2GPZA

Transthyretin-like protein from salmonella dublin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
111
structure length
110
Chain Sequence
MILSVHILDQQTGKPAPGVEVVLEQKKDGWTQLNTGHTDQDGRIKALWPEKAAAPGDYRVIFKTGQYFESKKLDTFFPEIPVEFHISKTNEHYHVPLLLSQYGYSTYRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transthyretin-like protein
publication title The Crystal Structure of the Transthyretin-like Protein from Salmonella dublin, a Prokaryote 5-Hydroxyisourate Hydrolase.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar dublin
molecule tags Hydrolase
total genus 26
structure length 110
sequence length 111
chains with identical sequence C
ec nomenclature ec 3.5.2.17: Hydroxyisourate hydrolase.
pdb deposition date 2006-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2gpzA00
1QABA 2G3XA 1GKEA 2QGCA 1SOQA 3B56A 1TTCA 3DJZA 4FI6A 4TNGA 5CLZA 5JIMA 5AKTA 3KGTA 4HIQA 3M1OA 1ETA1 2GABA 1QWHA 3A4DA 3NEOA 2H0EA 4IKLA 4ANKA 2QGBA 1E4HA 3P3TA 5K1NA 1ETB1 4WNJA 1SOKA 3D2TA 1IIKA 1F86A 1DVSA 1ZCRA 2TRHA 3I9IA 5CN3A 1TTRA 2G2PA 5JIQA 4TLSA 3BSZA 1ZD6A 5CLYA 2G5UA 4TLTA 4I87A 3ESOA 3TFBA 4I89A 3P3SA 1SN2A 1SN0A 4PWHA 1TLMA 3IMRA 5FW6A 4ABVA 1DVZA 3IMWA 2QELA 3CFNA 3GRBA 5E23A 2WQAA 5TTRA 1E5AA 1TT6A 3FCBA 4PM1A 1DVQA 1DVYA 2B16A 4TNEA 5DWPA 4IKJA 3IPBA 1FHNA 1TFPA 3DK2A 2G4EA 2QGEA 4N87A 4TL5A 1DVXA 4TKWA 2F8IA 4TL4A 5AYTA 4HISA 3IPEA 4FI8A 3P3UA 1BZEA 3Q1EA 5L4JA 5L4IA 3A4FA 3HJ0A 4PVLA 1KGJA 1GKOA 4TQ8A 4Y9BA 3IWUA 4IIZA 5DEJA 2ROYA 4N85A 4DESA 3OZLA 3CFQA 1BZ8A 4PWIA 4PVNA 4Y9GA 3I9PA 3SSGA 3P3RA 4DERA 3GS4A 3DJTA 3NG5A 4TQHA 3IMUA 1SN5A 4QRFA 1THCA 4ABQA 5BOJA 2H0JA 3CN2A 1G1OA 2GPZA 2IGLA 4AC2A 2ROXA 4D7BA 3GLZA 4L1SA 3NEEA 1IIIA 1TYRA 2QGDA 4IKIA 2FBRA 2B15A 5EZPA 5JIDA 1BM7A 3A4EA 3IMTA 4DEUA 2TRYA 4HJSA 4PWJA 3CN4A 2F7IA 4PWGA 4WNSA 5A6IA 3CBRA 3CN3A 1TSHA 4IKKA 4PMFA 5HJGA 1TZ8A 5K1JA 1TTBA 5IHHA 4KY2A 1IE4A 2H1XA 1RLBA 1Y1DA 3ESNA 3U2JA 4PWEA 5L4MA 3FC8A 3IMVA 4FI7A 3NESA 1DVTA 4ABUA 4TQPA 2G4GA 4Y9EA 3GPSA 4TM9A 4MRBA 2H6UA 3BT0A 2G9KA 3CFTA 3GS7A 5AL0A 5AKVA 3I9AA 3IMSA 4N86A 3CN1A 4ABWA 4ACTA 4HJUA 1BZDA 3DK0A 4PVMA 4YDNA 1IJNA 3QVAA 4PWFA 4TLUA 2FLMA 2NOYA 1BMZA 3U2IA 1E3FA 3ESPA 4DETA 2QPFA 3CFMA 5AL8A 4DEWA 1X7TA 4QYAA 4L1TA 3KGSA 4MASA 5E4AA 3W3BA 4Y9CA 2G2NA 2H0FA 3NEXA 1FH2A 5EN3A 2G3ZA 1TTAA 1X7SA 3CXFA 4HJTA 4TNFA 5FW8A 1U21A 3DJRA 4I85A 1OO2A 3CN0A 1THAA 3DGDA 4PWKA 3DIDA 2B14A 2B77A 4Q14A 5CLXA 4TQIA 1DVUA 3DO4A 3D7PA 3GRGA 4WO0A 1Z7JA 4IK7A 2B9AA 1KGIA 5FO2A 3OZKA 2H4EA 3IWVA 4AC4A 4YDMA 1F41A 3KGUA 4QXVA 5CNHA 5E4OA 4MRCA 4PMEA 5CM1A 5FW7A 1ICTA 3GS0A 4Y9FA 3DJSA 5CR1A 2PABA 4IK6A 4TLKA 5L4FA 3TCTA 5AKSA
chains in the Genus database with same CATH superfamily
1FRGL 5FM4A 1V8HA 1TJGL 3NA9L 4XPGL 3B2MA 1ZK5A 2VABB 1ETA1 5GS3A 2DQHL 4LEBA 2BSDA 3KJ4B 1OT1A 3APCA 2HT3D 4EN2A 1R24B 3IJSB 3B9KC 3CXDL 1LXMA 3IRPX 3WD5L 1J10A 1GCYA 3CVDA 3VDBA 5JW4N 1LO5A 1NICA 4PPTA 2EIEA 2GJJA 5F9AC 3NDYE 4YC2C 5B8CA 4QOKB 3RVTC 1PY9A 4LCWA 2YPLA 1WV7T 2CO6A 4KKLD 5FCUL 1DVYA 2Y4SA 3IPBA 3SYCA 2GJPA 1T7ZA 1OP5H 4E9XA 4F37F 1EJOL 1IGCL 3MRBB 3IEAA 3T6VA 1C5DB 1T0PB 5DS2A 1JRHL 4L37B 2G0KA 3U1QA 1DJWA 1GKOA 1MFEH 4PV9A 3TBYB 4P9HH 3QEQE 4X0KA 1R3KA 1R5WA 3HTLX 1UWFA 1HAUA 5DHVH 5F96L 4AJVA 2QEJA 1KG0B 4LCVA 4N2NA 5GS1B 1FFTB 1SMDA 4NRXA 2R27A 1H6EA 4MBRA 3RB5A 1X5LA 2A1WL 1MRCH 2WBKA 3QORC 1FPTL 2XFXA 3VGEA 4BH8A 3AS2A 3NIDF 2VZVA 1JPEA 4Y88A 2CLZA 4O58H 2VLRD 3QI9D 2ITDA 1NCNA 1NOFA 4BUHA 5CR8A 5J5EA 4OFIA 1FP5A 1JK8B 1TZGL 2G5BA 5ID1B 2YD9A 2YGQA 4N1CA 1MH5B 3I3BA 5D5ME 5F9JB 5D1XC 1H5BB 3O3BB 1CF8L 1J12A 3VFGH 5EFIA 5DUMH 2UX7A 1EBPA 2P28B 3MRFA 3QEUB 4FULA 4PJAA 2PO6D 4JY4A 5CD3B 1NEUA 5C0BD 1MOEA 1ZVNA 4IJ3B 2DQTH 1WD9A 1MNNA 5JDSA 5DJ8B 4OSUL 4IHOB 4HC1A 4ONHB 2GSGB 3HG3A 3PS6A 3PWLB 4PY7B 4FQJL 1NKRA 4F7CA 3CDCA 3HHSB 2QSCL 2GEQA 3T5WA 1B0GB 1QLFB 3D06A 3GXPA 3DO4A 4CDGC 1A1MA 4X99A 1ACXA 2XJLA 3JVGA 1K5WA 1INEH 2EVFA 2EDEA 3JT2A 4JG9A 3HBZA 3SCMD 4N0CC 5GZNC 3OG4B 4DEPB 4HUKB 3FQTB 4AW7A 1NCIA 5EZOH 4OJFH 3UAAA 3ELQA 1IFGA 2OZ4A 4BRJA 2P7TA 3HG1A 2EE6A 2IDCA 2V9QA 5C0BA 1Y1UA 1GC1C 3AG2B 2F0CA 3H4HA 5JIMA 3MLTA 5DO2D 4KKAD 2WK2A 1G5GA 2H2PD 1HESA 3GFUA 3ILQD 1TQWA 4YHZL 1AY1H 4XZUA 4JFVA 4PCSA 1LO5B 1NCJA 2D7QA 3H8NA 1N68A 1KB9K 4X4ME 3T71A 3HI1B 5B8CB 5JXAL 1EANA 1EGJA 4FDWA 3UCQA 2YA1A 3UDWC 4K4KA 4LCWB 2YPLB 4RCAA 2CO6B 2XN9E 3S7GA 3LEXA 1AR1C 4D9LL 4RFOL 4BZ1A 4PS3A 4QTHB 3LVTA 3C9NA 1RZGA 4LP8A 5HHOD 5FYKH 4TPRH 4MLSA 1A9VA 1UXWA 3A4FA 4RGMB 1EDQA 4UQIM 4PV9B 4KQ4L 3WU1A 5CGMA 4MA8H 2FHFA 4OLXL 4X0KB 3MLUL 2Y07L 1R3KB 1NPJA 1R5WB 2F7RA 3HNSH 1RK1A 1I7ZA 3WUWG 4J3OD 4HBCH 2BVEA 4NRXB 2WZ0A 1BJMA 4NQSA 4W1TA 3DO7A 3MRIA 4F24A 5CBEB 1NWOA 1IARB 2XFXB 1QTYT 1YEFH 2XIDA 4MZ3A 4BH8B 1W80A 2GC4C 1PD1A 3QG6A 3D07A 2GUYA 4LSTL 3PV6A 1WF5A 2CLZB 3BVTA 3TH3T 2CR3A 3SPGA 1QRNA 2ITDB 2NNCA 4L29A 4OCYH 2Q87A 3TPKA 1RUPH 1FN4A 2G5BB 5DC4B 1A65A 1S7SA 2YQ2A 5I24A 1EERB 3RKDC 1LJMA 3BQUA 1G9NH 3HE7A 5IQOA 3JWNH 4XO8A 2CKBL 2YAHA 3NJVA 3WS6C 1F42A 5EFIB 3TO4D 3MRFB 