8A 3EFOA 5I26A 1KIQA 2LU7A 4HK0A 2EYTB 1CMOA 4LLWB 2MTPA 4FMVA 4BFBD 4LBAA 1D5BA 5IMMB 5C0BA 1BZOA 4N8VB 4X8JA 4QYOA 5HDLA 1JHLH 3EJCA 3VFPB 1FG2A 3V0WL 2KMWA 2ZSVA 4PREB 2Q86B 3LVEA 3QFDA 4A7TA 4AJYV 3AU1A 1XCWA 1FL6A 3SE9H 5CEXB 1CB4A 5LQBH 4K3EL 4Y4KD 2ENYA 1QVOB 1UQSB 1N5YH 2X12A 2E7MA 3AGWA 3MRGA 1U8MB 3HZVA 4KKLD 2ATPB 2J6EH 2ZOUA 1FE8H 2X4OA 3RHWK 3FT3B 3KWXA 4HUMB 2V5RA 1SXNA 3ZR6A 4HCRH 1OHZA 3B9DA 5IVXF 3WHXA 5IVZA 3TTSA 3F5WB 5GS1B 2KPWA 3ESOA 3TCLA 4ZX6A 4TL4A 4MX7B 1MFBL 1JN6A 1ZK9A 5CZKA 2WQXA 3FUDA 1CU4H 3VI3B 3P4NB 1PZ2A 2BVOB 2M1KA 3H6AA 3ZT6A 4DK6A 1JD9A 5KS9A 3B9KD 1RV6X 1HHKB 1JGEB 1WISA 4Q14A 4AG4H 1J88A 1TTFA 1WAAF 2GFBA 1QP1A 2CO3A 4PBWD 2PPEA 1RUAL 2R0LH 4XO5A 1A14H 3FKUS 3QIBC 3UGXA 5IHLB 2R9HD 1CTMA 4OFVA 4FQXB 4W4NA 2QLVB 2OJEB 3QRLA 2Y22A 4LXFA 2DKMA 5JIMA 3TT3H 2IOIA 1B4JH 4J3SA 5E00A 2WXJA 5JPNA 4WI2A 4ZO6A 5LBSH 3S34H 3TOPA 3CFCL 3VXPA 4GAGL 2ZCKH 1N64H 2PPAA 1X4XA 1GAFL 3MSPA 1E4KA 2FCBA 3P2DA 2X6BA 3R06A 4CUCA 5AOIA 4IHOA 3GSQB 4LEXL 4QIRA 2O5ZH 4I85A 4KO7A 1F4WL 4BUGA 1IFHL 2IH9A 4JFFD 3HUJE 5IR1B 4YFLI 4Q6KA 1PL3A 4DTGH 4G1EB 2GCYA 4OAWA 3SCMB 3MRKB 4QXGL 4XPGL 3ZK0A 3IVKA 3EOAA 4U1HA 6PAZA 4FCAA 4E9XA 3O6MH 2YAEA 2WLNA 3OR7B 2UV3A 4S0HA 1DJYA 2IGLA 1KEMH 1JPST 1NIBA 3NCMA 3Q5YA 5C2UB 1EHXA 4X6EA 3DRQA 1HKFA 1CN4A 1E5YA 3EGSB 1JV2A 2O4EA 3O6FB 4XI5D 3O4LD 4XPHH 1IC1A 4AK1A 4N87A 1QMUA 1ZAGA 4UI2A 1FZOA 5CEZH 4HS8H 1NLBL 3L3DA 2Q3AA 4C56D 2D0FA 3VD7A 2F0CA 4LIQH 3TPUB 1FN4B 1I9RL 1KN4H 1OP5H 2FH8A 4GQQA 4RLDA 2EEAA 2V5TA 1AXTH 4KQ4L 2WWOA 3KCPA 1AY1L 2V8LA 3ESNA 3FO0L 1G9NL 1GZQB 1MY5A 1XTLA 1DL7L 4KVCL 4DKDC 1Q1JL 1VZIA 4I9WE 1K8IB 4XP4L 5TF1L 3OX8A 4N2OA 2DPKA 3RRQA 3X13B 1I9JL 3V4PB 5IW1B 3IDJA 3SE3C 3BP6B 4YDLB 3SHSA 1F4AA 3QIWC 5LBSA 1AYOA 3D85D 4HPYH 4Y1TA 1PNCA 3WJLA 1LO4H 3SZKC 1TYRA 1FUNA 1P84K 2B20A 1LK2A 3QNFA 4PUBL 1NICA 1H3UA 3NPZB 3SKJL 3EJJX 3WE1A 3CHOA 2LU3A 4Q2ZB 4BZ2H 1UUNA 2EUXA 1MAML 4W4OA 3QNYB 1Z7JA 4HK3N 4WUKH 2UZXB 4O02H 1XMEB 2ZQKA 3CFKB 2VSKB 3PGFH 3Q8AA 2QQQA 5G55A 3IRPX 1UJ3A 4GQZA 1U2CA 2JXMB 3C08H 4YSDA 3P77A 5KBKA 1N6QL 1T7ZA 1KBVA 3ARDA 3W1ZA 1E6OL 3OAZH 2NY5C 3QQ9C 3P2TA 4UAHA 3RWCB 1IM3B 1HCFX 5D1XB 5MERB 1PSKH 4XZUA 3JQOB 3PFUA 3QXDA 4CAGA 1QBAA 5JIQA 4I3SH 1VFAA 3UZQB 1WWWX 2X1QA 3RKDC 5H35A 1I53A 1KCSH 2QPSA 4JMXA 4K5OA 2UWEE 4DPBX 3EIFA 2PYEA 3HE7A 3O9WB 4LMQI 2W80C 4F7TB 4WNSA 1IGJB 3VD9A 2VLRD 1B0WA 2BSTB 4L5FE 3ZE2B 4UTBH 2Y1AA 3MHZA 2NX5B 3UTZA 4P3WA 4WFEE 3B2DC 2FBJH 2Q76A 1ETB1 1CLOL 3CVHL 3SYOA 5DVOA 2NY6D 1HL8A 3OM3B 2WQRA 4YHZL 4Z0XA 2AV7A 1JHKL 4UINH 2L7QA 4KX9A 5LBSL 3BMWA 4GW1B 4UWQB 4EDWH 4OV5A 3WHXB 3QDAA 1U8HA 2LABA 2XN9E 2H8PB 5FYJE 4F7CA 1MW2A 1NCBL 2WTPA 5EUKA 4ACTA 5IJKC 4TVPH 4OF6A 1OP3H 2CRYA 4M8RA 5TTRA 1GGIL 2AQ1A 2HKFL 3D05A 3OHXA 1ES0A 3PL6C 5DMYA 2YD6A 4TVPL 3PQYE 3SQBB 4OD3L 3MLSL 4TVSa 4OD2B 5FWRA 3VQMA 3PWJA 1U8JB 4CSZA 1E2VA 5H4YA 4K23H 4A2DA 1WLHA 5AUMA 4XMKH 4FYTA 3C6SB 5IVNA 2VZOA 3KGSA 1MWAL 4G6AC 5C8JA 3TEWA 4W6XB 2A6DA 2Z7YA 2B2XL 4EN3D 1D7BA 3OKDB 2CO7B 1QNZL 3HFMH 4BSWB 4FRWA 4IJTA 1A7QH 3IFLH 3VCLB 1RZQA 3GSVB 4S1DD 5F1IB 3IMRA 3NSYA 3IFPA 7PAZA 5J1TC 5KBLA 4HCRL 3AREB 4PWKA 3HS8A 1AHMA 4PH8A 5EOCL 5K1VA 4PCTA 3DGCR 3MLUH 3VSQA 4G3YH 