2GPZA

Transthyretin-like protein from salmonella dublin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
111
structure length
110
Chain Sequence
MILSVHILDQQTGKPAPGVEVVLEQKKDGWTQLNTGHTDQDGRIKALWPEKAAAPGDYRVIFKTGQYFESKKLDTFFPEIPVEFHISKTNEHYHVPLLLSQYGYSTYRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Transthyretin-like Protein from Salmonella dublin, a Prokaryote 5-Hydroxyisourate Hydrolase.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar dublin
molecule tags Hydrolase
molecule keywords transthyretin-like protein
total genus 26
structure length 110
sequence length 111
chains with identical sequence C
ec nomenclature ec 3.5.2.17: Hydroxyisourate hydrolase.
pdb deposition date 2006-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2gpzA00
2NOYA 1IIKA 2B9AA 1DVUA 3GLZA 4MASA 4N86A 2QELA 4DEUA 3A4DA 1RLBA 3CN2A 3HJ0A 2GPZA 1X7TA 2B14A 3FCBA 1IE4A 3CN3A 3BSZA 4PMFA 3ESNA 3A4FA 4QRFA 5DEJA 2PABA 4DESA 1Z7JA 5AKVA 3DIDA 3U2IA 2G5UA 1OO2A 4HIQA 5K1JA 5CLYA 3CBRA 1E3FA 3IMWA 1FHNA 3U2JA 4PVNA 5CR1A 1SN5A 3CXFA 5JIQA 1TFPA 2QGEA 4I87A 3P3UA 3P3TA 4WO0A 4Y9CA 5L4IA 2B77A 3CN0A 3NEXA 1SN2A 1SOKA 3CN1A 2B15A 3P3SA 4ABVA 1BMZA 1DVZA 3I9PA 3NG5A 4YDMA 3D7PA 5E23A 4KY2A 3GRBA 4FI8A 4ANKA 5L4FA 3CN4A 4I85A 4HJUA 5AKTA 2G9KA 4D7BA 4PWJA 2QPFA 1IJNA 5FW8A 5CM1A 3D2TA 3DJRA 4TQPA 1FH2A 4TNGA 5EZPA 4AC2A 3IMUA 3OZKA 5FO2A 1TT6A 3ESOA 4Y9EA 4HJSA 1THAA 3P3RA 2F8IA 1KGJA 1F41A 1ZD6A 2ROXA 5AL0A 2G2NA 5K1NA 1GKEA 2WQAA 2B16A 3TCTA 1TLMA 2FBRA 5CN3A 4HISA 4TLSA 3GS4A 4IKLA 2ROYA 2H0EA 3NESA 5AKSA 4PWKA 5FW6A 2F7IA 4TL4A 1ETB1 4IKIA 3DGDA 4TLTA 3CFTA 4WNJA 3GS7A 2H6UA 3FC8A 3IMRA 4MRBA 4Y9GA 3A4EA 4FI7A 4PWFA 2G2PA 2H0JA 2QGCA 5TTRA 1TTBA 1TYRA 2H1XA 4TLKA 4PWEA 5A6IA 4IKKA 4Q14A 3DK2A 4IKJA 1DVYA 2G3XA 4TL5A 4TQIA 2H0FA 4QYAA 5AYTA 4ABQA 4DERA 5IHHA 4PWIA 1ZCRA 4AC4A 3CFMA 1TTCA 5BOJA 1G1OA 3CFQA 1TTAA 1BM7A 3I9IA 4TNEA 5HJGA 5JIMA 3W3BA 4N87A 4ABWA 3TFBA 2QGBA 3IMTA 4HJTA 1ETA1 1THCA 1U21A 3CFNA 3NEEA 3NEOA 1BZDA 1DVXA 4TQHA 5E4AA 2GABA 