4PJAB 4JY4B 1KCRL 2NOYA 2R1WA 2YA0A 2B7DT 3MPCA 2VAJA 5C0AA 5JDSB 4MXQC 3MLWL 2XPYA 4G8AC 5E08L 2BVQA 1FFNA 3NFSL 5DGQA 4ZXBD 1G0XA 4ODSH 2JSFA 1VJSA 4F7CB 3MV8E 5MI0C 4NC0B 4XE0A 4N28A 5IHZA 2AAVA 3BIAX 3TBVA 4U1GC 1A1MB 3CVIH 4X99B 4J27A 2YFOA 1FLRH 4H8WL 4N2MA 3D4GA 4WFGD 4UQ9A 5LBSA 4U05A 1IM3A 1T1ZA 3K4ZA 1KCSH 2NTFA 4Y19D 4XCCH 1NCAL 4H88H 2P7TB 5CEXA 3W1ZA 3HG1B 1IX2A 1HQ4A 4U2YA 3I84A 3LH2L 3A6CH 1QO3B 4BFIA 4QRRE 1G94A 3CXHJ 1S7WB 2V2XA 1D2PA 3IT8D 1IC7H 3MLTB 1BQ5A 1N70A 4NSKA 1L9NA 5FXCH 3TJHD 3LNDA 4XBGA 3ZUCA 1EUTA 1NFAA 3TONA 4W70A 4PS8A 4HAKA 4XVTL 1EIBA 1P7QD 1XX9C 2EDXA 2XWEA 4DP7X 1KENH 4FNTA 3D2TA 3L4VA 4XZUB 2CIKA 3WDHA 5JMOC 2IMMA 1UUSA 4G5ZH 5JIQA 2NSQA 5IFAH 3EF7A 5MEQA 3ESOA 4PWHA 2MTAA 4JPIB 3N6YA 4Y1AE 5BRZD 3LRKA 4N1EA 2CCLA 3LEXB 1NDGA 1JD7A 4LOFA 1XWVA 4ZUTA 3C9NB 1RZGB 1FFQA 1E4KA 1CXHA 1IBZA 3G6JE 2VKXA 4JFPA 5EU6E 4APQA 4YSTA 1UXWB 4J8RA 5D7JC 3F58L 4X7TB 3RHWK 4QMEA 1SUHA 1JGUH 4DJMA 4PJAF 2O1AA 2XVBA 4IBQA 4XNDA 1RK1B 2AK1L 3HC4H 1T6BX 1IO4C 1R9FA 3CBKB 3VSVA 4YHIA 4NQSB 1W72A 2YXFA 1OLLA 3DO7B 3MRIB 3J2PA 3NABH 1Y7VA 5L88L 1XGUB 4OLYH 2EUVA 1KB5L 3QG6B 4B3EA 4XHJC 4IKKA 5E5MA 3PV6B 5DMGD 5IHHA 3AAZA 4PG2A 2XXMB 4U6YA 5JHBA 1QRNB 3EYQD 4FI7A 4L29B 4NEHB 5CUSL 4X6DA 4OQTL 3O4OC 1FN4B 4JO2H 1VFAA 2EZ0C 1S7SB 2NQ3A 3QUXA 4WV1C 3BQUB 3D3VD 3FZUC 2IMNA 3HE7B 2WVTA 2WXLA 1WA0X 5A40E 4G9DA 1NCTA 4D9QE 2LVEA 5F6HI 5JUEL 3QQDA 1OAQH 1X5GA 2R1WB 4FERA 2YXMA 3FSAA 4FRWA 1AG6A 2AJXL 4UOQA 5C0AB 1SDAB 5J89A 4NZDA 1OAUH 4GFTB 1RK7A 2BVQB 1FFNB 2YWYA 4HV8A 2OR9L 5F1KC 4AH2A 1Z6JT 3N85L 1NBZA 4IOSA 8PAZA 5IHZB 1TNNA 3TBVB 2AXHA 3H9SD 2FD6H 1C5CL 5AW9B 4L48A 5ABDE 4UMSA 3VD7A 1IAKA 3K2MC 3W81A 4Q4EA 2DIJA 4MRCA 3UJTH 3VXME 2HLFD 1MFDL 1IM3B 3UJJL 1T1ZB 2QQQA 4JDTH 4EPSA 2WJ7A 4IK6A 5JZ7D 3ILDA 5CEXB 1YYMH 3GBML 1PZDA 1HQ4B 1F4WL 2CRYA 4BFIB 3Q48A 1TTCA 4MB3A 3IK2A 2V2XB 2LLNA 4NSKB 5E00A 3O2VL 5JW5A 2ESVE 1MQKH 4XBGB 5D6DA 3L4YA 3ZRFC 1KGYE 5F7KC 3UYPA 4OZGE 2IWEA 4EIBA 2IEPA 2LABA 5ACLA 4PTUA 4MD0A 2W92A 3MSPA 4JO3H 4M56A 1YNLH 4GQZA 4M5SA 2CIKB 1NMBH 3LKOA 4GRMA 4RNRA 5MEQB 2I24N 3H9SA 2GTQA 3TFBA 2YD5A 2HFEA 2NQDA 4N0YH 4P5TD 2YD2A 3NH7H 1ZS2A 4HFUH 4WI0A 1KYOK 4P3CH 1F1GA 3TIDA 4ZUTB 2WGNB 5CINL 2YXVA 3ECBA 5GGSY 4FMVA 3ZDYE 4JFPB 4APQB 2LV4A 1G43A 1XGPA 4J8RB 4QXGL 5F72S 5FGBA 3HFFA 5BO1L 1HHIA 3LXBA 4GNKB 4JRFA 3QARA 4PJIA 5CJOL 1OK8A 5A6LA 1VPOL 3EJYD 2AABL 1F6AA 4UQEA 3CMOH 1A6TA 1WK0A 2HRLA 1RZFH 2KYIA 1NBCA 5E8DL 2JJTC 1E4JA 3WLWD 4YHIB 4FQIL 1W72B 2YBRA 3KH4A 5DHEA 3K6OA 5B39G 1J1OH 4P5TA 1KB3A 4NZTL 5GS1C 1FVEA 1UCBL 4P2AA 5MEOB 2Z8RA 5E5MB 5AFAA 3AAZB 3OXSA 4U6YB 1B90A 5G4MA 3IMVA 1OQOA 3X14A 4X6DB 2EEBA 3FOLA 5TDPA 1VFAB 2ZXDA 1V7MH 3QUXB 3WTWA 2C4XA 4P4RA 3OKMA 4N9GA 5IMMA 2IALA 2YAQA 3VH8A 2BVOA 4G9DB 4AEHH 4PJXE 3C5JA 3QQDB 4LIQL 4U6VL 1H5BC 2CUMA 3KYNA 5EWIH 3WFEH 1TFHA 4F7TA 1TYEB 4OV5B 4UU9A 3OTTA 1CL7L 5E03A 3O11A 4E68A 2WWKT 2AQRA 4IJ3C 5EN3A 4HV8B 2OS7A 4E41D 3CAFA 4G8GD 2Q3ZA 5IY5B 3F5WA 4AH2B 4XNZB 4GO6B 3IKKA 1NBZB 4YEFA 2WP3T 4ZFFA 2AQ1A 5LBVA 5C0NC 4ZMZA 2FIKA 3IETA 3ZR6A 5LCVA 1IAKB 1LHZA 2EEFA 3PUUA 2VJ0A 4NI6A 2P24A 3DI2B 3V79C 1USQA 2FECI 3VXUD 3N2JA 2CM5A 4DEPC 4YHOH 4EUPA 5AKSA 4KV5F 5DJYA 12E8H 5GJTL 4EKXA 2NR6C 4AEEA 2ZXCA 4PHXA 1ROWA 1DJYA 2NW3A 1C8PA 1I7TA 2X6MA 2QJDA 3UYPB 3L81A 4PTUB 4MD0B 1N67A 1S9VA 3DX8A 3LKOB 3HC3L 1DN2A 4GRMB 4XVSL 4RNRB 1R1CA 4KK5D 2HFEB 2Q3XA 3N9GL 1KXVA 3CFNA 1XSIA 4OJYA 2IC2A 1LVEA 4OGZA 5B8CC 1VAHA 4X6DF 1QFWH 1U6AL 3MREA 1FHNA 3CV5A 3DK2A 4NAMA 4PJ9A 3ECBB 4NFDA 4WY7H 4ZTOH 5I8KL 3VXUA 3VFPA 1CR9L 4PRID 5EOTA 3KYOA 1HHIB 1S3KH 4PJIB 5HHME 1MCKA 3HPLA 5BVPL 1F6AB 3DBXA 2ZXGA 1VZIA 2VDOL 3BEWA 3DECA 5EDXA 1MF2H 1A6TB 5H2BA 1J9RA 4LOUD 4OCSL 1A14H 2HT3C 2ALWA 1BIHA 5D7IE 1L0PA 5EEUA 2X9WA 3F7KA 4KO6A 4P5TB 2CR6A 1GL4B 5BOPA 1FVEB 1J1PL 3HMWL 4UV4H 5AB1A 5F1NA 1BZ7A 3OR6B 3RFRA 3OXSB 2UZYA 4O9HH 1KELL 3X14B 3BESR 3MTRA 2D3JA 2ZWZA 1T20B 3FOLB 5TDPB 3TS8A 4X50A 1AQDA 1T1WB 1OE2A 2HKHL 3ZKXB 1A6VH 3D4YA 3MBWA 3OKMB 1OAKH 4N9GB 4P4RB 4UT6A 5IMMB 1BXVA 1NCDH 2IALB 4CBPA 2ORBH 3VH8B 1MIEH 1NGQL 5BUAA 5GIRA 4BE5A 4GAGH 4PWFA 1CDYA 1G1CA 3C5JB 1JZ8A 2PPCA 2XICA 3K5RA 3LEVH 4F7TB 3KYNB 2ODIA 1O0VA 3EJJX 4LSQH 4UU9B 3O11B 3QDJD 4ZOBA 1ZXKA 5CGBA 4MMXA 3VW3H 3FQUA 3BFWA 5AYUH 3B37A 5IVXE 1BVLB 3F5WB 4W6YB 1DUZB 3U4AA 1GVIA 4HT1L 4ZFFB 1IBGL 2FX8H 2FIKB 3BKJL 3IETB 3T65A 4O02L 3WE1A 4TNVF 3ZT5A 5DO8A 3TEUA 2P24B 3UTTA 3JVGC 2XG5A 1AO7E 1W0VA 3VE0A 4NKOA 4NUGH 4X8XA 5E2WH 5CU5A 1ZT4B 3SJVE 4EUPB 1VEOA 4JPSA 4L1HA 4PJIF 5DJYB 2BOLA 3BUTA 1CDHA 3CLFL 3KE0A 1TO4A 3SE4A 3V0WH 2H0PA 1QPKA 2NW3B 1RVFH 2PPFA 4IKLA 4PJEF 1PLCA 3PF2A 2KHAA 2WXJA 3UEZA 5IREA 1RLWA 4G7YH 1ZGLA 2OPCA 4UNUA 1MVFA 1S9VB 3DX8B 5K69A 3VGGA 3K4AA 3D0LA 4MVBC 4JZJA 4LZKA 1BQRA 2ARWA 4D9RE 2CDFA 1UG9A 2QADD 1QOKA 1QMUA 4HMDA 5TTRA 4AM0A 4NJAH 3DYPA 4QJ4B 5CP3A 5DWPA 3MREB 2A6KA 3VXUB 4PJ9B 3QK0A 2I85A 3VFPB 5INCA 5A7EA 2LHAA 4JRXA 5F7NC 1QFWM 3KYOB 5EOTB 5C0CE 3HPLB 4B9GA 5DURB 2WUBL 3DBXB 3H2QA 1C1EH 1I8UA 4B7IA 2HWZH 3BEWB 