4OZHB 3STZB 2XYCA 3MC0A 4KAQL 3B2XA 5I1DA 4O58L 1ZLSL 4JL2A 4ZFZA 3QG7H 3QEQD 2J4WH 4LSSH 4YR6B 4JQXC 3RTLA 4PQXA 1FA4A 4IMKC 4DUVA 3ECBA 4Y8DC 5BQ7B 1NWOA 3HG2A 1MFDL 3AXLA 1PLGH 2AABH 3MLYL 4ONGL 5IHZA 1DQJA 5LLIC 1OF2A 4O2CB 3LEYL 4IRJD 3LAFA 4F8PA 4F7KA 4F8OA 2QHRH 1E67A 5D7IA 3QYNA 2MPVA 3VRJA 5CXPA 1WBXB 3UYPB 5AAMA 4N5EC 3L4WA 1MIML 3AABA 1ZTXL 4X0KA 5DHVH 5C9JA 4E2OA 3FUEA 2EP6A 2YWYA 2M2DA 2H45A 2X6AA 1MUJB 1GYWA 2Y4SA 3DRQB 4GIOA 4JO1L 3R8QA 3VFPA 3ARQA 5CJBA 3IB4A 4PRIA 4JHVA 2EDKA 5D55A 2F18A 4R8WH 2WQ8A 5I73B 4OLYL 2VZ1A 3RLSA 3FTUA 5E1IA 3D69A 1MCHA 1MWAA 1JZIA 4L4VE 1NGXB 1RVFH 4JR9L 4P57A 4BKSC 2QHRL 4HS6B 4JM2B 3UEQA 3MRJB 1URZA 3I2CL 1A3RH 4JPIA 1XGQB 4H0LC 4ZUSB 2WQSA 4IK7A 2OSLA 5JXEA 4NPYA 5HDBB 3FT4A 4G8GE 3FCTA 4FHJA 3UTTE 4WCYH 4ZFOA 4GLRI 4XB3A 1MCWW 3L3HB 1YEIL 4LGPB 4J6IA 2CHWA 4G72B 4ABUA 3A23A 4AQEA 4A7VA 1FGNH 4O58H 4WU7A 3NSFA 2PWFA 1KACB 4KJYA 1YN7B 3VI3A 4UT9L 1ZPUA 1VKXB 3VQ2C 3X3FH 5E94B 5DO8A 4AEHH 2D4DA 4MQXD 3QORD 2XTSA 3A21A 4QRTA 4AQ1A 1ADWA 4F7MB 1D9KC 1QI3A 2G2NA 3TBVB 3RHWF 3DUSA 3RGVC 3O6ML 3AU0A 5FCUL 3SBWC 3MJGX 2NNRA 3ABGA 2C34A 2DQUH 1YYLL 1WF5A 4ONHB 3OC5A 5EFIA 6CGTA 2EE0A 2IC2A 1EXGA 1GR7A 1P7QD 4UZUA 2G5BA 3L7FB 3NGBB 3V5KA 3GPSA 3CFUA 3VWKA 1MCQA 1QI5A 1KPRA 1YYML 2IGFH 3PP4H 1CFSA 1CLCA 1V3MA 2VZUA 2D03H 4HH8A 4DT2A 4NI6A 4OLVL 1KCVH 1FNLA 1UVQA 2D8KA 4D0BA 4LHUG 1T3FB 3TWYA 4Y4FD 4NLHA 3UGUA 2VW4A 3GSQA 4Z7VA 2O5XH 1E5UI 3U25A 3EJQA 4FADA 5C0FA 2PYEB 3HE7B 2RBLA 3O9WA 2RGSA 4XNQA 4XNUH 1A6TA 3EOTH 2OCCB 3II2A 4HHWA 5EU3A 3H9SD 3WDJA 3ZE1E 43CAA 4HIJB 1IKOP 2VR4A 3M1BA 4ZUWA 1OT2A 1QACA 2ZPKL 4UB0H 4KC3B 5JOPE 3DUUB 1D7FA 3GRBA 4P5KA 3HR6A 1Z66A 2C3HA 3SQRA 1RUAH 1R24B 3MRIA 1BQLH 5IJKA 1JK9B 3KJ4C 3K2IA 1MHEA 2VE6B 3T3ME 4EF3A 3BDBA 5DVKA 1M4KA 1S7TA 4YN3A 3C5XA 1NUGA 1XR8B 1U8KB 2RQEA 2Y06L 2P7TB 3ZLQC 2C3GA 2PW1B 1TVBA 2CQVA 3QJFB 5TFSH 1DDHB 1UD4A 3ZE0F 3ULUH 1QYGH 3S88L 3C5ZC 3S3JA 5D9SA 2GFBB 3BP4B 2XIBA 4BZYA 4IRZA 2OMZA 1BVLB 1VFBB 1X9QA 2NNCA 1XGZA 5T5FH 2BSDA 3RIFF 3PIQA 2VN5A 5I8EA 4UOW1 4WFFD 4AY0A 1YEFH 3DBSA 4GP5B 3RQ3A 2GUOB 2DYSB 3IDXL 4PWGA 3SQOL 4I1PA 1F00I 4NN5B 3C9NB 3OMZA 3DA0A 3I02A 4H8HA 3A6CH 1SEQL 3SJVE 3W5MA 2JELL 1QFUH 1ZV9A 1M7DA 3MNVA 3OKEA 5TE4L 5D6DA 2B1AH 3BUYB 1A64A 2FWOA 3PYCA 5B3SB 3G08A 3RPIA 3P11L 1SQ2N 3NJXA 3G5XA 2G60L 4GO9A 3RWEB 4GP8B 4PJAE 5SWQB 3BYYA 1IAKA 4ZS7L 2C9PA 3DX4A 5F89B 3D12B 3Q8CA 3KWUA 4D9RE 3V0AC 4Z7WF 2CRIA 3O2WL 2X6UA 3G5YB 3HOGA 4HIEB 3CCHB 1MCFA 3KL3A 4P06A 4HOZA 3NK4A 2OK0L 5LG1A 1BM3L 4ANVA 2HKHL 1YNTF 1A1NA 1T2QL 1EQWA 1SOSA 4HX1A 3NH7H 1XB3A 1XTMA 2XG4B 1KCLA 4L8SB 4G83A 3KM2A 1Q1JH 3D3VA 4EI6B 1F6AB 1I1AA 2B77A 4AUJA 4PJ7B 3B37A 3VFSB 3ZKXC 5BO1L 4NP4H 1NDMB 2NY4D 2O6FA 4XO4A 4FTVD 4P2RD 1U95B 1WBYA 3IMUA 5GRUH 4XZUB 4DGWC 3E8UL 2X5PA 2VDLH 2JTYA 1RJLA 1RUPL 5ACLA 5IHBA 1BYNA 4OZFA 4UF7C 4MXVE 4CU7A 5JQHC 2I5YH 4JFXA 1VADA 5DS8A 3K46A 4OTXL 5D5MB 1WEJH 1XH0A 1TQCB 2PTVA 3SN6N 1KTLB 3BPCA 1K8IA 1HN1A 3QXTA 3IETA 3S48A 2LV4A 5IG7A 1AO7D 1SJEB 2W0FB 3HRPA 4PAZA 2ZF8A 2NUTB 4HS6A 5G5DA 1JCVA 5TDPB 4ZRGA 1INEL 1VACA 4ABWA 5IHUH 1VDGA 2H32H 3MFFB 3N91A 4PM1A 5JA9A 4BE6A 1QSEA 1UXSA 4KY2A 4AVJA 6FABL 4JFZL 3PWPB 3UZEC 1K3IA 2H8PA 2XHNA 