3QVAA 3OZLA 3GPSA 4TKWA 5AL8A 2QGDA 4TLUA 1TSHA 3IMSA 4I89A 1SOQA 4FI6A 4WNSA 2H4EA 5DWPA 4QXVA 3GRGA 1GKOA 1E4HA 1Y1DA 2TRHA 3DJTA 1F86A 4IK6A 3Q1EA 5L4JA 4DETA 2FLMA 1QABA 4PM1A 5CNHA 4Y9BA 5JIDA 4TNFA 2G3ZA 4PVLA 5CLXA 1QWHA 3IWVA 2G4GA 4MRCA 3DO4A 3DJSA 5EN3A 1E5AA 1DVQA 3BT0A 3GS0A 4DEWA 2TRYA 1BZ8A 4N85A 3DK0A 1IIIA 1X7SA 4L1TA 4PWGA 5FW7A 4IK7A 3B56A 3I9AA 3M1OA 5CLZA 4PMEA 4YDNA 3KGSA 1DVTA 3IPBA 4L1SA 4TM9A 5E4OA 3IPEA 3SSGA 1BZEA 4PWHA 5L4MA 4IIZA 3ESPA 1TTRA 1ICTA 1SN0A 3KGTA 1KGIA 3KGUA 4PVMA 3DJZA 3IWUA 1TZ8A 4TQ8A 4Y9FA 4ACTA 2G4EA 2IGLA 4ABUA 1DVSA 3IMVA
chains in the Genus database with same CATH superfamily
3VFMA 2VDKH 1Z9SA 1FZMA 4QWWD 2WZAA 2YPLD 2WN2A 1FFPB 1H6UA 2QPSA 3DYOA 3OKOB 5DHYB 4PS8A 1EGJH 1CMOA 4GIPD 2BJML 4G8FA 2DI8A 2PETA 3CBKB 4LT7A 2D7MA 3L1GA 3NPSB 1ZTXL 1BD2A 3CHSA 1NM9A 4FQ1H 5JOFB 3MBEA 1LWJA 3BZ4B 4FEMA 2JKLA 3FOLB 3NEXA 5CD5C 3RBGA 5HVHC 2QKIC 4HKJA 2GBTA 1HILB 1QKZL 2ZT9C 3E3QE 3ULVE 4MJ6A 1F6AB 1T5XA 3GMLB 2K8QA 5FGBA 5JPNA 2OAAA 2YXVA 2PTTB 4L48A 4GQQA 5I19L 4YWGL 5EEUA 3DWTA 1RZFL 3KPMB 5CEZL 5D70H 3SJVA 4B6ZA 3MJ9H 1JE6A 4OCWH 4PQXA 4QRPD 2EXWC 1E2ZA 4RGNC 4Y2LA 3L3DA 1CK0L 3D25B 2P46B 3WG7B 3HA0A 3NIGF 1JZ3A 3CJJA 3AT8A 4P5TD 5E9DD 2W8CA 1G9EA 4P2RE 4QNPE 1N64L 5CGYC 1FO0H 1OPGH 3V9CA 5HDRA 35C8H 1VB9A 2BVOA 2XZCL 3D34A 5T1KB 5DRZA 3W39A 2P8MA 3QCTH 4QDGA 4TF4A 4OD1H 4OJEH 2VIRA 4ENED 5KVEH 4NN5C 3NCMA 2EO9A 2OQJA 2VL4A 3RDTB 4HUWA 4KX8A 4JHBA 1NZRA 4JN2A 1OCWL 4M1CC 1WIPA 4ODTL 2WANA 4ZUWB 3FT1A 3RVUD 4NZDA 4HLEA 1SGKA 3CE1A 4TL5A 2KMWA 4FXGA 3E3QC 3R0NA 5IJKC 3M86A 2C3VB 2P8PA 2XN2A 4H26B 5JW5A 2AFNA 4HV8A 5G55A 5SX5K 2VR5A 1Q9LB 2A9NL 4JFZL 3P2DA 1CE1H 1FZKA 4XVSL 2XV3A 3VRLF 1QNZH 2JKXA 4Z0BL 4RISL 3ZE2F 5KVGE 5GGUB 1OSPH 5INDB 3O45A 2JK5B 4FX5A 4NFCA 1F86A 1GSKA 3QHFL 5CZVH 2HJKB 4NENA 5BMFH 5IG7A 1Q90A 4QLWA 4HWBH 5CCGE 2QQKL 1BREA 4MJIE 4HU8A 1SNRA 5DGRA 1R3LA 2XZAH 3OG4B 5EO0B 2Q10A 3TEYA 2LAGB 2WNXA 3PP3H 3DTXB 3ZKSD 4JFEA 1KULA 4O02B 2KHAA 4PUBL 4HIEA 4WKXA 1NGXA 1RPKA 2B2XH 2EH8H 