5DO2C 3VD2A 5H2BB 3AC0A 3ILQC 1CFBA 1MFCL 2H0JA 2ZXWB 5DFWH 3PNRB 3ARUA 4JFXA 4PS4L 3ULUL 4YVUA 3HS9A 2WXPA 3CFCL 1FIGH 1IQDA 3NIFB 5K9JH 4S0HA 1BZ7B 1FAIH 4ZFOL 3PY9A 3QPXH 3LRGA 3WFBH 2UZYB 5F7EL 4PBXA 4H26A 2ZONA 3WN6A 2R0KL 4K5LA 1AQDB 2FQEA 4DP0X 3MBWB 4LQFL 2H6UA 3N06B 1YEEL 3KDMA 2P8LA 3UIZA 3LZRA 3SDDD 2JKWA 4AYSA 4J7RA 4JPKL 5GIRB 5LXGH 3QA3A 3BQUC 5FV1L 1UWGL 1U8HA 2IWKA 4HETA 4E5XA 5ANMA 1NOAA 1LQBC 5KSBA 3QFJA 1R46A 4WCYH 2QHRL 4GMSL 3WEBA 5HI4D 1UACH 4W9HC 5E4AA 4HWEL 4MQXD 1J1XH 1KB9J 2KERA 1PW3A 4MMXB 3FQUB 4XPHL 4WFFE 1ORSA 4QHLA 4S1RH 3NP4A 5T1KD 3W11D 5AVXB 2DI8A 4MHHI 1EBAA 4CC0A 5GGQH 1NSNH 3MZGB 3SE9L 4L05A 3T65B 4Q9QL 5INDB 3UTTB 1TZHA 1A64A 3MRMB 2XG5B 3VGFA 4FYRA 1AQMA 1W0VB 3VE0B 2AZUA 4NKOB 1EFXD 4WEBL 3OPZH 5I6OA 3VXSA 5I1IH 4OD1H 2R7EA 4C59B 2D03L 4LPWA 2FIRT 1B3IA 1IZJA 2X89D 1L9RA 5FYKE 1KT2A 1RP8A 2NSXA 2MEJB 2ZP0T 1OTTD 3MV7D 1JZGA 4O4YL 3WKML 1ZGLB 5MENE 1NAMA 1EZSA 2UZIH 1QLEL 1U58A 3PHOA 3Q2NA 4JUSA 3D0LB 4UIMA 4JZJB 3VQLA 3NIFF 2WLNA 2C7UA 2CDFB 4L18A 3BO8A 1Q9WB 1W8NA 2VLMD 2VR8A 4R97B 2YRPA 4HAFA 4YWGL 4AM0B 3LN4A 4ZO8A 1D6EA 3ZL4H 3ZDXE 3W0WE 2A6KB 3NSYA 5J7CC 2NRDA 5INCB 1UJTA 3KCWA 1A3QA 4JRXB 4QR7A 2W95A 3WENA 1E4KC 5C7XH 4TUJA 1JPSH 4MJ2A 4APQC 7PAZA 5GSRA 4JEGB 1A66A 5LBGA 1MIML 4H2CA 3TJHC 4Z1PA 3JWNE 4YHML 3QNXA 4KPHL 3WY2A 5ICZA 4JFXB 3QUYA 1UTDA 2C3VA 2PWEA 4JM2D 4Z7WE 3IDGA 5C9KA 2Q0ZX 1IQDB 4Z77A 1CUOA 2YPKA 4QHUA 4OM0H 1U8MA 3F7QA 5CMAA 3DOSA 1MDAA 4H26B 4PFEA 4MDRA 3KXFA 2Z7UA 1SF3A 4HKZA 4Z3HA 1H3PH 2GY7B 3KDMB 2P8LB 3QUXC 1T1YA 3X3GL 1RJLB 2BJMH 3QA3B 1LO3H 2EYTA 4KRLB 2GSIA 2D3LA 5AQ0A 1U8HB 4E5XB 4F3FA 5ANMB 5KSBB 3QFJB 1SYVA 4HK0A 2J43A 3BZFA 1X5YA 2HVJA 1J9CT 4CVWA 2G3ZA 1ORSB 4QHLB 1OCWL 3UTQA 1EX0A 1JNNL 1IFRA 3KLLA 3RJOA 2DQCH 5L8JB 3RWGA 1F02I 1MJ8H 4K94C 2Q7NA 4EO5A 5E94A 3ZYZA 1AI1H 2VERA 4XNZC 4IK7A 1KYFA 1R3IL 4EI0A 2DOCA 4H1LH 3D39D 4ZTPL 4ALAC 1ZS8A 3EYQC 4WWKD 3MXWL 2AF2A 1TZHB 1E40A 2CUHA 5KYWA 4M8QA 2NY0D 5E4EB 2C1OA 1CI3M 2UY6A 4Q0XL 1BVNP 3VXSB 4TF4A 1RP9A 2PYED 1MCWW 1RL1A 2R7EB 3DJZA 2MMXA 1KT2B 3N0AA 4OZHA 5IHUH 4AVJA 1E4WL 1P9MA 4GG6E 4YFEA 1BF8A 1GZHA 2QZ5A 5CZXC 1ECYA 1NAMB 5T33H 2NCEA 4KRMB 3PHOB 4P5MA 4UIMB 3S5LB 1JCVA 3HI5L 1A9EA 3UCRA 2C7UB 2Y22A 4GPVA 5D4HA 4ZUUA 2PF6A 3BO8B 4PN6A 3GXMA 3R4RA 3IXTA 4U1MA 4TNWF 4HLJA 3ZT7A 3LN4B 4B3VA 4M1GL 1D6EB 2DL9A 4TNEA 3V4VH 4ZMXA 3KPMA 1G9HA 2VIRA 2HLFC 4HIIA 3B7SA 5KG9A 3L8QA 1CGUA 4BHUI 3L5XL 3D5OF 4UTAL 4TUJB 1A6AA 1DVFA 4I2XE 3HFMH 5GSRB 3GTTA 4Y9GA 3VRJA 4XP5H 3JV4A 4JKMA 2X6UA 1QI4A 5CZVL 4LCCA 4LEXL 4R2GD 5E99H 3LH9A 3QNXB 5ICZB 3QUYB 3EJSA 2C3VB 3IDGB 1TU2A 2VC2L 4OQTA 4AIZA 4Z77B 4FEIA 1ID5I 2OMBA 1VGEL 35C8L 4W93A 3V9EA 1N8ZA 2B0SL 2YPKB 1U8MB 4P5TC 4QHUB 5CMAB 5TE7L 2ZOKA 3WE6A 3K72A 3K5SA 4MCYA 5K1JA 4NHCL 4V1DE 3DOSB 1UM6H 1TG8A 1RUKH 3KXFB 5LNDA 3HVDA 3IF1A 4HKZB 3S4SG 3UTSE 1OAJA 4FG2A 2J56A 2MNJB 3RUGE 3AXLA 4LU5H 3IMSA 4AEIL 1T1YB 4DF9A 3WAKA 1NA8A 3ZKXC 3D48R 2CO2A 2EYTB 1NCOA 2GSIB 2R1XB 5D1QE 4F3FB 3HC0A 3P02A 2BK8A 3WMQA 4C54A 1SYVB 1DBKL 1E6OH 2CM6A 2VDLB 3EJYC 3I85A 4HK0B 4NKQB 2CMRH 4W4OA 3BZFB 3WNOA 1NINA 3O9WA 5F0LB 1KTLA 2HVJB 2EKSA 1BEXA 4R7XA 2BY1A 3UTQB 5BW7A 2R0LH 4RMRA 4QHKJ 4HLEA 5B3JE 2CA3A 1KYOJ 2DLIA 3F05A 3RWGB 2D0GA 3GJEA 1QSEA 4XWOD 2W8CA 1FZMB 4B7LA 1F97A 3TT3H 5E94B 1M1XA 1UGKA 5I30H 2ZKXA 3UBGA 1N5AA 2A0LD 1G9EA 1A2YA 2WKOA 4I48A 1ZS8B 5T5FH 2IADA 1TJMA 3DTUB 4M7ZC 5KYWB 1YEJH 2DM7A 1MCDA 3OKDA 1G1KA 1ORQA 4M8QB 4NQQA 1UC6A 4TMPA 3ZHNA 4Z76B 4WI4A 2C1OB 2F53A 2VW6A 2UY6B 4LFHG 25C8H 1KY6A 2YMOA 1ZANH 3B9AA 1ZDSA 3C6LD 5I6XB 4HUMB 1EH9A 3GSOA 4OZHB 4O2CA 3OR7A 2CLVA 3L1OL 2AJSH 2YO3A 4B50A 2IQ9H 3GHPA 5J12B 4KRPB 1HL8A 1YC7A 5D4JA 5DI8A 1ED3A 5AWNH 4HH9A 4EN3A 4P5MB 5TGBA 3NOIA 3UPAA 4ZUUB 3LKPA 4AGLA 2DYRB 1UM5H 3W9DA 1BW8A 4WI3A 3IXTB 2DJSA 2QELA 4J3WA 4U1MB 4LLAA 2FQGA 4ZI8A 4YHKH 3PP4H 5I1JH 1MFVA 2ZWKA 4LLYA 2FR4A 3KH3A 1PX3A 1KXVC 3KPMB 5JTWA 3JVFC 4RFEB 5EEZA 4HIIB 1LQSR 4L3FA 4UQBA 5KG9B 1E65A 3QYMA 4J6IA 2P42B 5AW1B 4PJ9C 2CIIA 2GFBA 1W8OA 4UNTA 1A6AB 5TDNA 1DVFB 4BKSC 1VZGA 3VRJB 1NOLA 3NTCH 4HIXH 3JV4B 5I1AA 3ULVL 2XA8H 3P3RA 4LCCB 4ODBD 4AUJA 1JL8A 1GMIA 3TF7C 2I60L 3ORJA 3RNKA 4UOZA 2VRKA 1TU2B 1DBJH 2X4PA 4N4YB 1KTDA 4AIZB 4DOHB 3W5MA 3EJPA 1ODUA 1TOXA 2OXHA 1N8ZB 2CGZA 2DB8A 1KEGL 2ZOKB 2I7SA 3K72B 2WBJA 3O6FA 3PNWA 2FGZA 3WE6B 1JHLL 3ESNA 2A9DA 4P0DA 3IF1B 3VXRE 1X9LA 3ZHLA 5KJ7E 1QW8A 1MW2A 3AXLB 4X80L 3WNNA 3QZOA 2V9TA 1BBDL 4FG6C 5G4OA 3UAFA 3HC0B 3RBSA 3K6FA 4OZHF 1CXKA 4UYQA 1RCYA 1KLFA 3O9WB 4M29A 4U33A 1KTLB 5LKNA 3W56A 2EKSB 4LOUC 3BVNA 4LRIA 1D5RA 4AI7A 5C1MB 2AXJA 2E7LA 1IAIL 3J8F7 1LO4L 1OGPA 1QSEB 4J3OH 4IRSB 4MMXC 5BOZG 4NIKB 1TETL 5CLXA 2H1LM 1M1XB 1BFTA 1SLUA 3FUFA 3KPSE 5I1GH 1FF5A 3CZUB 1N5AB 3E8VA 1K6QL 1A2YB 3ZYJA 4I48B 4XCYA 4F8PA 2IADB 4PMEA 1ORQB 5IROA 4UZSA 2A83B 2GBVA 2F53B 2XX1A 4POYA 1J05A 2FQDA 4W9CC 5BZDA 5HI3C 3U4KA 4Y89A 3LXCA 4PLJD 4XNBA 5IVZA 5LBSH 3GSOB 3MOAL 3A4DA 1QWHA 4O2CB 5KBPA 3OR7B 1MI5D 3JUYA 3SE4C 3IDIA 4YXLL 5C0RH 1FG2A 3CBJB 4LGSB 3L3IA 