2AJZB 3FL7A 2BSRB 2DIJA 3O3EB 1I8IA 2EKSA 2YGQA 4XZ4A 4WWKB 3F58L 2G2RB 2GBVA 2I7SA 3P0GB 4PYHA 4XPAL 2Z9TA 2A2QT 3QQ3A 3TX4A 6PCYA 3INUL 1KB5B 4U1SA 3TL5A 4MASA 3A22A 1WZMA 1SNRA 2RH0A 4G1MB 1S7XB 1QAWA 3ZDXE 1TSRA 1JERA 1NFDF 3IS1X 4JHWH 3IGFA 5KVFL 4GUCA 2FJFA 1RP8A 4X5XB 3F7PC 2LLLA 4NNYA 4ZAKA 2VR7A 2YZ1A 1YNKL 1CFVL 3O2DL 4GBXA 4NEHB 1XZ0B 2F53A 4NNXA 1LNUB 1KXTA 4ABVA 4AM0Q 5AYUL 3DROB 2J1KA 3B34A 2BHZA 4JB9H 4X6CB 4R0LA 1GKEA 3SKNA 3HS0A 3MV8D 1Q9OB 3VTAA 2ISDA 3IF1A 4LQFL 1R5IA 1KEGH 3FO2B 3CFCH 1O6SA 3Q2NA 3ZQXA 2VXSL 2NTSP 5DI8B 4XVSL 3V10A 2X1XR 3SE8H 1FJ1A 3K7UA 1HDMA 4WKZB 1NGWB 5BRZA 4ZFQA 4GT0A 1DVYA 4YHZH 5ESAB 1DQQA 1J5DA 2ENQA 4XCEA 1GYAA 3QUXD 2I07A 3GLAA 1IE4A 4UM9A 1RK0A 1IX2A 3KPMB 2VLKE 5T3XH 5INCB 2G5RA 3ZSSA 4F7PA 5HVWA 2AJ3A 4GQPH 5JORA 3WKYA 3RIAF 2OP4L 2X4PA 5I73C 5GJTL 4JFHD 3QJQB 4N9GB 2J1WA 4HZ1A 1F5WA 2B4CH 3ZO9A 1N0XH 1A25A 3FO1A 1XZWA 3APNA 1P1VA 3Q43A 4M93C 5AKSA 5GS3A 4J3VA 2R4SH 4QHNB 1Z9MA 5HPOA 4I1NB 2E7HA 5LKNA 2LW3A 4HZLA 1GHFL 4AXWA 4X0KB 5CCHE 1ND0B 1OCWL 3HZMB 1WAPA 3LS4H 3IMWA 1KF9B 3RA7L 3FB5A 3GKZA 1XR8A 4JM0A 5I82A 4XXCA 2ZOLB 4KKZA 1DJSA 4N0CD 1PG7L 2BW4A 3LNIA 5F44A 4A7UA 3BP4A 4HV8B 4P9ML 1NKOA 2K4AA 5DQJB 2YARA 5CLYA 2Q6WA 3G7TA 2ZOWA 2WBJD 5IUSA 1LP9A 2IXQB 3NDYE 2RR3A 1XGQA 3B7TA 4K5PA 1EFXD 3BT2L 3RDTD 3EDFA 3VXSE 1JXFA 3QDMA 1F86A 4CDGC 1LK3L 1F4YL 4HD5A 3GHPA 4XP1L 3DVIA 1WBZA 3WKNA 4CBPA 2CPCA 3AREC 3FK3A 3MGAA 4UDTA 3FMGH 1EHKB 3V0HA 4KHTL 5EBLA 3TZVD 1ZJBA 2JJSC 4J4PA 4NDMB 1A4JA 5F7BA 1A6ZB 4Z7NB 4QD2E 1DBKL 4OJEH 1Q1PA 3EHBC 4IKJA 3J2PA 1FL3B 3G9VA 3P11H 1HYRC 5I0WA 3BH8B 1AXSA 4KK5D 2J6WA 2EECA 4K55A 1T03L 5E9DA 1ZLDA 1FNEB 3K2KA 3OLDA 4OIFA 2FX8H 2VWEE 3JT2A 4QO1A 1CLZL 3AXLB 3MRHA 4RMRA 5LBVA 3RNQB 3BC9A 4UV7H 4PJ5D 4XPFL 4MJ5A 1J18A 4XB7A 3WBDA 4GKNB 1OD7A 4I3GA 3NJHA 2EICA 4TUOA 1QRND 5D7IB 3VSTA 2NTFB 2XETA 3WTWA 2ATKB 2D4FA 4I9XA 1TPXB 2UZYB 5DHYA 4CL7A 4Y19B 3Q2CA 3D3VB 4ZYKB 3K6IA 2X9XA 3OAYK 5DRWB 4M8UA 4MLSA 1GGCH 5H2BA 2C5DC 4JRXA 4N2EA 2IH1A 1D5BB 4WKXA 4EUPG 1QYGL 4N2HA 3VWJD 5L4JA 4HLZH 3VXMA 1AR1C 4EZKA 1BLNB 1NPJA 4TUKH 3UO1L 3ZL4H 2YPKB 5JHDE 4UNTA 1NM9A 3Q2WA 4ECNA 2A9BA 3KLSA 3IDMB 4DTGL 3IT8D 2VO8A 3QO0B 1G94A 1A7OH 1GZHC 3U1SL 4DEPB 1NKGA 1HHHB 2OV0A 3A4DA 4LFHD 4MA3B 1H8OA 5ILTH 5ADOL 2D7TL 2PW2B 5KAQF 3QEQE 2GJZB 1U9KA 2JKIS 5JLZB 5IG7B 5E24E 1PKQA 1F3DH 4P5KB 4U7KA 4NQEE 2UWEA 3LEVL 4PVLA 1R3IL 1D6VL 2APFA 1TCRB 1ZY9A 3GXDA 4XP5H 3WNJA 3RFZA 4LARL 4PU2A 2QKIB 5J6GB 2ZNWA 3RVVC 5C07A 3HNSL 5G2NA 2HX9A 1YN7A 2LAAA 4ICWA 1KV7A 4PJGA 2HTLD 5E1AB 1ITBB 1MVFA 1S7TB 3OC8A 3OBAA 4DZBB 5KOVC 3CJJA 4G2AA 3KLQA 4M61B 3R0MA 4L5FH 4W70A 4YSRA 4JW3A 2IDFA 2ZICA 3QAZB 5IB3B 2CBTA 4PGCB 3GC3A 5T1JA 4J6RL 2YMXH 2ESVA 5KS9B 1DVFA 4MYWB 3FTZA 4UIMB 2VRQA 3DIDA 1BFOB 1XBDA 5E2VH 3V4VB 3WN5A 4KKQA 1TO5A 5D1XD 2OTUA 1FBIL 4IOSA 4JY5L 3V9FA 1G7QA 5EOTA 1KPRB 4AOFA 3APFA 2BZ7A 2VM4A 1HH6A 3RJDA 5T1LD 3VD3A 3DRTB 1RUQL 3DJTA 1J1PH 3LHPH 3NQIA 3E6HA 3OJ2C 2QQNH 4KZ0A 1HDMB 4XN7A 4ELKA 2R39A 4P04A 4XCFH 4K3HA 3HHRB 4XNQB 4IDJH 5HJDA 4FQJH 4YS4A 5E9AA 1IAKB 2OULB 1T66D 4QRRB 1CICB 3LVTA 3KCWA 5AVZB 3QC5X 3QEHA 4CW1B 1IC0A 4GMTL 1DEEB 1SDYA 4YHKL 4LCVA 2AXHA 2LOEA 3HR5B 5F7WC 2XZZA 3ZDYF 