2YQBA 3M88A 4OT1H 5I8OH 2RH0A 3QGVA 5DI8B 1ED3B 2DBLH 4HH9B 4R8WH 3FAXA 4EN3B 2C34A 3CD4A 5TGBB 3BT2L 3LKPB 3CZEA 4LEOA 4PCTA 3P3SA 3W9DB 3O2WH 4WUKH 4HWBA 4JZJC 3HN8A 4ZDHA 3QFGA 4LLYB 2FR4B 4BCZA 4IGBD 4R97C 4UYPA 1KJ2A 4ZG1A 5FUCE 2Y6TE 1P1VA 2G4EA 5GGVY 4BKTC 2OSLA 4YUEH 2GSMB 4EZKA 4JRWA 4J6RL 2F74A 2CIIB 1J8HD 4HULB 3FT9A 1AOZA 5TDNB 1D5BA 2WQRA 1FE8L 4TSBL 4YE4H 4ZW8A 1I4FA 3QQ9D 5I1AB 3QUKA 4EZMA 2B5IB 4ZJ9A 1WWCA 2DQUH 3QZWG 4NQDD 4F57L 3WEOA 1QR4A 2C1PA 1GGBL 4PVBA 4UBDC 3PV7A 2ZYSA 3RNKB 3APFA 3JQOB 3UYRH 1UT2A 2QR0A 2X4PB 1KTDB 1L9PA 2Y25A 3EO1A 4QXUL 1XAUA 3QSKB 4DTGH 1PLGL 4HJSA 4NGHH 4XWGH 2OXHB 2H26A 2YMTA 2BW5A 4FP8H 2QADC 1AJ7H 3FQ2A 3O6FB 2WBJB 3PNWB 5LDUA 4MJHA 1GGCL 4J39A 3DX0A 4U1IA 4BK5A 5HDBB 2XBDA 3R1GL 5TE4L 5FYJL 3V6OE 1Z2KA 2ATKA 4PRHE 1A3RH 3GUTA 1IUZA 1N7ML 3O4LA 1KYDA 4B9YA 1RZPA 4DO6A 2CALA 3WI9A 5C6TL 3C8KA 4OCXL 4XNAA 3D85D 1M6OA 5D7LD 1KLFB 1NFDA 2AMGA 5CCKH 2DLFH 1PZ3A 1L3NA 1WA2X 3BVNB 2P1YA 1U93A 1HL5A 4TYUA 4F9PA 4ZOAA 1KSRA 1MCJA 3WNJA 1CD9B 3B34A 4AK2A 1HIMH 3GI9L 3CFKA 1UH4A 4KTEH 4IBYA 3RDTD 4K9EH 5A16A 4D0BA 4NKMA 2GJRA 3NSFA 5A2IH 3ME0A 4XCYB 3ARQA 5A2KH 2KI6A 2HFFA 2R69L 3LV3A 2V8LA 2VN6A 1DE4A 3RY4A 2FYVA 4ALAH 1J05B 1KBBA 3TTYA 3GSVA 1CFSA 3VFMA 5E4EC 4CN6A 5BZDB 5D7LA 4HXAH 5ELIA 5IVZB 3F2LA 3J07A 4QI3A 3SGDI 5BV7L 3ULUD 4JFQA 2VMEA 3QDMA 3ABMB 3IDIB 4R7NA 2PWHA 1FG2B 2IBZY 5FO8A 1OTSC 3L3IB 2NMSA 2WSKA 3ARRA 5DT1L 1Z9LA 3VD3A 3VGDA 3JT0A 1DQMH 2W91A 1G7HA 2CO3A 2HJKA 3C08H 4LEOB 3U6XA 3KBEA 4I89A 1SN0A 3QQ3A 3VSUA 4YHNA 4S1QH 2A9AA 1C16A 4BQBA 4RAHA 4GH7B 4ZDHB 3SOTA 3COOA 4MBOA 1KJ2B 4IRZL 4POZD 2ZKWA 4WUUD 2VW7A 1UYWH 2OSLB 2VDOB 1M05A 4TL4A 3ASNB 2RALA 3EDKA 3CSPA 3SHSA 2F74B 3FJTA 4BFEA 3DRTA 3E2HB 1UD8A 1D5BB 1DBMH 1I4FB 4UT9L 2EECA 3QUKB 3I6LE 3B1TA 4XO4A 3ARXA 1JNLH 2C1PB 4ATWA 2XI9A 4DIXA 4ZFOA 2XBZA 4BUQA 5HXMA 1AZVA 1MCOH 1V05A 4C4BA 2QGDA 2QR0B 2VXTH 5LHDA 3CZJA 3VYNA 3S3BB 3EO1B 4B41A 3ATAA 3EOAA 1UADC 1S6NA 3VMPA 4I1RA 2H26B 2IBZX 1P4BL 1EXHA 3HKZA 3MGOA 4KDWA 2DIAA 4AL8L 1QSFD 1TMCB 4U1IB 1SLXA 4JG1H 3FC8A 4PWEA 5MP6H 3U6XS 4G71B 1FYTD 1KPVA 2ATKB 2QLVB 1W16A 2BSCA 3GUTB 3O4LB 2VT0A 3LQZA 5BUGA 5D8JL 2WXHA 2NY3D 3RAJL 4RRPA 4LPCA 3C8KB 4OLZH 5AW7B 5B1JA 1M6OB 1NFDB 3HAEH 3II1A 3MV9E 3QCUH 3BH9A 1FCGA 1U93B 1XBDA 3EW3B 1X9RA 2Y7MA 4GKSA 3W37A 3Q8BA 1UXMA 1XB3A 5E5LA 4PWKA 3CFKB 4WWNA 1A4BA 1F2XK 4I0PD 2YLKA 4Q6YA 3STLA 1MCPH 2XVKA 3PWUA 5A16B 4D0BB 4UCFA 2J55A 2YSTA 3MOBH 2M2DA 3Q5OA 4K2UL 4NKMB 3WXVL 3ME0B 4K7PY 3U25A 2HFFB 3UOAB 4LLUA 3RX8A 1DE4B 1YEKH 3BAJA 4XOEA 7FABH 4FFZL 1F11A 2K9FB 2XLLA 4QRPA 3VD5A 5G55A 3GSVB 1CFSB 3RP1A 3QEGH 3L1EA 3LHPL 2VKWA 5LXVA 4JFQB 4NERA 4EMZA 3QDMB 3ZE2E 5I6XC 4R7NB 4AYBA 5FO8B 1TVBA 2FK9A 2J7LA 3AS1A 4EUPH 5ANHA 4WWID 1P9MC 4QF1A 3T0WA 1OY3B 1ET8A 1GZHC 3VWKA 2NY7L 5I1EH 2P5WA 1G7HB 2HJKB 2Y3AA 3QQ3B 4N2OA 5D93B 4YHNB 3QHZH 2BIOA 1C16B 3EDFA 3DX2A 5TJWK 4JQXC 3NVQA 4WWKC 1Z9MA 4XCNA 4JM4L 1JVLA 2B08A 5T3XD 1AE6L 3DRTB 5DD1L 4NNXA 3VFVA 1MFAL 7TAAA 1NDMA 2GW5A 1CLZL 4LFHD 3OJVC 1DVFC 4XMZA 2HUEA 2ZCLH 4ZFOB 4LSRL 2AQTA 2H6OA 2Y6SC 2FEEL 3CUPA 4DVBA 2QFRA 4JFHE 2V0AA 1OCCB 4FG0A 2OYLA 1QEWA 2XVGA 3EOAB 3M1BB 1JNJA 1IL1A 2DL2A 3D4ZA 4PG9A 3MGOB 1BJ8A 1Y6NR 1IE4A 1HK6A 3BWAA 1PX8A 1KN2L 2A4CA 3N1PC 3HPJA 4WI8A 1CTOA 1KPVB 1UOWA 2JI2A 4F15B 3GC3A 2A77L 5IQNA 5KSAD 3CFTA 4JPVH 2XFGB 4XMLL 3LQZB 3SKNA 5EORH 4TVSa 4BHUA 2VZUA 2E27H 1OOWA 3LDBB 1I1FA 2AMUA 3GDBA 1AFVH 4CVUA 4J3XA 1F1AA 3RRQA 1RIUL 1LNUA 2Q8AH 4UT6H 3TNMA 3VYOA 3BH9B 4QNPE 2LR4A 2HFTA 3MUJA 3NCJH 4K5NA 3QWOA 5F9WC 3SO3C 4EI5D 4GKSB 4IIQA 4W4OC 4RA3A 1X7SA 1FGVL 3O9WC 5IQ7H 2DLTA 2IDSA 2XQBH 3QHFH 1IGMH 1XD0A 3BD4A 5A2AA 4C56A 5BW7C 5IUCA 4QJ3B 1DQTA 3PWUB 2YK1H 1E4XH 2JJVA 3EHBD 3L2NA 1YMMA 3OKKA 5LWYL 2CSPA 3VD4A 2D4DA 4GSQA 4LLUB 5E1IA 2APXA 3AUVA 3MKGA 1MPAH 1QKZH 1F11B 2JB5H 4QRPB 1DZBA 3LNIA 5KN5B 4YGVA 4CUCA 2CPUA 5GRVL 1FRGH 3ULUF 1QLEB 3L7FA 4GRLA 4AVHA 1TJGH 3NA9H 4WU5A 1MW0A 1CVRA 5AW4B 4RFNC 2DQHH 2O6CA 1MHPL 2NTSP 4JY6A 4QCIA 4WW2A 1TVBB 5HD8C 4QF1B 1ML0A 2VDRL 3CXDH 2BSTA 2UX6A 3WD5H 1YEHL 3VWKB 2P5WB 4DVRL 4EN3C 3Q2VA 3E1ZA 1KACB 4P2OD 3MR9A 4FJ6A 5FCUH 2A0LC 2CJSA 2COVD 2RTTA 3DXAB 4MJ5A 1Z66A 3FRPA 4UI2A 1A4AA 4XCNB 1EJOH 5KBDA 1IGCH 2FDBP 1JRHH 1HCVA 3NJMA 1QI5A 1JDCA 4DFHA 4NNXB 3VFVB 3FO1A 1BJ1J 1HHJA 4G1EA 1NDMB 2Z6FA 2Z92A 5CP3H 3Q05A 4JKNA 3FL7A 1QAWA 4XMPL 1IC1A 5HY9A 5F96H 3DJTA 1MRFL 2KZKA 2G30A 1QHOA 2B5IC 4DVBB 2ZX5A 1JG9A 5HI5D 4UOJA 4F7PA 3MNZA 4YFLI 3O3AA 1QEWB 1FPTH 3NAAH 4I0KA 4DEUA 4PJHA 1IL1B 1NLBL 1AS6A 1JZ3A 1DQJA 1EAOA 2F19L 5AVWB 5HJGA 4R0LA 3HZ3A 1A1OA 3BWAB 3IFNL 1D6VL 2WLIA 3HPJB 2WBJC 3OQ3B 1TZGH 3E7JA 2H3NA 3WXWH 3PREA 1UWXH 4AYID 3SKNB 3MLYL 1CDGA 4H20L 1CF8H 3CIQA 1I1FB 4JHAL 5CGYD 3WFCL 4FNRA 2R0WL 2VLRE 1TEYA 1ZGLP 1LNUB 1JGVL 1D3CA 4L8SC 2QPFA 3CHQA 3TNMB 3H56A 3GBNL 2JB6A 1AQHA 4JFDA 3Q0HA 3QWOB 1CGYA 2Y5TA 3F7LA 4YS4A 4IIQB 5F2FA 4FYTA 4KOCA 5T1LD 4FQJH 4JCMA 2J6WA 3QJQB 4LRIC 3V7AE 2AQNA 2QSCH 2E7LC 4C56B 3JTBA 2DLHA 4L4TA 4Y16D 5C0BE 3AQZA 2A99A 1YMMB 2WOBA 3VMNA 3OKKB 3RL2A 1KTCA 5SV4A 1ZSDA 4NN7B 2E7HA 3EJUA 3T4YA 3ULVD 5CEYA 4U6HA 1O6TA 3BIBX 4YGVB 3F65A 3VXOA 3L7FB 4GRLB 1RSFA 3BCFA 1EUUA 3U0TA 5IHBA 3JBG7 3CX5K 4NQCD 5EIIG 4JY6B 6TAAA 1H8OA 4KFZC 4QCIB 1OAZL 4Z3IA 2NSMA 2V17H 4YHZH 3LPWA 2DMGA 1GOGA 2BSTB 1I7RA 3IRCA 5AVZB 1CLVA 1FCCA 4R5VA 3BUQA 1PG7H 3LYRA 5JXAH 5I1LA 3ULAB 1UD5A 5FA4A 1OHQA 3MR9B 1H8SA 2X53A 4ZUSA 1E5AA 4I1NB 3R8BB 4F1ZA 2AJYL 2WB7A 4M3KB 4RFOH 1PJWA 4MJ5B 3FFCA 3IFOA 1UD3A 1XSJA 2R56L 3FRPB 4R4ND 4DZBA 1ZGLM 4UDTA 3T3PE 2FJGA 3ENEA 1G7LA 3HJ0A 3RVXD 3RZCD 1BLNA 2EH7L 4P05A 4KQ4H 3FO1B 4G1EB 1HHJB 4YDIL 4AZUA 1E5UI 2Z92B 3MLUH 2Y07H 1GGUA 2CHWA 4YN3A 3FRUB 2HLEB 3SSGA 5FFLA 5HY9B 4FQQA 4JJOA 4JANA 4DP2X 4XX1E 1SN5A 5CP7A 4QRTA 1Y18A 4AC2A 5HHOE 3HB3B 4TULH 4F7PB 3MNZB 3VWJD 1CURA 2WTOA 3O3AB 1NFIA 3T6WA 3IPFA 4PJ7A 4PJHB 3OM3B 4PYHA 3ALWA 4N3TA 1DQJB 3GIVA 1X5MA 5JA9A 2GTZA 2Z8WC 4R0LB 1MJJA 1Z3GL 2NUPA 2WO3B 2WLIB 2EDBA 5SWZD 2IGFL 3BKML 3S9DB 2H3NB 3UL4A 5DFAA 4BK5C 4FFVC 4I3SH 4KI5D 3TJPA 1J5IA 1FO0A 4PVMA 2CKBH 3SGJA 3QC6X 3JZYA 1KJMA 1RERA 3T04D 1KCRH 2EC9T 3QQ9C 4DO5A 4D0CA 4WW2F 3MLWH 4JFDB 5E08H 2DD8L 3E8UL 1G9ML 3VWJA 2Y5TB 2OMZA 3NFSH 2J1WA 4NN5C 1KC5L 4G82A 3GM8A 3WY4A 4ZYKA 3X11A 4PJGA 1FNFA 2Y72A 2BNUA 4L4TB 3GXDA 4OB5L 3BEVA 3SBWA 3QWNA 4WO4D 2MQ3A 5SWZA 4JL2A 4Y4FD 2J8UA 4H8WH 3RL2B 4CILA 1ZSDB 1JIBA 4PJ8D 2DLEA 3QJRB 4WHCA 3T4YB 3U2SA 5KBNC 3MLXL 2O5XH 3FQRA 5CEYB 4U6HB 1FNSH 1HILA 3KLHC 3BE1L 4JLRA 5AOLA 3AREA 5FHAL 4PBVC 3DGGA 3VXOB 4E9YA 1IFHL 1PQZA 1MNUL 3U0TB 1LWRA 2UZPA 4WFGE 3JYBA 1KWGA 3WYRA 2FX7H 1ZLVH 1NCWL 4XVTH 1MCHA 3G5VA 4Y19E 1MAKA 5C2BL 1I7RB 4YSRA 3QP3A 4AE1A 4A7VA 1YUKB 1YZZA 5E7FA 5I1LB 1GAFL 3BYYA 4OZFG 4Y4FA 3EH2A 5FA4B 4ZUSB 5FYJD 3VDAA 3U79A 4M7LH 3E6HA 4YAQB 1MXDA 3FFCB 3GLDA 3IFOB 1Z9NA 3GSXA 4N87A 3ZDZB 4DZBB 6CGTA 2WBWB 4EDWL 2NY2D 5HVHB 4UDTB 2R2EA 2FJGB 3F58H 1G7LB 2AI0L 3LPFA 1BLNB 4ZZFA 3TEWA 43C9A 5FFOA 2J1YA 5BRZE 4ANWA 4IBZA 1FZKA 4LKXA 3ULUC 2RGSA 3O8XA 4FQQB 2AK1H 4JANB 4JDEA 2B59A 5CP7B 4QRTB 2Y7QA 1Y18B 4X6DE 3WEAA 4A2FA 1FORH 3Q8EA 4WSKA 3MYJA 1P5UC 3QUZA 1NFIB 5L88H 1T2XA 3GB7A 4G59C 1TMQA 1WIPA 4FEMA 4PJ7B 4XP6L 1KB5H 3GIVB 3CBRA 3PAYA 4G6KL 1MJJB 1YCSA 4AUYA 2NUPB 4BH7A 5JQ6L 4BFFA 5CUSH 4ZX6A 1ZV5A 4K9JA 4ZK8A 4JFUA 4OQTH 3PU7A 4OY9A 3ZKQD 3O3EA 4O2FA 3MLVL 1REIA 3OC5A 5TF1L 3CQPA 4ZW5A 1CU4L 1B9ZA 1CE1L 1FO0B 2LVCA 2Y2TA 4F15C 5ADOH 1HKLL 5I18L 1PYWA 1UFGA 3AT8A 1KJMB 3EH1A 3RWDA 2FQFA 4KROD 3O6LL 5JUEH 2D7TH 1T66D 2DH2A 3IN2A 3LS4L 5F0PB 4D0CB 1TXKA 2AJXH 4HF5L 5E1QA 2AW2A 5B1JC 2H0FA 4YBLB 2OMZB 2IDQA 3BMWA 2FNBA 3E9TA 1BVKA 2OR9H 2ZYIA 1MJ7L 2XV3A 4ZYKB 1CXIA 1YDPA 2XVLA 3N85H 4PJGB 5C08D 3X11B 2R69A 2BNUB 3PABA 4AGMA 2Z35A 2EDJA 3BEVB 5K59F 2F54B 5SWZB 1I82A 1PS3A 1U30A 1A25A 2J8UB 1NLDL 3MU3A 1OSYA 4JG0L 3ZDZF 5SX5H 3UJJH 3U2SB 1T7WA 3EYOA 5DHYA 5D2LA 1IBBA 4AYMC 3FQRB 1BZOA 4Z7VE 1HILB 3HR5A 4JLRB 2TSAA 3GBMH 3AREB 1E67A 3DGGB 1F4WH 2ZUVA 3ZGIA 2NY3C 3H9SE 1PQZB 3CQQA 3O2VH 3EO9L 4P9ML 4U7KA 4UILL 1HWHB 3CVHL 5JHLL 4FAAB 3G5VB 2WCGA 4OGYL 4M6MH 3O6ML 2DMBA 1A6ZA 1SJMA 4HKBA 2AEPH 3P73A 5IW3A 1WP6A 4ORGA 1HDMA 1AGCA 1TZAA 4FHKA 4XHQA 3VWKC 3WIHH 1WIOA 1I3GL 3E6HB 1ANUA 3OB0H 5TE6L 4X4ZA 1JD9A 2EYSA 3T2NL 1N6UA 4UT9A 3GSXB 3IDJA 3V6ZA 4PJEE 3QIUA 2QPEB 2R2EB 2VDQB 4M3HA 4C58B 1DL7L 3NPZB 5BO1H 2VWEE 1HCFX 5CJOH 3WKPA 3GK8L 4NX0A 1DUYA 3OZLA 2LU3A 1VPOH 4PP2A 2AABH 2J73A 4RAUA 1FZKB 4GBXA 4LKXB 5DJXA 3O8XB 4OZ4A 2B59B 2GHZA 2Y7QB 4FQIH 1PDKA 1DQQA 2GB2A 3FB8A 3MRNA 3MYJB 3BUIA 3QFDA 3QUZB 3NCBB 4G7QB 4PJGF 3PJSA 4NLHA 3GB7B 4NZTH 3VFWA 1BGXL 4A7SA 4ZW7A 2VDMH 4HIJA 4I13B 4JRYA 3KPRA 4KVPA 3CVCA 4FCAA 1M2VA 1VACA 2Y5QA 4KJYA 4LRNL 4BH7B 2J8UF 4LEEA 1PZ2A 2NY2B 2BP8B 1IJ9A 4JFED 3O3EB 4HUCA 5KJ4A 2C9XA 4O2FB 2WSDA 3P2TA 4N86A 2W65A 3IGAA 1PYWB 1EWHA 2WXRA 4NZ8A 3E38A 3RWDB 2B1AH 2F08A 4LIQH 4U6VH 5DSCA 1TDQA 1IEAA 4R26L 1A5FH 1IAMA 2BY3A 5KVEE 4L8CA 5IEKA 1CL7H 4K73A 2YWZA 1G7JB 1ASPA 3DVIA 4OFVA 2EEDA 4XBMA 1NCUA 1BVKB 3U6RA 1YDPB 2E7BA 1WEJL 4KKCD 4YZFE 4IIQC 2HYMA 3PABB 3TT1L 3RIFK 2Z35B 3IE9A 1MLCA 4OCLC 3QZPA 4X7CC 5DJAA 4HK3N 4U1HA 5AZEL 3LEYL 3QRLA 5BV7B 1O9ZA 1CXEA 3WDIA 3EYOB 5DHYB 4E41E 4G8GE 5D2LB 2YZ8A 5KSAC 3HR5B 4K3HA 1U4EA 4EXKA 1BQHA 2VTFA 3HG2A 3MCKA 1GGIL 4FZEL 3TCTA 2Z31A 5GJTH 4AMXA 5I75B 1FAKT 1UXSA 3NJFA 3NYKA 2X2IA 3IFPA 3MDJA 5ESVA 3T4AA 3EO0A 4P3DB 4L3AA 4S1SL 4HCFA 5KS9A 4EDXA 3MAWA 2FLRT 1F4AA 1E8ZA 4XVSH 3HC3H 4WW2C 3VXUE 4EI5C 1RZ7H 1T03L 4LPYA 1A6ZB 5CN2A 4HKBB 3P73B 5CJQH 2GIXA 4ORGB 1HDMB 5J06A 1AGCB 3N9GH 5AZ2L 4LMQI 3FF7A 2NZ1A 2TAAA 4FXLA 2VZ3A 1TT6A 2EYSB 4HVBA 2QKIA 1V27A 2WQWA 1U6AH 5HGBA 4NO2A 1H3UA 5C70A 3RVVD 2NQCA 4UDUA 5I8KH 3V6ZB 3QIUB 3RY6A 4WK0B 3ARDD 2PCYA 4Y4HA 4JNXA 3KM2A 1CR9H 3S98A 4Z3JA 1WZ1L 6PCYA 2ZAHA 2ZOWA 3CZGA 1DUYB 4PP2B 5JXED 3Q8FA 5BVPH 4RAUB 5DJXB 4GBXB 2VDOH 3FT2A 2PR9A 4OIBA 3GS4A 4G6JH 5E9DA 4OCSH 3WCYA 1G0YR 3FQ4A 3LPOA 4EBQL 4P59L 4J2XA 1PDKB 1DQQB 1MFBL 3FB8B 3AM8A 3E9UA 3MRNB 1BBJA 3OHXA 3QFDB 4KJWC 4PRIE 1DQDL 3PJSB 3VFWB 1J1PH 3HB3C 3HMWH 1EZVY 4HIJB 