1NIFA 2PWHA 4JNXA 4ODWB 3FCUB 2AK1L 3CDCA 1ZLVK 2CIIA 4GKZA 1XL4A 1QHOA 1NCGA 2A9ML 3BZEB 1MJ7L 3CN4A 3T6XA 1GZPA 2AC0A 1EIBA 3WFEH 2OZ4L 1T0PB 1KSRA 1NCOA 3OQRA 4FKEA 1CT8B 2J8OA 3FUJA 1H6FA 1QD0A 5GGVY 1QASA 5AKRA 5EOQH 5C09B 3A3YB 4XBEL 1OGAB 4WSKA 3OPZH 1VFBA 3ZY7A 1YEHL 2ZG3A 2UUDK 3N04A 5J1AA 1FL6B 1A0QH 1JGLL 3MCG1 5CR8A 3EDDA 5CEXA 4KRMB 5E6IB 1A6AA 5HI3D 1QI4A 5EF3A 3W5NA 2DWTA 1CXIA 3OJVC 4Z0BL 4Y4KC 4RISL 3U36B 3GHBH 4XVJL 1AVAA 1D3CA 2CLVA 1I8KA 4OI7A 1YQVL 3ZDWA 4WAFA 4M8QA 2X4SA 2CBQA 2NLJB 2YC1A 4KFMA 3LSOA 3BFQG 4AGMA 1MCPH 4C54A 3V0DA 5IROD 3HLKA 3EO1A 3QDGB 1YDPA 3LHAA 1JZ4A 2QPDB 5IVZB 3PWPA 1T20B 1GGBH 1SHMA 3FSVA 4DO5A 1TZIB 3RWDB 1MIEH 3FO0H 2BP0A 4WWKA 3F7LA 3H9SA 4G7VH 3EOBA 1EO8H 3PUUA 4N86A 4OIIL 3VXQB 4G8EA 1M2VB 4EO5A 4CU8A 3CV5A 3KZ8A 3MCYA 1RAMA 2H3NB 4EPSA 4MD4A 2VIRB 1NFIA 1R34A 5E9DB 1AHKA 2Q8BL 1CXKA 3RP1A 1Q9WA 4HP5A 4XMTA 3SDAB 4XN1A 2DQIL 2OMXB 1FFRA 5DEFA 5T3XL 4F15B 3SOBL 5T1KB 3HAEG 4FABH 4P99A 2ZCHL 3QWOB 5KBPA 1CUOA 4LVOC 5KVFH 2JB5H 4WIQA 1SJXA 3DV6A 4HUVA 1UWYA 4O02A 4TSBL 1FFQA 3NMEA 1OIOA 3K8LA 1AO7A 4KX8A 4YX2H 3MV9D 3R0NA 5FYJU 2XQYG 4R2GB 4AVIA 3WTSA 4MZ3A 1IFHH 4M1CC 5D1XA 2B9AA 4AWJC 5ESAA 4L48A 3VXRB 1F18A 4JO8A 4WWID 4PPTA 4UQ3A 5D1XE 3OKMB 4XMLL 3D48R 4G6MH 3IETB 4M02A 4IRSB 5CN3A 3SPVB 1ZHBA 2AJ3B 2F8IA 4QXVA 1A2YA 5D7LD 3APMA 1KLFA 1NUFA 4BRVA 1H8NA 4HYTB 4MDRA 2XZAH 4R7DB 4HWBH 4WTQA 4AIZA 1ETJA 2W0LA 2VMEA 2WSKA 1Q90A 4P5RA 1QLEL 4WWPA 1MF2H 3L4ZA 5CILL 4F58H 1U8CA 4A04A 3T9WA 2CMRH 5EDSA 2NW3A 2C9SA 4Q56A 2FBJL 4P4RB 4NKQB 1AHWC 3O3EA 5G4NA 1JXGA 2QVFB 5SX4H 3C6LC 2E75C 4F3FB 5JNYA 1KXVA 1WH0A 3MLPA 2Z93B 5C0JB 4OV5B 4QMEA 3BIAX 2CLRB 5CLTA 4C55A 2DQJH 2P49B 4UQEA 5DSCB 4PV8B 3VFRB 4JJ5A 3N1MC 1RHHB 1WUNT 4QRPB 3UJIL 4YGVA 1IT9L 4N2FA 5DRZA 1YPZA 5K9JH 4ANKA 1L7TL 2V9RA 1G7JB 2OJ1A 4PJHB 1ES0B 1Z6JT 3U6RA 3UPAA 3QFGA 4TLUA 4TQ8A 3KYOA 1MFEH 4CNIA 3MUHL 5I1LA 3AADB 4JUSA 2V5YA 1B88A 3HUJF 3TZVA 5L8LB 5LAXA 3DIVA 4LLQA 3EH1A 1RUPH 2E6PA 2NX5E 4OM0H 4H5SA 5E00B 2ZUTA 3H8NA 2I26N 2ITEA 2K1MA 3MREA 5F0PB 4NOFA 3OL2A 2OYMA 4L37B 4CKVX 2E8ZA 5C6TH 4NM8H 2RD0A 4J3TA 4LU5L 4X6DB 5FW8A 5C0AB 4AK2A 1JDAA 2C9QA 3B2PA 2B08A 3EYUL 4A63A 1YEHH 5E8NB 3TP4A 5MENA 3DX6A 4MDJA 1T7XA 4ICXA 1I3VA 1TZ8A 4EQ2A 3BRFA 1RIUL 3US9A 1PMYA 4P48A 5I18H 3HRZA 4F9LA 3CSYA 2NXYB 1RLBA 3I6SA 5C0CB 3BZ4A 1OP4A 4MMZB 2FATH 3PQYD 4AZUA 4L8CB 3P9MA 4NZRH 5IBLC 3S3DB 1D9KA 2ARJB 2JIXD 5CD3B 1S3KL 3GNML 1EPFA 3JV5A 2GKIA 2HFEB 1J0IA 1JGDB 2IDQA 3DMMC 3FQYA 5E1HB 1ID5I 4ODWA 5BQ7A 1T83C 4NENB 2ATKA 1TNNA 3UROR 3ZDYB 3MVSA 3TWCL 3CFJA 1L9PA 2P24A 1AJ7H 4XAWL 5EHFA 2BY1A 5FC9A 2PO6C 3CFNA 3NESA 1I8AA 1OCOB 4X7CC 1AY1H 1ID2A 3PU7A 2QGDA 4NQDE 4U1NA 5E23A 4U1JA 2VR3A 2M8XA 1UD6A 4R4FH 3D3VE 2FX9L 4PSRA 1EO7A 1JXKA 4OKDA 2AZAA 4ORGB 4PV9A 1LP9F 1LWRA 3UTQA 3P3SA 5D7IE 3VX0A 1GZQA 2BNRA 4JFYA 4XMPL 1ML0A 3VH8G 1SMAA 5CCKL 4E0RA 4X4ZA 5BVJA 4N20A 3NQKA 4QRRE 2J1ZA 3NK3A 1MWAB 4OJFH 4ZNCD 4XODA 1KTBA 4G7SB 1RURH 2PUQT 2UWEB 3HRZC 2QADD 2V2XB 3LXCA 1M2OA 3MODL 4F9LC 4PFEA 5EU5A 3LKPB 3AQYA 1FDLH 3OXRA 4F9PC 1P0SE 4PJEF 3CX5J 3HB3C 2AEWA 2WLZA 1A9BA 4MD5B 2FJUB 3BKYL 1ACCA 2KUTA 2WZ0A 4P2QE 4NXKA 4QHUA 3CHSA 1FP5A 2ZXAA 5IMOB 1KELH 3HB3B 