4NN6B 4JRYB 3KPRB 1X3DA 2Y69B 4G6ML 1M2VB 1VACB 4KJYB 4QKTA 1KELH 4BSVA 3KLDA 3FB5A 1F4YL 3GBEA 3AY4A 4R0LC 1LWHA 5D2LF 4PGEA 2HKHH 2G75A 4Y9EA 2EUXA 3WG7B 3AY2A 2WNGA 2W65B 3IGAB 2OTPA 2KMWA 5ISZD 3ZMRA 1YN7A 5DSCB 4CL7A 1AZUA 1Q0XL 1IEAB 2KKQA 4L8CB 5CILL 1CDUA 5IEKB 5DA4A 1FDLL 1E27A 3ARFD 4U0RB 4TVPD 4H0LC 4KZDL 1MVYA 3VNZA 3DO3A 3U6RB 4TNFA 5CFAA 2C26A 5GS0D 1BREA 3TWCL 4I0CC 5ESAA 1THAA 3CFDA 3UH8A 4HT1H 1UUNA 1IBGH 3A47A 3ARBD 1MLCB 2H9GA 4J23A 5DJAB 1YC8A 4Y2DD 4I1PA 5HYSG 2H4EA 4O02H 1NGWA 2X09A 3QDJE 3KGUA 4U1HB 4IMKA 3RURA 3KD4A 2MPVA 5IFHL 4DP9X 1U3HA 1EZVX 5T3ZL 4W4NA 3LAFA 4X7SL 3U0PA 1BQHB 3HLKA 2Z31B 2QGCA 1UXSB 3KL5A 3CLFH 4NCC2 5CGYC 4ELMA 5ESVB 4K3EL 4DW2L 4HIQA 3T4AB 3EO0B 4F8NA 3ULSA 1NZRA 5KS9B 4EDXB 2PW1B 3B2DC 1IC0A 4IOFD 1DQLL 1SYSA 5F0MB 4RGNB 3SDAA 5DR5L 2JTDA 2XPGA 2MOGA 4KMTL 3H1ZA 3UMNA 4R96A 3ABLB 4JRXE 1JPFA 1H3TA 5I6MA 4FOMA 1J0JA 4LHJB 3CZNA 2QKIB 3C5ZA 3EJZD 5HGBB 4NO2B 4LVNB 4B53A 3ZR5A 4BCXA 2ADFL 4JVPA 3N41B 5C0JA 4Y4HB 1NMCC 2BSBA 1MG3C 5I1KL 3DIVA 5BZWA 1CXFA 1FC2D 3FQ1A 1NBVL 1Q9KA 4XNUL 5JHDA 1R6VA 3CK0L 4PWIA 2DS4A 1QYGH 3FT2B 5E9DB 1MFCH 5KUKA 3ULUH 1BBJB 3OHXB 3CFCH 4X5RA 5DRZA 5DWUL 1E2WA 1NC2D 1P6AB 4N9OB 4HHGA 2VW4A 2PUQT 4BSVB 5ANME 1HE8A 1OF2A 3FB5B 2QMKA 2R0KH 4CA4A 1VESA 2A3TA 2D2CC 5F97E 2YN5A 3EH4B 4PGEB 2G75B 2LU7A 4LQFH 3IDMA 1YEEH 3CX5J 2XX0A 4V2CB 3RVXC 2KS0A 3DX7A 4BA8A 5JQHC 5JIKA 3QZMA 1YN7B 2NY4D 3IDNA 3SGJC 2J1ZA 2QHRH 4GMSH 4DETA 5KS9F 4HWEH 1E27B 4R7VA 2VOTA 5DZ9A 2WINB 4Y5YB 3K0YA 4FXTA 5AVTB 4G83A 5ESAB 1FQ9C 3CN0A 1ZAGA 3CFDB 3VWJC 4YBLC 3GQFA 5AW8B 2B14A 3FS9A 1EDHA 4KKBC 5F9OL 2VISA 2H9GB 4BA0A 1XCXA 2CK0L 4P46A 1BXAA 1OWWA 4FF9A 3SE9H 4Q9QH 2ZCZA 1BECA 1NGWB 4IBLT 1F4HA 2GJ6A 3ARGA 3PL6A 3SBWC 3VB9A 4DKTA 1BMGA 2YS4A 5EZLA 4LCIL 4XRCA 1U3HB 4JO5A 3N41F 2OCJA 4JM0A 3WHE0 3U0PB 4WEBH 4LHUG 3II3A 1U8IA 2VDRB 4MA7H 2D03H 4ELMB 2K7PA 2RCSH 3AREC 1I7UA 4GB9A 1XMWA 2GABA 3N55A 4U4IA 3QUMH 3ULSB 4WEUD 5ABAA 1KBKA 2YAFA 3WKMH 2E59A 3CWGA 1JS4A 1SYSB 4BUGA 1LYQA 5IJVA 3SDAB 1QLEH 2TRHA 3OHMB 2XPGB 5BVJB 2P3YA 2X6AA 3UC2A 4AVKA 4R96B 4TLTA 3LIZA 4KMQA 1KTRL 3BZ4A 2VDNB 3C60D 1R19A 1XCTA 2PWFA 1UWYA 3FU9A 4P2QD 1JPFB 3FAWA 3NZUA 3KW8A 4YWGH 4ZMQA 5HHQA 1GYAA 1DLFL 1BD2D 5FLVA 1J5DA 1A7NH 3C5ZB 4BD4A 1DVQA 3CLWA 4L5FL 1YG9A 1QATA 1SXCA 4Y4FC 4KK6D 1TFPA 1ZJAA 1KUMA 4G6AC 4X8JA 5C0JB 1AXTH 2ODHA 3HUJE 4YL9A 4KJPD 5I66A 1X6LA 2W80C 4ADIA 1FJ1A 2PXYD 1UA7A 5BZWB 2H32A 2ZX9A 2VLME 5DJ0A 5IBLC 2PR4L 1Q9KB 5JHDB 3LZFL 4X5PA 1MIMH 3I9PA 2ZOLA 2FWSA 4FFWC 2C4FT 4UINL 1IM9D 4U1NB 4YHMH 4QJ5B 5IW6A 5HJBA 4KPHH 2JKSA 3O8XC 5IESL 5JW4R 5IMOA 1WAAE 3C60A 4OLEA 3WV0A 5DRZB 2ZG3A 5JIDA 1WQVT 3GSNL 4MTMA 5F89A 2DI9A 3MRJA 4BQ9A 1MRDL 4FQXD 2GUOA 3QUZC 3L45A 4N2KA 4L3ED 1XD1A 4XNXL 2EDTA 1PD6A 3WFHA 1PZ5A 1VKXA 4X9BA 1PX4A 2DYPD 1OF2B 3U9PL 3IDMB 2EDHA 5I0VA 4QGTA 2NY2C 4KBPA 2FEJA 2NXZD 3MGAA 2BIPA 3LQAL 3T08A 3X3GH 3T0DA 5BS0A 5KYNA 3DX7B 4FGMA 1XH0A 4ELMF 1PJ9A 4N5EC 3IDNB 3B9VA 2OR8A 4NXKA 2BERA 3US9A 2H3XC 1WFNA 2EXSA 1NAKL 1ZK9A 3BN9D 4Y9CA 2GAZA 3FQWA 4LARL 3H3KA 3Q13A 4F33A 1VFMA 4N90D 1OCWH 5CSGA 1C8QA 1JNNH 3V0DA 4ZMAT 1OO2A 2CBOA 4TUOA 2YEVB 4OUUA 2DQGL 1I9RL 4RBPK 2VISB 2OM5A 3QS3A 4F7MA 3GO1L 4M1DH 4P46B 2Y2YA 4RRPM 1R3IH 2Y24A 2COQA 4XO9A 4ZTPH 1IGTA 2GJ6B 3ARGB 3PL6B 5LB1A 3MXWH 5EZLB 3TPUA 4XRCB 4BELD 4FXKA 3EYVA 2BSED 5DRXA 2AZAA 2JKRM 2QTEA 1XT5A 3OQRA 1HHGB 1TQSA 5EULV 5BV7C 2NLJA 1MEXH 2NY4B 2V8MA 1DO5A 2F1AA 4KKZA 1SOQA 4MNGA 2DLGA 2DKSA 3BI9X 4E0RA 4NM4L 1I7UB 4KHTL 4YXHL 1GTNA 3NEOA 3D39E 1E4WH 5CJBA 3VQMA 5JR1L 1K3ZA 3F6IA 2EC9U 2WV3A 5ILTL 5IJVB 4G80A 1SF5A 1DQIA 2W1NA 4A04A 2HT2D 3HI5H 3OAUL 4WDIA 1OSEA 2X42A 5I0XA 2CBQA 3BZ4B 1XCTB 4AMWA 3HZKA 2YN3A 1PZCA 3MRKA 1HYSD 4LBEA 2VDKB 4N68A 5HHQB 2PN5A 4CVXA 5SX4I 4M1GH 3UPRA 4XPBL 1BX2A 2K4WA 4WJG3 3OMIB 3RPKA 2VR3A 3IAPA 4B9PA 3LH8A 2A6DB 3BDYL 3NPSC 4X8JB 4PJCA 3HG4A 5L4JA 4UTAH 4XP1L 1FJ1B 3FTZA 2ZPKL 2AQ3A 3SY6A 3TZVA 2H32B 3QIUC 4E9LA 5DJ0B 1CG9A 1Q0YL 5JA8B 4IS6A 5B38G 2FZ3A 5CZVH 3T3MB 4LEXH 1E42A 3MROB 4J2QA 4FFYA 5IW6B 1JGIA 1HKFA 3HOGA 1MXGA 2PTTA 4GBXC 3D0AA 1L0YA 3V0JA 5I1HL 2VC2H 1MVUA 3PQYD 5IMOB 2FEDD 2F2HA 3FFOA 4AL8C 1Q90A 1M3IA 1VGEH 2FX9L 35C8H 3NJKA 5F89B 3MRJB 3V4PL 2GUOB 3K6IA 3S3CB 4NHCH 1TTBA 2YRBA 1VKXB 2DW5A 1PZ5B 3WFHB 2EYRA 1JZ4A 4NN6C 3NCEB 1KIRA 1NIEA 2ZX8A 4I18C 2XTJB 2VXQL 1S7RA 4GUOA 1M71A 5AKVA 2DAVA 3FCTA 1GW6A 3CMGA 2C9SA 1N12A 5BS0B 3GSQA 4TLUA 3QG7L 2Y36L 4IU3A 4Y2OA 6FABL 1DBKH 1UZ8A 2WPGA 1AG0A 2GAZB 2MCPL 3NMEA 4F33B 2ZNXA 2DQMA 3CNKA 3RGVD 1URZA 4ICWA 4U0RC 4TUOB 4DKFL 3DGDA 4OUUB 3UBXG 4WVRA 4IBVA 2C9AA 2VLLA 5BQDA 4F7MB 4P2RA 1BIIA 5HDRA 4TOYH 3FUNA 3BVUA 1P6FA 1IGTB 4KY1L 3BPNB 2XQYG 1A3ZA 3TPUB 2BX5A 2XN1A 4FXKB 3V4LA 2ZD0A 5DRXB 2YZ1A 1UFUA 4UIKH 3VNYA 3B83A 4Z7AA 5JHLA 2HUHA 3P9MA 1RH8A 2NLJB 5JLZA 1CLOL 4MNGB 5ENWA 4E0RB 4L8BA 3AGVA 4LLMA 4YQXL 1A7QL 2Z31C 2OYPA 3T3MF 3FYIB 4ZFQA 3L1OH 2FHBA 2VN3A 1OD9A 2WNKA 3T4AC 2ZIDA 4NKDA 4G80B 4HKJA 3TLRA 4WEMB 3P77A 4R4FL 5HHNA 3M86A 5LDSA 4RX4D 4WDIB 3B8YA 4RGNC 1URIA 4YLCA 3HZKB 3U36A 3MRKB 9CGTA 4LBEB 3CC1A 4CVXB 4RIRA 3TM6A 2BM3A 3UPRB 1Z9SA 3BH8A 1BX2B 1OE1A 5DD5L 5FOJA 1IMHC 2AEQL 4FA7B 2QKIC 5GHWH 1TTFA 4PJCB 5IP4A 4LVNC 3OAWA 3TZVB 3K1DA 3W2DL 3RY6C 1BYOA 4F2EA 5IQ9A 1CG9B 3M6DA 4Y4HC 4M4PA 4DESA 3ULVH 4IS6B 2NW2A 4M9OA 2FZ3B 1E9PA 2EE3A 3TU6A 3IRZA 4OCMC 4QRFA 2I60H 2EIKB 2PTTB 4GEJA 2AEWA 3DX4A 4LIQE 5HHXL 1OF0A 1MVUB 3DUUA 2A6IA 3WGVB 3PWPB 1CICD 3TBCA 2APBA 4NPYB 3AM8C 2J6EA 5L7XL 1KEGH 4GUPA 4CJ1A 5EF1A 2EYRB 2FO4B 4HS3A 4G7VL 4JKPL 4XMKH 3S37L 1KIRB 3K8LA 1YN6A 1H3WM 1FFPA 3QUGA 1FNGA 1IZKA 2IV9A 1S7RB 4R9HA 1NGPH 1M71B 3AY4C 2Q2LA 3GMRA 4LSPL 1N6QL 3FCTB 1BBDH 4AW4A 1WPCA 3GSQB 4AKQA 1NCGA 4IU3B 4PRPD 2X1PA 5JXEC 4JCWA 1OP5K 3ECQA 1YNKL 4A63A 1UZ8B 4QYAA 4A6YH 1RURH 3HHMA 2IAMD 3T0EA 3IB4A 4HDIA 1IAIH 5H4YA 1LO4H 2CRZA 2P9RA 4JG5A 2VRQA 1S3RA 4CSSA 3K3QA 3QQ4A 1L5GA 1TETH 3FTUA 1SY6H 4K15A 4M03A 1IV8A 4PRDA 1DANT 4P2RB 1BIIB 1IBYA 3RL1A 2VR7A 1K6QH 4J3TA 4M43L 2J1XA 3N1QC 4N3UA 4FHJA 2R2BA 1V3KA 4N8VA 3MJ7A 4PJCF 3GS0A 3EXLA 4IMKC 2DQFB 4R5TA 3FB7A 2DPKA 3P9MB 1AANA 2WLHA 1FUNA 1U3HC 3QWRA 4RWYL 4PRPA 5JLZB 4QO1A 5ENWB 2N59A 4L8BB 3MOAH 4LLMB 4OUOA 3FCGA 3GDCA 3L3KA 4ANKA 4YXLH 4R83A 2O4EA 4NKDB 4HKJB 2WIMA 3P77B 5HHNB 3QNZA 4M6NL 5HGGS 4NOBA 3Q6GL 2XV2A 2HTKD 2QVIA 2E9IA 4Q8BA 3SDAC 1KCVL 2NYYD 3QE5A 3U36B 1WUNT 2JNZA 2XWCA 1FFRA 5EOQL 2WVVB 4RIRB 3LRLA 5HHPB 1MI5E 1RFDL 1Z9SB 4BK4A 1UWEL 2CWRA 3BH8B 5H35A 2JCCE 1WHOA 4LP5A 4W9GC 3LB6D 2O26U 3C5ZC 4ISVA 4N0FA 4J6RH 1BYPA 4QRAA 5LGJA 2AV7A 1OL0A 4EI6A 5IQ9B 1DJHA 1FE8H 1O6SA 1PZSA 4TSBH 2ROYA 1ADWA 3RWIA 4B60A 3FO2A 4DGWC 1IQWL 2NW2B 4LHUD 3SEPA 5IJKA 1HE7A 2K3TA 1E9PB 2XTLA 2OZNA 1PFCA 3PDOA 5DRNA 1WGVA 3DUUB 2A6IB 5EBWA 4PQXA 1J0YA 1J8HE 4X6CE 1PLGH 5EUOF 2E75C 3B2VL 4GUPB 5T3ZD 1GGCH 1QQDA 2CO4A 2VQ1A 1E5YA 4HS3B 4UNVA 1PF3A 1DEEA 1YN6B 3R1GH 2XKSA 1FFPB 1FNGB 2KT6A 5FYJH 1U41A 1NANI 1OGAB 2QDVA 5LAXA 1JWUA 2DTML 2JJUA 1N7MH 3BVWA 1XH3A 3GMRB 5E1HB 1AACA 2ICCA 3CN1A 3GZOA 3QZLA 3VRLE 3FH7A 3WO3B 3C2SA 2E9JA 1CDIA 1AD9A 4NQXA 4PHZA 1Q4NX 5C6TH 2ZYRA 4OCXH 4KZ0A 3U2IA 4IBTA 3AMLA 1Q9LA 1OE3A 5J3HD 2BRRL 4GQ9L 3T0EB 1WS8A 2OTUA 3G04A 5ICUA 4HDIB 3NCYP 5D7SL 3CXFA 2P4AB 1HQRA 3DJRA 3K6DA 5DD0L 2WCSA 4N2AA 3GI9H 3QQ4B 1MFUA 3GZPA 4K3DL 1L5GB 3ETTA 2BHUA 4NQEB 4PRDB 1T3FA 1IAIM 3RL1B 5D7LE 3GPEA 1JPGA 1LO2L 2WN3A 4TV3A 3GJFK 3B7TA 4PJDA 3GMPA 4P46C 2R2BB 3FKUS 4N8VB 3MJ7B 3O2DA 4L4VA 3ARGC 3FB7B 4S1DD 3P4NA 5JOEA 1ET7A 1R3LA 5FECA 3PGCA 2DEWX 4QO1B 4PUBL 5BV7H 3DDGA 4MS6A 2NY4C 3L3KB 2V9RA 1SM3L 2K6YA 1X5JA 3QXAB 3VDCA 4N22A 2PCFA 1L9TA 4KAQH 4AGQA 3BLPX 3QNZB 1RXLA 1D5ZA 5IEHA 4DQOL 2WY3B 3VG9C 4AIXA 1XQ4A 4DN4H 3ULUE 2W60B 5AOKA 2WXNA 2UUDH 3B2PA 2AAAA 4IRZH 1BEYL 1OP4A 5EN2A 4YX2L 3NZ8A 4QT5A 1A4JA 2WZ5A 2W5PA 5H4ZA 4N0FB 1SBBA 1GXEA 3AU0A 1HWGB 3STZA 5LGJB 4OI8A 2AV7B 2EDOA 3CE1A 1O6SB 3AS0A 3RWIB 3FO2B 3VJ6A 5C0IA 1LE5A 1TQCB 4F58L 1F4XL 3KWWA 5H94A 4HPYH 4WUUE 2VMFA 2WXKA 5L6YL 3ZK0A 3CN2A 1RUAL 5GGVL 1A4KA 3PDOB 4OVVA 5DRNB 4E9QA 2ICWI 3ARWA 1QZNA 4GKZA 3BKCL 4OJCA 3AQDA 3B9KD 2XWJA 1P4BH 3C60C 1S9XA 3CFUA 2VLJA 4AL8H 1QQDB 1NANH 4MXWL 3DX6A 4KGJA 1DEEB 4ILDA 2A9CA 3OKOA 3QRFM 5L2KB 1TTUA 1D2OA 1TJXA 4KK6C 5FM5M 4JCLA 4H0IA 5LAXB 3US1A 1JWUB 2ZCHL 2X6VA 1PLAA 1XH3B 4AZ8A 1SZNA 5D8JH 2WQVA 2JI1A 2IAND 2X1OA 1AD9B 3GBLA 3H6JA 4NQXB 1INDL 2X9ZA 1QSFE 1G9MC 5TF0A 1Q9LB 1FYTE 1HEHC 3L4XA 3P9LA 4J12A 5FAAA 2OTUB 3G04B 1LLAA 1YA5A 5HHVH 1HQRB 5GSVA 1QACA 1HNGA 3DMMD 3KWVA 3KPQA 5DK0A 3S4SB 4NZJA 5CIPA 3ABZA 1T3FB 1JFHA 4FQXC 4K2UH 3D9AL 1W8EA 3V0GA 3U9WA 1JPGB 3WXVH 4ZZKA 1W9XA 3MO1A 1ZLUH 4PJDB 3GMPB 4AVIA 1AZRA 3RLSA 3BMVA 4L4VB 3UJIL 3BPNC 5GGUA 4FFZH 4WKZA 4HKXA 2GJZA 4PJBA 3B5TA 4KWUA 2ZXAA 2NXZC 2GKIA 3P4NB 4FXKC 4BBWA 1R3LB 5FECB 3PGCB 4F92B 3MRHB 4KUCF 2P5WE 5F3HA 1EGJL 3M1OA 1CYWA 5D1XD 5EC2A 3D52A 5TQ0L 2PCFB 2W0LA 1YMHA 4BZ1L 3BN9C 3WELA 3HRZA 4L3CA 2VQTA 1DVSA 1GJIA 4HBQA 2NY7H 1D5ZB 5IEHB 4UQCA 1DJXA 2W0KA 1W0WA 2L7UA 4HU8A 5E6RB 1U91A 4K23L 3FO0L 3UGEA 1OOAA 4JW3A 1I1CA 3UACA 2E6JA 3LVEA 3NZ8B 2OW7A 4QT5B 1A4JB 4G6FB 4ZNEA 3DOIA 3I6KA 4JM4H 4N0CD 2ZYHA 4F2MA 5GZND 4XN1A 5KWYC 5K39A 3STZB 2ZKMX 1AE6H 2MRYA 3EDDA 5DD1H 3Q2LA 5I23A 1EO5A 1HHKA 4KK8C 1MFAH 1RUML 5JO5A 3D2UA 1W6LA 3VJ6B 4E9RA 1CLZH 2ED8A 5C0IB 3TZVC 1LE5B 3GSNA 3KWWB 5H94B 4HCIA 2KUTA 1ASOA 3F12A 3QJUB 2VZOA 4LSRH 3C6EA 3DYOA 3H3PL 1A4KB 2BRQA 2AGJL 2HN7A 4QYOA 4QRUA 5IMLA 2ZUQB 4GKZB 4NWUL 5T3XE 3NQIA 2HT2C 1YYLL 2IPUG 3HMXH 1B4JH 4JN1H 4UM9D 2YKLL 2XWJB 3CFEA 1S9XB 2CDGA 5C07D 2VLJB 2YEQA 2X4QA 2AK4A 4P4KA 3DX6B 5I26A 5T1DL 1KN2H 2WLLA 4PJDF 4Z7OE 3OKOB 5L4MA 2V4LA 1WAPA 2JFCA 2VMDA 4DP6X 1EMTL 2VZSA 2G4GA 2Z7WA 3MLRL 1HAWA 1T22A 2A77H 2QQLL 1AR1D 2IOIA 2AJVH 3ELAT 4XMLH 1B88A 4AZ8B 3RWFA 3D09A 1XB8A 4P04A 4CKVX 2APFA 5AAWA 1CIDA 1B0IA 4Y1TA 5D7EA 1TF4A 4M7KL 4WTXA 4PAZA 1RIUH 3DIFA 5I6LA 4U3CA 2JE8A 1A21A 3KNBA 3AWEA 3P9LB 5JW3L 1EJFA 1B9KA 4RH4A 2PPDA 1RPQA 3GXFA 1D5MA 5ID0A 2Z93A 2C4FU 2NPLX 5D1ZD 3KPQB 3F00A 2WYZA 2ZNWA 4ZX5A 5CIPB 4GT7A 3QDGA 1L9MA 1XL4A 3MO1B 4ANUA 