2E6JA 2YD9A 4WVRA 5C0NC 2O5YL 2VC2L 2VWEC 4X8CA 3WHE1 5I24A 1UFUA 4HCIA 4N1CA 3UTTA 1OXYA 3CMOL 1H3WM 1AYRA 4N4YB 2PR9A 4HFWB 3K5SA 3VXSB 2VN6A 2ZUWA 5FUZL 3CVCA 4PJXB 5KYWA 1Q9WB 2D73A 4C83A 3LN4A 3KPSD 3TJEH 5JZ7C 4NUJA 4P4KC 1X7TA 3WN5B 1CC3A 3CN0A 4P46C 3THMH 3ZSTA 2LTQC 3O3DB 2VDOL 3VI3F 4JZJA 5F7AA 4A6YL 1XF2B 4JQIH 5DZJA 2D7TH 1L7IH 1I7ZA 4Q0XL 1BV8A 3L3JA 3RX8A 3SODB 5I6XC 3QXDB 2KHAA 3DRTA 3KW8A 2XJKA 5CU9A 3VMOA 2G5BB 3L7FA 3IMSA 3IFPB 1XR9A 5I8OL 3FU6A 5D8JL 4YXLH 4NQCD 1VFAB 1BLNA 3C5ZB 3CIAA 1E9QA 1O75A 4L9LC 4D0DA 2DQUL 2AQQA 3DJ9A 1KLGA 3ETTA 2IQ9L 2DM7A 2UWEF 3ARXA 2K6ZA 3N42B 1O9WA 3I3EA 5IJBC 4Z3TA 1A2YB 2WXHA 4QRSB 4B7LA 2FIKA 1TZAA 5D1QA 2AITA 1DQLL 3RI5F 1J9SA 4GKZB 3TN0D 3W11C 3IRCA 1C5CH 2VDPL 2GSIA 4RVBA 2E27H 2WCSA 4XCNB 5DD0L 5EU7E 5E1AA 4XPFH 4MMXB 5J9PA 1HHJA 3AMKA 4F1SA 3UYPA 1A7NL 5KSAC 1A7RH 1HWHB 5DTFB 2ZUVA 4OLUH 2Z93A 2EDEA 4CJ0A 1K4CA 3EJYC 1AGDA 5IFJA 3NJVA 5I66B 3WIIL 3HC4H 1KJ3H 5FGCB 1A3RL 2PCFA 2IQAA 2LAGB 4OUOA 5EDXA 5GRZA 4APXA 4KO9A 4B96A 4KITB 1EK3A 1BGXL 2XUWA 4GQ9L 3RUGE 3NPSC 4AVHA 1OAUH 2BFVH 5C8JB 5IHWA 3HS9A 4MJIE 3ULVF 1X7QA 1BCIA 2A6KA 2OMWA 4H0IA 5FFGA 4XMVA 4XP1H 5AL0A 1AJ7L 1NGPL 3FF8A 3R7RA 3HG3A 4JQVA 1I1YB 5DLMH 1HXMA 2NR6A 4IW4C 4WY7H 5DC4B 3CZEA 3UYRH 5HGGS 3E6HB 4Y2DA 2C3VA 2YRPA 1A65A 1OLZA 1QSZA 3K8MA 4EIGB 3ARSA 3T5WA 5F2FA 3FQRB 2I60H 3LZQA 1QQDB 1VFUA 4HSQA 4NKDB 4M7JL 4X6DA 3BMVA 5JHBA 1CFBA 4H1LH 4UYPA 1BAWA 1AMXA 4ALAH 4I87A 1TETL 4AEEA 1KY6A 4OGAD 2YS4A 2ICWB 3GFUA 3ZYOA 5I18L 4EZMA 3RPIB 2XVBA 4KVNH 3VGAB 3BT2H 5D96B 4MQXC 2JELH 4G9FE 3NZUA 1NZRA 3FOMB 5DJYA 3QUZB 1AGEB 2PO6B 2FR4A 2H32A 3CN1A 3RY5A 3UH8A 1X5YA 1I9RH 2CUMA 1U92B 5FKPB 1R19A 1RXLA 4IIQC 4R3SB 1LK3H 1PZ3A 3EGDB 3VRJB 1E43A 1MFVA 1SYSA 3DOHA 3IKCA 4LVHB 1L9OA 4QTHB 3O6LL 3CFJB 2HVKA 2DQEL 2CNYA 2OM5A 3ZKSD 1I1AB 1MHHB 1Y7VA 4L8DA 3GSNH 1WYJA 1F1DA 1CGXA 3FONA 2QGEA 1XIWB 4A38A 2EYTA 4Z7UF 4B5ZA 1U95A 3MOAL 1CFSB 3AZUA 3P4LA 2DLFL 4MNQA 2R15A 4IBLT 2P5EA 2R2BB 4QYOB 3X1GA 2WUCL 1BXUA 5GGTL 1XSOA 1E4HA 4B53A 2X4QA 3ZL1A 3FAWA 1K4DB 1GA2A 1RMFH 3NSDA 4HETA 1AZRA 3UP1A 5EN3A 3TH3T 4JFYB 4LCYA 3K80A 5J6HB 2FJHB 2FJGA 3EUDA 5BRPA 3ESVF 3QDJD 2DQGH 1NQBA 3IJSA 4J3OD 4J27A 32C2A 1BOGB 1IEBA 4EAEA 4P4RA 3TBYA 2GT9A 4MJIB 3GM0A 2ZOKB 3UTOA 5IMKA 3KEHA 5JNYB 2W60B 4Q9QH 4PWFA 3J7HA 4GSUA 4U3HA 1F8TL 3L4YA 4A7QA 4I0CC 1EV2E 2Y5QA 4E41E 3VD0A 2Y5EA 4B9ZA 5IJDC 5MHSD 3MTRA 4AT6A 1HOCA 3TCLB 4I0PD 5DK0A 3II1A 2MQGA 4X5QA 3ILEA 3OJMB 4FMFA 4ZMZA 4FLHA 2HVBA 3SOBH 1N19A 4TULL 3IPFA 5J6SA 5D9SB 2Y3AA 1BVNP 2MEJB 4R5VA 3B1UA 1QX1A 5C7XH 3D85A 3QDJE 4ERSL 3DV6B 4HUVB 3D34A 5K9OA 5IQ9B 5I8EB 1JS4A 3L5XH 15C8H 1UXWA 2GK2A 2WKOA 2WLIB 2VITA 2WANA 1BZQK 5FHBH 1AIFA 3WNOA 1G84A 5A6MA 5IWLC 1MW0A 2EDNA 1D5MB 2F61A 4J8QA 5GJSH 2BSSB 5DJXA 2C7UA 1Z9NA 3VFTA 1DQIA 1ZHKA 1OGAE 1QO3B 5I2IB 2H6OA 4JG5A 2AEOA 4I48B 5GGTA 1X3DA 1MW3A 3CU1A 2A1WH 3KDMA 3GMOB 5IIEB 3G6JE 4RA3A 1K72A 4ZOBA 4FQ1H 2Z4QA 1P7KB 2HWZL 4CC4A 2ILLA 3IFOA 3M1BB 5D2LE 3P9MB 4ZUWB 1VEPA 3REVB 1FNFA 2ADYA 5CO1A 5BO1H 5JTWA 3MYZA 3H53A 3HVDA 4KXCA 5IR1A 5BO0D 1N2RA 2IFGA 3TYFA 4NBYB 3JWDL 3KWTA 3ZKMC 4OZFG 2GCYB 1LQBC 3WKQA 5BW7A 5HHMB 1TQVA 4NZDA 4ETYA 4U1HB 3KMDA 1MXDA 3KPNA 1FHNA 4BKTC 2EC9T 4ANUA 1YPZF 5ADPH 4JJ5B 2BOCB 3TC9A 4TMPA 3NPSB 3B3BA 5DU7A 3T8XB 4OKVB 3HZMA 3LTVA 3PDGA 3DJZA 2WWKT 4HGWA 3F6LA 4PGZA 3QISA 1MNUL 1JI1A 4H13C 4ELDA 3RVUD 1SEQH 2O5NA 1JMZA 3RZCB 2FNBA 2WLKA 4NBZB 4ODBD 4Q6IC 4U6HB 4FFWD 1Q38A 3A67L 3GSRB 5DC2A 4Y4HA 2ED6A 1XB8A 2X9ZA 1AP2B 2X70B 4QR7A 1P2CB 5AW3B 4ZW3A 4QOKD 4C56E 5BQDA 5DQ9A 1SN5A 3QEUA 4BDVB 1M7DB 3MNVB 1A9BB 4Y9CA 1IVTA 3K6NA 3S6CA 4JDEB 5C3LD 2C3VB 1XWVA 4QHUB 5GGSA 3ZE0B 1G9NH 4GSDL 4HUWB 2HYMA 1JP5A 3H9YA 1K85A 3CSYB 3F12A 2DJUA 3WXWL 2WN3A 2E59A 4DEWA 1HKLH 1KFGA 4S11A 3DOSB 3OV6A 4WWNA 3D18B 1M7IB 2UVFA 5DJZB 4JPKH 2NY2D 5AWNL 4Z5RB 1KMGA 1ZCRA 3L6FB 5DMGC 3QULB 3FOMA 5DJYB 4L4TD 4JKKA 4NQEB 4XPBH 3VM5A 2X2IA 3FJTA 3MLWL 5JUEL 4Z8FH 1OPOA 2X88A 2YZ8A 1U92A 1S5IH 2HX7A 2NY3C 3KGTA 4GKNA 5FKPA 4AKQA 2I25N 3L4UA 4P3CH 5D6CA 3VXUB 2X6MA 3LPGA 3WN5C 1T89A 2P44B 1RSYA 3QUGA 4QY8A 5F6IB 1DP0A 1HT6A 4QWWC 1NGZB 5LVEA 1E8WA 4U1JB 3C5SA 3M8OL 4Y19A 3G6DL 3HG5A 4KRPC 3OZKA 3QZLA 5BXFB 2BVUA 3QUZD 5K59F 1YUHB 2YXVA 4PSPA 4A2FA 3S8GB 3GEWB 1BF2A 1SJVA 3FHEA 4AYFA 4WHCA 4DO4A 4LDEB 4JG9A 3B2VL 5DD3L 3LIZL 3TJPA 1F1AA 1NAKH 5BRQA 4AX3A 3TJHC 1M57B 3QG6B 4HPOL 2HA1A 3CDGA 4TKWA 3TZVC 1TTRA 5C70A 5E70A 5GSRA 3LIZH 4DH2A 5E08L 4M7ZB 2ICCA 1EMTH 2Y7QA 1IQDB 1C16B 4LHUA 3V4PH 4AENA 5BVPH 3FSOA 2GJZA 5E6SB 4F91B 5DRXB 3NJNA 4ADGA 1OY3B 2GC7C 3TN0B 2X4NB 3CLEL 5DHEA 3NEXA 4M7ZC 3F5WA 4NQCB 3DARA 4J39A 5AW7B 2G2RA 1KT2B 2R29A 1SOKA 2EDRA 2P5PA 2ZUQB 3L3KB 2W60A 3MKGA 4MCNA 4TXVB 1KFAL 3NFSL 1JZEA 3P4NA 5DT1H 1X5HA 5FKAB 2WBXA 3FB7B 4ZTEA 4HUCA 3NIFF 1EGJA 1GY1A 1FFTB 4OM1L 2WTOA 1OOWA 3GXTA 2VZ3A 2ICEA 5M7QA 4GINA 3MGTB 4GBXB 1E9PB 1NFDE 4JN1L 5J13C 4FEMA 5GRVL 3ZRCC 4WO4A 3V52L 1OQOA 1RHFA 2JCCF 4P8QA 3RL1B 1U8JA 1H8SA 1KTJA 4GUOA 2HCZX 2O72A 5C0RL 2ZJSL 2WBJC 3VFGH 3KPLB 3PNRB 1FZKB 1HH9B 2NQCA 3ZTNH 1ET8A 2WZPD 5IBTL 2W95A 3L4VA 3D6GA 5D1ZB 1FE8L 1CG9B 2ICWI 1KCWA 1DN2A 4K9EL 2IPUG 4GRLD 3FULA 3K6SA 2XN1A 4XVUC 3BEWA 3MBWA 1WCQA 3P73A 5HDQH 3T8MA 4ZI8A 4Z77B 1JPGA 2FB4H 1P6WA 5F1IA 4IBUA 2XX1A 1MNUH 3HJEA 3S4SG 5EIVA 2OTWA 3LRKA 3HLAA 4WCYL 1RK0B 1UWEL 3KPMA 5CEYB 5MP6L 5IK3A 2NY6B 4AEIH 3EFDL 3FDWA 4OCYL 5KUKA 5M95B 4BZ1A 3W39B 3WEOA 3MRHB 1FGNL 2ZX6A 2K7PA 1JHLL 4ODVL 3RWIB 2IANA 2IAMB 1W9XA 3REVA 3MRKA 3BVNA 1TJHL 3IBOA 4NYLB 2GQHA 4MCZA 2VTFA 4PRDB 3G6AB 1EHLL 2H1XA 1UJ3B 4P2OC 2Y5TB 4PJAB 4ZPTB 4PW9A 4OFYA 3UTPD 1FNAA 1KBBA 1OF2B 3MUJA 1XH1A 3CC1A 3OAWA 4AUYA 2FEEL 4OCSH 4R7NB 2VAAA 3QJZA 4X6EB 1KYOJ 1IM3A 5JIPA 1JWUA 4JRYB 4OLYH 5DC9B 1KBGH 1W6WA 1JPSH 4R4BA 5C0IB 1MH5A 1PG7H 2N4IA 5TK4A 5CEZL 3AT8A 5F3BA 1LQSR 4NKIL 2AAAA 1MUJA 3LEYH 1AXIB 2YPKA 1HI6A 4FXLA 4AYEC 4G8FB 4HV8A 5DQJA 2G0LA 4HVBA 2P5ED 3H42H 4RAHA 3K3QA 2XV3A 4R26H 4F7TA 3MA9L 4X6CF 1DBBH 1OM9A 1UUSA 4KMLB 1HNYA 4P2AA 4MCMA 2D2CC 1J0YA 5E6ZA 1V05A 1CD1A 5T3ZH 1T1XA 3CFBA 3JV6B 4IMLB 1PIFA 4OQTA 3S96A 1JK8A 3U36A 1V8HA 1MN4A 2X1PA 2FH6A 4U6YB 5T1DL 4UDTB 3QI9C 1XV8A 2FK9A 3GZOA 4FXGB 1FNHA 3I9GH 4PTTB 3WXVH 3MRQA 4LCUA 5DUPH 1AHWA 3EO1B 3QDGA 3QEQB 4OR1A 5DRNB 2WNKA 2YUXA 1SFHA 3MU3A 4IRSC 4BK8A 1KJ2B 3F12B 3HBPA 1FNEA 5E6RB 4KJYB 1O9VA 2ZCKL 3P4OB 2VERN 4G71B 5HGDB 3PWPE 3HZYB 4J5VA 3OGCA 1MWAH 2PLTA 5DGRA 4CMHC 1S9XB 