3OLGA 2EO1A 3FTXA 3GGWA 5LWYH 3Q2CA 4K07A 1KN4L 1CD8A 4KK9D 3IM1A 1UURA 3DJSA 4PIBA 4HKXB 2GJZB 4PJBB 4WKZB 5GGUB 3SQOL 1KJ3L 4LPUA 4RMUA 5EDSA 5F8RC 4JGJA 2GIMA 4TNGA 3GRWA 3V7AG 3RKDD 5F3HB 4Z3GA 4L1BA 4G9FD 5EC2B 2CHZA 4JY5L 1YPZA 4KZCA 3KG5A 3CSYA 3SIKA 5K1NA 1YMHB 4ANXA 1T21A 2DY2A 3U30B 3HRZB 4L3CB 2VDRH 4F7KA 1CS6A 4MXQD 4U1JA 1WZMA 3CSGA 1YEHH 3ZT6A 1WDAA 1PU0A 4UTBL 4DVRH 3K8KA 2FT8A 3V5KA 1YUHA 1W0WB 4TVPH 4A2MA 1AKJD 5GS0H 1U91B 4ZTEA 4XC1L 5KW9L 2FO1A 1I8LC 2P8MA 4YSOA 1DJGA 4N8CL 3KCPA 1CF1A 4FLHA 1QWNA 3I6KB 3CJJA 3N42B 4Q6IC 1W72L 4F2MB 5T1JA 2CJUL 5KZCD 1CO1A 5K39B 3KPOA 1NKGA 1HHKB 2JQZA 4RLDA 3I75A 3MACL 5JO5B 3D2UB 1LP9E 3DSFL 1FLTX 3P3YA 3L95A 4XMPH 3TNNA 2JKJA 3GSNB 1Q94A 1MRFH 4HCRL 3FOMA 5DVOA 3F12B 1WRFA 3LKRA 4HZ1A 1GH7A 2ZJSL 2ZZUT 2VZTA 2YIHA 2HN7B 4QYOB 5IMLB 2P49B 4DAGL 1IGYA 3T0XA 1I1AA 3C87A 2XC8A 2Z4QA 4MNQD 4M6AA 1X5FA 2VXQA 2HX7A 3FTGA 1NLBH 2F19H 2CDGB 3ZE1B 2AK4B 3IFNH 4P4KB 1D6VH 2WLLB 3LKNA 5F9DC 1J18A 2BPBA 5FGCE 2YARA 2FGWL 4LO9A 2EACA 3V7MA 1T22B 2HG0A 4PJBF 3IS1X 1CTNA 3RWFB 1KBGL 4H20H 4JHAH 4CDHA 5AVRB 5FGSA 3H53A 5DJ6A 5D7JD 3P11L 3WFCH 4K71C 1I3VA 1BMZA 4ZO6A 4TRPL 1JGVH 3DIFB 4B6ZA 2GIYA 1PKQA 1X7TA 3KNBB 1MN4A 1T0MA 1JJUA 5DUBA 5F3FA 1QPPA 1FH2A 3F7RA 4X5LA 1D5MB 1TZIA 5EU5A 1S8DA 5ID0B 5KVMC 2Z93B 2YUXA 4GLRH 3T0EC 3NRQA 2QPUA 4K3JL 4YHLL 2XZQL 5CXPA 1UOKA 1R47A 2G0LA 4HJGA 3QDGB 2IVFC 3BFQG 2QL1A 5TQ2H 4E2OA 2VLKD 4HGWA 1OW0A 3SGKA 5CWSA 2PLTA 1KPUA 3GGWB 4XHJD 2I7OA 1DP0A 4N25A 1VB9A 2EDRA 1ROCA 5D2NA 4PR5A 4QUOA 3LXUX 3VI4A 2NUTA 2ITCA 1QNZL 2VQUA 3FZUD 3CU1A 2UV3A 4Z7QE 1YPZB 1OAZH 3CSYB 1ASQA 3VXTA 1SHXA 1RUQL 3O6KL 1IE5A 1QG3A 1T21B 4ZMOA 3ULVE 2BNQA 3T09A 3ZDZE 4U1JB 1IKFL 3BVDB 2DQIL 2PP8A 3STBA 3V5KB 1EVUA 4CN4A 2X1WL 4Y8DC 1J11A 5D4QA 2H1PL 3VFSA 1MZZA 4NQCE 1CYXA 3ZE1F 2AJYH 4OIFA 3EFDL 2P8MB 1XV8A 5F7WC 3X1EA 4PRNB 2R56H 5AAMA 2PP9A 1GRWA 3KCPB 3VA6A 4OD3H 1OV8A 3G9AB 3P0VH 3IAQA 2BNRD 4UUJA 2V6HA 3KPOB 2EH7H 3ZMEA 3TA3D 3O0RH 3I75B 1Q72L 1VA9A 4YDIH 3L95B 1H0DA 5D7KD 3TNNB 2WC7A 1Q94B 1HI6A 3FOMB 3VD0A 3LKRB 1XF3A 1TQCC 5IJKC 1WWWX 1VHPA 4F7EA 3S88L 3V0FA 3KM1A 1IGYB 2C7FA 4AGPA 2R8SL 1I1AB 4AT6A 3W39A 2Z4QB 4JQIA 3FTGB 3HBGA 4QRSA 2R2HA 2NYYC 2APTA 4LL4A 3CDYA 3ARVA 1Z3GH 4HEPA 4X6EA 1A22B 1Z0NA 5E24E 3GD1C 3LKNB 2R23B 1KGUA 2RBLA 3TCLB 5FYKU 2IGFH 3BKMH 1OTUC 2C9RA 1XH2A 3MNDA 4QOKD 4C4KT 5FK9A 2BZ7A 4HJ0C 3QRGH 1EQWA 1UT9A 4FCHA 5DJ6B 1PG7X 3CGTA 3POCA 5F3BB 4OJAA 1UCTA 1KPRA 1UM4L 1OAXL 1PKQB 2ITFA 1T0MB 3MN8A 5DUBB 5AVSB 5SWZE 1KXTA 5AB9A 1G9MH 3H42L 2BFVH 2J2ZA 1TZIB 2WNWA 2YAOA 3QEQA 1KC5H 5EU5B 4LPXA 5FW8A 3X2QB 4MYWB 2G3NA 2NY6B 4X4XA 1R24A 3EJTA 4HJGB 4LAQH 4YDLB 3UZQA 3B6SA 3SOBL 4HGWB 5D72L 1KGIA 3IFLL 5CWSB 2F1EA 1KPUB 1EEZA 1SVBA 1JMXA 1TJHL 5E51A 1TTGA 4P06A 1OALA 3MLXH 5DUML 3FU0A 1JHKL 1PL3A 3BE1H 4NC1E 4ZO9A 5D2NB 4GY4A 4PR5B 5FHAH 4HS6A 5L4FA 3OJDA 3VI4B 2NUTB 1IFHH 2ITCB 3DJ9A 1S78D 4WF7A 5D5MA 2VXVL 3X12A 3VXTB 4GO9A 1G7MA 3P3TA 1NCWH 1MCBA 1X7QA 5J3HC 1ETB1 3MNWA 4W9KC 3CTTA 2M26A 1NKOA 2BNQB 4G7SB 3BRFA 5C2BH 2UXTA 1CGVA 1QA9A 1INEL 1CQKA 3KBHE 3ZL1A 1F90L 1EAJA 4QHMA 1GAFH 3EIFA 5FWRA 2APWA 3VFSB 5IKCA 1XEDA 5EZOL 4OJFL 3F83A 4A68A 2KDGA 1CLCA 4HUXA 4UUJB 2AI0H 4PJ5D 3D87B 5EC1A 1GJUA 3SPHA 5JQIB 3QWQB 4Y9BA 1F0LA 1H15A 1K3IA 5FYJE 3CFQA 1H0DB 1MH5A 1D7BA 3IGLA 3LHAA 1HI6B 4FHBD 2NR6D 1XF3B 2EEXA 1NM9A 4B96A 4F7EB 2YOCA 4W9LC 4LQ1A 2FT7A 5IQLA 4E9WA 2JJSA 3BW9A 3OAZH 4AT6B 2Z8VC 3W39B 3N91A 1TKWB 2BS8A 4QRSB 4EQ2A 2ZUQC 2R2HB 2FSEA 4G6KH 4X6EB 3V8CA 4CC4A 1NEZA 4I9WD 3TC9A 2C3HA 2QVTA 1QLFA 2DYSB 3EDJA 1HH6A 2HRGA 4PJ5A 3TH4T 3D50A 3MLVH 1MCQA 5TF1H 1CU4H 5FK9B 4P3WA 1CE1H 4ACTA 5JIPA 3HNSL 5I18H 4LCWD 2YPLD 1HKLH 1CBVL 1BFSA 3VI4F 3TEYA 3O6LH 1BVZA 1V10A 3VH8G 3BUBA 3LS4H 1KPRB 2IPTL 2DWYA 4HF5H 3GBDA 1MREL 4JO4L 1JF5A 1KXTB 2AJUL 2J2ZB 1ODAA 3QEQB 1E3XA 1QPXA 2X38A 1E2ZA 1MJ7H 2TSBA 3P0GB 3WO4B 1E5CA 4X4XB 1K5NA 3UZQB 3NP3A 5BNXD 4NBXB 3B6SB 5DS1A 3H9ZA 1ULVA 4NAQA 2W94A 1NLDH 4JG0H 1EEZB 3HI1A 2Y06L 2XY1A 1JYXA 1OANA 4FNPA 1I1YA 4ZFGL 5FHBL 2CHXA 5K93A 5C08E 1F56A 3BWZA 4HS6B 4QTHA 4PI2A 3OJDB 4J3BA 3NIGF 3MFFA 2XSKA 4U49A 1KGWA 4EUPG 2B1HL 3EO9H 4P9MH 3GXUB 5D5MB 4UILH 2ADJA 4GMTL 3X12B 1M7IB 4ODSL 3CVHH 1G7MB 1X7QB 3MNWB 3KLAB 4OGYH 4HG4K 2A4ZA 3LKSA 1F86A 3O6MH 3EJRA 5CCHE 1DSWA 1YAZA 1QA9B 3VYPA 1L9SA 3DMMC 3HRZC 3L08A 2F5AL 5F71A 3WTYA 4WFHD 4QHMB 3CSTA 2QQNL 5IKCB 4PU2A 2DKUA 4EZLA 3KAAA 5CBEA 4FG4A 5TE6H 3RIFF 3T2NH 1SNRA 1KFAL 3U4BH 1SXAA 1XH1A 3Q3GA 5L9DL 1Z5LA 4BFBD 4HUXB 1BCIA 4I5BA 1DL7H 5FYLD 2CHDA 4LCYA 4WHYH 2VERN 5EC1B 3LS5L 1H15B 1JDAA 4H8UA 2AEIT 4YNYA 4I77H 1UA6L 5EU4A 3QISA 4WI5A 4G5ZL 3UFIA 1LWJA 2EDDA 4QRRA 2K1MA 1DJZA 3HG1D 1IGIL 5HP5A 1AKPA 3G08A 3KHOA 2EVHA 1J8SA 2IFGA 3BW9B 2PMZA 1BGXH 4YMPA 1F3DJ 1Z3RA 2FSEB 3WOVA 4MVBD 3CN3A 4LRNH 5JORA 4C4KO 1VCBC 2Y7LA 3GXTA 5KTEH 3DI3B 1NEZB 4JL1A 1UB5A 3LQAC 1HH6B 2R15A 4HJJH 4P4KC 4PJ5B 1ZPLA 3ZQ9A 3DVNB 4Y1AA 1H8NA 2OR7A 1E90A 2XN9B 4JUTA 4X2UA 4AGOA 3HC4L 1MAML 5DF0A 3RFZA 3G6JA 5EU6A 1SEQH 3C09B 3FXIC