4PJ6A 4XBPB 2RFXA 5KW9H 1R5WB 3FTWA 3L6FA 3RL2A 1UXWB 2VITB 3HFML 3AWEA 3MO1A 5T1KA 2BS71 5E0QA 3UPRB 4ZJ9A 4J1UB 5LGHH 5I1HL 4OW6A 2XWBB 4JY4B 3SPCA 1DVXA 3CZFB 1G1KA 5EOTB 4Y1AE 1PD0A 2H2PC 4DKAA 4Q58C 3FTGA 2WUBH 3D39A 4DPAX 3WLWC 2DTMH 4I3RH 4NFDA 4EMZA 1OK0A 3KPTA 3UZQA 4L1LA 2C4FU 2VKXA 4X7EC 3QJXA 1OVZA 5F8QC 4MD0A 4QYAA 4LCYB 2R56L 3U2JA 1CZ8H 4DGIH 5BOZG 1QUNA 4NC1E 3VI4E 1AO7E 2ZCLL 1GGTA 3IJSB 1PAMA 1QPPA 4IRSA 4FA8A 2IIJA 3QG6A 1B4TA 3BUQA 2QQLH 2G3NA 4OQTL 5C0FB 4FGMA 3QRGL 2OXHA 4KUZL 3ECBB 4OCWH 4IU2B 3V0GA 4AIZB 3NZHL 3T2LA 2BIMA 3MTXA 4F7EB 2VKWA 3T65B 1Q8MA 3ZOAA 1WIPA 3BVTA 3IXTB 3QUML 3S4SB 1CQYA 4RX4A 3DHUA 2X4NA 4DUXA 3E0GA 5HHPB 5EF1A 3U9WA 2CH8A 1B90A 3L3KA 1RH8A 4GEJA 5JW4N 1Q0EA 4YBLB 5BS0D 1KUMA 2LVEA 3DHMA 4PBXA 5IW6A 2XIDA 4PV8A 2UY7B 3H9ZA 2CRMA 3NJIA 4NHCH 2R51A 3BQUD 2A6JB 4I3SL 4P23D 1IC4H 2PW1A 3RGVA 5F6HJ 3T2QA 2WVSA 3T08A 5E6IA 3QP3A 2EUZA 3MLRL 1BFOA 3GLDA 2EXWC 4IDLA 3O2DA 1QFWI 1HYSC 3QPQC 4CN4A 4BZ2L 3LD8C 4JRXD 4TSAH 3UDWA 2I5YL 5IM7B 3O6LH 3H1ZA 3SKJH 2DOCA 1D5MA 4JHZA 3PL6D 5TE6H 4EIBA 5I23A 2IFFL 5KWYC 4KQ3L 4OLUL 4U31A 5DZ9A 4MJHA 3MLTB 5CUSH 4F2FA 3BKCH 3W37A 1OP9A 1ZHKB 1EAPB 4YPJA 4H5SB 3L3GA 5E2TL 4WUKL 5IROC 2QSCH 4MVBD 2V8MA 3IBEA 3KPOA 3KPSA 4M5SA 4L37A 4WI8A 1A6VH 3SDDC 2OZNA 4FQJL 1HSBA 5C1MB 1UWEH 3CFDA 4I2XE 2YQ3A 4V2BA 1NLDL 1KJ3L 1QWHA 2FWOB 5EU4B 2D9CA 4GW5A 4N5UA 4X99A 1LWJA 1X6NA 3UIZA 5CEYA 2R0KL 5B8CB 4AL8C 3K72A 1BBJB 4XXWA 4HUUB 2Q9OA 4WO0A 3C6LD 4KKNA 2QKSA 4TM9A 3V52H 4ODVH 3E8VA 4JG0L 5DJ8A 4FLOA 1MJ8H 1QBMH 2A9MH 3RWIA 4BCXA 4GNKB 3SKUD 3NJMA 3VFGL 3VI4B 1W0VB 2X09A 2PCXA 2QGCA 1GZPB 3MJ6A 2CKBH 3QHTC 3DLQR 4OCRH 4U1LB 4BFJA 4WTXA 4BSJA 1MRFL 2G3MA 3VXMD 2IOMA 4HSCX 3NRPA 3BRDA 3T1FA 2AJUH 4L1BA 3A4FA 1AXTL 5FA3B 1PKOA 4NJ9H 1IGTB 1OCZB 4LIQL 3F83A 2FO1A 3DKHA 2A74C 4XNDA 2KS0A 4JRXE 1KG0A 1PF3A 3AS3A 5AVWB 2F58L 5GISH 1FFNB 2ZTBA 2B59A 3O0LA 3WJMB 4WJG3 2ZSWA 3UTQB 4H8WH 1I8KB 4HPOH 4TNVK 5FOJA 3KLAB 3LZFL 3T4YA 1USZA 1P2CA 2HTKD 2XKUA 4J6RH 2F1EA 5HYJA 4NRXA 1HL4A 5E2UL 4HF5H 4DFIA 1JHTB 5IP4A 1FIGL 1KBKA 4FQIL 2B8OT 4TVPE 2E27L 1MFMA 2CNZA 2GTWB 2VR8A 3QDGD 4MJ6A 5HYIA 1I7RA 4IJ3C 4LPUA 4CVWA 4EDXB 1AIZA 1KN2H 4MXQC 1BQ5A 2E4FA 3O45A 3S34L 1DDTA 3PHAA 4Q89A 5AL8A 2V2TA 2HN7A 4WHTB 4LEXH 3ATEA 3VWKC 4IIQA 5DGQA 5TQ2L 2EIJB 1A4AA 3EBAA 4HULB 2XPGA 3ESPA 7PCYA 4QRPA 2Q2LA 3Q3GB 3L3OB 4Z5RA 1GJWA 2J8UE 1X5FA 2X4RA 5D71L 3T0DA 5CP3H 5FUZH 1FRGL 2ZE0A 4EN3A 4N85A 1XDTT 3KJ4B 1ZANH 4ODTL 2JQZA 4D8OA 1S46A 5K1NA 2JMRA 4CVUA 2IBBA 4FG6D 4HMDA 1UA6L 4L29A 4MXVF 1JF5A 2OFQA 4IOSD 3LEVH 5DCCA 1SGKA 5T1LB 3E1F1 5TH2A 2FBOJ 2QPUA 1HS6A 4LL1A 5EUOB 2ED9A 2GUOA 1G6RA 4FFVC 3PP4L 4IRJC 3DSFH 5EBWA 4JY4A 5BUGA 1N6VA 3TBCA 1FL5B 1O9ZA 1Q9OA 5TE7H 1N0LB 3UTPE 3I02B 4FQLL 4GW4A 4UT7L 4YPGB 4AIEA 1H6EA 1MI5B 1VENA 1REIA 3P0VL 4ILDA 4TOYL 5AAPA 4NKOA 3D25A 1QFWM 3F7VA 3MRMA 2JJWA 5JQIB 1MFAH 4YDIH 3Q1EA 3TNMB 3L95A 1R3JB 4X7FC 1RIHL 3HB3D 3QZBA 2D9QB 4N0UA 4TS6A 1KZYA 1Q9LA 4UQAA 4EKJA 1QRNE 2GJ6E 3LRSB 4MAUL 4NIKB 1TSHA 2F19H 4WHYH 5E7BA 5EZIH 4UM9B 5BNXD 4HIEA 1JNLH 3FT9A 5AALA 2PTUA 4NJAL 3BAXA 4N22A 4F7PB 2Z1KA 4CU6A 3FT1A 4MCYB 5A2JH 1NC2B 3RX9A 4DSYA 1AQMA 4G42B 4KJQC 4W9DC 3TWCH 4JPWL 2X4PB 4RH4A 3WNPA 3EYQC 2DL2A 3CN3A 3FFCA 4YBLC 5HGHA 1NCNA 5D2LA 4FNRA 1BXXA 1LDPH 4N2NA 3CQPA 1MRDH 3LRLA 2E86A 4HK0B 2IWKA 2J3SA 1HHJB 5HHPA 2V2WB 3CAFA 3SDCD 4N8VA 4A7SA 3UTSD 3J07A 1DDHA 2HRPH 4WI5A 1HCVA 2EE9A 3BCFA 1GC1H 2CBOA 2DV6A 1OAYH 3MGTA 1KCUL 2OSYA 3ME0B 4OZFB 4ZFGL 2J71A 1MFEL 5IQ7H 1WFJA 3U6RB 4LSQH 1JAEA 2VDML 2GK0A 3CHQA 3EJSA 2BNUA 1FPTL 5A2KH 4IIZA 1J1XL 2B0SL 3QO1B 3VVWA 3P9LA 3VG9C 5D96C 1T1XB 4AW7A 2VRAA 1ZA6A 2WNXA 4N90D 1F1GA 3JWDH 3SE3A 1G6RL 3V4VH 4CN1A 2QMJA 1LP9B 2NYYC 3EO0B 1CBVH 3L1GA 4FG2A 1P7HL 1SM3H 3RY6C 3EYUH 5ISZA 2HG5A 4H0HB 1AZCA 5AW9B 5IVXB 2GHZA 4OF5A 3C5JB 4MD5A 2IVFC 2ZYHA 3WEAA 5E8NA 1WWBX 2FZ3A 3EOYG 4PJ5B 5IV2B 3W3BA 5KYXB 2LVCA 1A9EA 2AJZA 1RULL 5IGXH 5E6IC 3PGCA 1WQVT 3R18A 5I15H 3QQ3B 1KJ2L 3FN0H 3BKML 1TJGH 3HBZA 3EYVA 4I0PB 3ZUNC 1OSZA 4W1TA 4F58L 2C4FT 4P0DA 2G30A 4CSTA 2QQLL 1EDQA 2CCLA 2JLPA 3VFNA 3PCYA 3VXOA 4Y4FC 3COOA 3DDFA 3OB0H 2OBGA 4ERSH 2XPYA 2P52A 1NOAA 1PX4A 4YDVB 4PRDA 1PTZA 1W91A 1JWMA 4HX1B 2OL3L 2W65B 1GKOA 3S5LG 2ZKWA 2FO4B 1HJCA 4XNAA 2H32B 3LZLA 3JYCA 3OAZK 5DMJB 2VDOB 3PGDB 4JFPB 5I0ZA 4HISA 2VDPB 5IUCA 3OXSA 3IWUA 1BXVA 1TUPA 2KKQA 1YMMD 2NPLX 1O7DC 2NTFA 5AOLA 2CHNA 1R5IB 3QUXA 4S0SD 4NQSA 1N4XL 1EJ8A 1J11A 4NWUH 4ZYKA 4LEBA 3FNKA 1RZFH 3BFOA 5E1GA 5DI8A 2F5BH 4N8UA 25C8H 3MLSH 3K4ZA 2OLDA 3JWNC 5I1KL 1NGWA 5BRZB 3ILPA 4XNMB 5AD0A 1Z3GH 1I9IL 2EIZB 3UXFA 2R2BA 2I07B 2BOBB 2O6PA 4M03A 1FH2A 3HUJB 2VABB 2JK5A 3N0PB 8PAZA 3HZ3A 4UT6A 3SYCA 3IDMA 5TJWK 1U8MA 3HZVB 4Q9BA 3WXVL 3CZGA 5K9QG 2X2JA 1QPXA 3OXRB 4F2EA 3WLBB 4PTTA 4OIIH 1SEBA 2AQTA 3L13A 5JIDA 2YKKA 4RFNC 3S4SA 4LGRB 1C12B 2DQGL 4I8DA 4JM4L 5MI0B 3V55A 3POCA 3NRFA 4MJ6B 4FABL 3S37X 3VFMA 2XSKA 3ELQA 3IFNL 3P30L 1E6OH 2OMVA 1JZGA 3ESMA 4CVZB 5HYSG 2J8UF 5F88A 3WMSA 4Z7OF 1EEUA 3MJ9L 1ADQH 3QI9D 2BC4A 4FKHA 2D31B 4X7TA 4G11A 5IFAL 4AMXA 2A83A 2APSA 4BK5C 4NN7B 3IYLW 4OD1L 2FE0A 4G1MA 1SYVB 5K39B 5F7HA 3K2UL 3QR1A 3UAEA 3WFHA 3F58H 2AJVH 2NZ9C 2Y7NA 4P23B 2X87A 3V0IA 1NBYB 3O6FD 3JWOH 5CIPH 1ICTA 5FS5A 3RZCD 1J0ZA 1RU9H 2R4RH 1WZAA 1J5CA 4XBEH 3X11A 3UFIA 4DKTA 4LVOB 5TDOB 4Z3GA 3D33A 5HHME 1JTOA 2NDFA 3K2MC 4FHKA 2XWRA 2MRYA 3UBHA 4AH2B 2OK0H 1XT5A 3KWWB 3O8XD 1G7QB 1J10A 2XQBH 1NCWH 4LCIH 5D70L 1QQDA 1HWGB 3KXFB 4D9LL 1AC0A 5IQ7L 4KZEH 2LU5A 1DQQB 3BQUB 4UTAA 1CDHA 1DO5A 4IHOB 1WZ1H 3BFWA 4CSPA 5DYOA 5B8CA 2VLJA 1MVUA 2BIIA 2HJFA 5TE4H 3SDXE 4HC1A 1NC2D 2EDOA 4PWIA 2KH2B 4M3JA 1MG2C 4RSVA 3KLHD 2KC0A 5EC2B 4PJ5E 1AGEA 1ZSHA 3QEHB 3HNTL 4CW1A 2FL5B 4WEEA 1UD5A 1FH5H 2XWJB 3VE0B 4TUOB 1E9OB 4UDUA 4J28A 4PBDA 1NJ9B 2WHVA 4HK3J 3AQXA 3MV8B 4IOFD 4MAYD 2C9VA 1YPZE 5DHYB 5JXAL 1ZHLA 2F7RA 5H2BB 3S5LB 4IKLA 1XIWA 4BQ9A 2EILB 1MXGA 1CLVA 1BMGA 4QOKE 3BD3A 2WVTA 5FYLE 1N68A 1T1WB 3LQZA 4NQVA 1P6AB 1G9MH 3B8YA 3OD3A 5MEPA 5MP6H 5DWPA 5J3HC 4OKVA 2PXYB 4GFXA 4FZ8L 5H35B 4HGWB 3UBXA 2F68X 3RGHA 4Z7OB 1E5BA 5IM7A 4KK6C 3TBBA 2V5MA 2DYPD 4MMZC 3OKLA 2DW5A 4A2LA 2JI2A 3IGAB 4PJ9A 3DX7B 1BOGA 4YVUA 1WTLA 4ZO8A 1N59A 2LTQB 1OCCB 1UD3A 3HIZA 3PAVA 4KNUA 4Q7DA 3W0WA 5H4ZA 4J3OC 1AP2A 3IDJB 4OLZL 2NY4B 3EO0A 4Z18A 4RAVB 4JHAH 3LSOB 3P0VH 5DF0A 2QKIA 4JMNA 3TA4D 3UJJH 1YDPB 4NN5C 1IBGL 3M88A 3OZ9L 3FQWA 4PJ5A 5IV2A 5L2KE 5KYXA 1OSEA 4NNPL 5TPWH