4LCIH 1E42A 5E4OA 4F7TA 3UTTB 2UWEB 1QPPA 4ZOEA 5L4MA 1N4XH 4FHBD 4X8GA 1U8NB 2P3YA 3FKUS 5ERWB 4C83A 2YBRA 3QIWA 1HXYB 1GYWA 4GEIA 3UH8A 2DWEA 4J3SA 3M07A 4MSWB 5ES4B 4GH7B 1NA8A 1QFUL 4RQQA 4NPKA 2EDRA 1F90L 2P5WB 2YGOA 3ULUL 2QQKH 5B4MC 4MQ7B 2E86A 3TPUA 3N91A 2JJTA 3F62A 4WGWB 3GGWA 1KJ3L 1L3WA 2ED9A 5TF0A 4RAVB 3VUAA 3BPOB 3WDIA 3WNMA 1IB5A 4X80H 3FUDA 3C60A 1NMBL 4NT6A 3SEPA 1L7TL 3S3SA 4RVBA 1NFAA 4D8OA 2Y5TB 4LCVA 5EF1A 5IVXF 1S7QA 1SMDA 2IGFL 2EIBA 3BAWA 3QIUD 3MR9B 5CMAA 5FYLD 4NCC1 2COQA 3OSKA 3MACL 2LFGA 1DQLL 4KZ0A 2CGRH 2AF2A 2XQBL 2XTJC 4MS8D 5EC1A 3WEXB 3QRFM 5T3XD 4PGEA 1A8ZA 1V7NL 2OSLB 4MDJA 4XI5C 3ZUCA 3GB7B 2WWNA 1WTGT 3N5AA 1E5CA 2CNYA 2IWFA 1E30A 2PTUA 1MRFH 3CFIC 3E80A 3IRZA 3ZHNA 3T1WA 3CU7A 4BWUA 1CS6A 4PG9B 1JUFB 2IPKB 4LCCC 1YDPA 2IV9A 1JPFA 3TA3C 2BS9A 4R9HA 4ZMAT 2EINB 2DLFH 2A6KB 4NOBA 2HVKA 3OMNB 2V9QA 3QWRA 5E5MA 3GXUB 3A6CL 1J86A 4OCWL 4AX3A 3TL5A 4K5OA 1FL3A 3M7FB 4IHOB 4QRRD 3ZZSA 1WWBX 4Z76B 4AYFA 3MXWL 3MLTA 1Z9NA 3ZRFC 5B39B 3EZJB 5GS2D 1FGNH 4XCFL 3MLZH 1JXKA 2HCZX 4JS7A 4UQAA 4Y2DC 1UA3A 4WSGA 2E27H 2ZF8A 4GG6F 4JM0A 1J0IA 4LLWA 3GYRA 2HJFB 2VKWA 4HWBA 2FR4B 4L9LC 4YVUA 5D55A 4PJCA 3DHUA 2Z9TA 2VB5A 5EORH 1DEDA 1MFMA 1P5VB 2GFBA 2H26A 3K6FA 3DPBA 5AB0A 1SYVA 3L7FB 3N06B 4ZX4A 4HPYH 3ZO9A 1ORQB 1DBJL 3S48A 1IFHL 5DF0A 2TRYA 1AKJA 4N85A 1I53A 2IDSA 4IBUA 1K72A 5B21A 2OMWA 5KVDE 2WSPA 2DF3A 1M05A 1MCIA 3STBA 4NPJA 3AY2A 1OK0A 3CCHA 1ED3A 1R34A 5HHOB 1KGCD 1WTLA 5KYYA 2V8LA 1YYLH 2F53D 1G7HA 2BOBA 4BA8A 1V7NH 2Z93B 1NEUA 1ITBB 3KPSD 1X5KA 5HXMA 4JKMA 3KAAA 2WBXA 4KZDL 2XQ0A 4U2ZA 2XXMB 3CZEA 4DKTA 1ERNA 1A4KB 1XZ0B 2H9GB 3VMNA 4C56E 5A16B 4Z3GA 2PYEB 1G7JB 3NABL 4J4PD 4Z3FA 4X8CA 4KROC 3QO1A 1HTYA 4I1RA 4URKA 2ADFL 2HN7A 3E6HB 5DJ0B 4EI5A 5J13C 2CO4A 1AP2A 1CLZH 3C5XA 1C5BH 4W9HC 3APCA 5EU3A 4ZT1A 3T0EA 3KL3A 4KI5D 1N12A 4ZTPL 2G0LA 1UGKA 4IJ3B 4OLXH 4PJDE 4XAKE 4Y8DC 2JNZA 2ILLA 2WYHA 3Q0HA 3TIDB 2FQDA 1TQCB 1BWMA 4URTB 1INEH 5AOIA 4OBSA 4WCYL 5KWYC 2ZKHH 1JPFB 4ZZKA 3SB3A 4OZGA 5T5NF 2Z0BA 1RUQH 4J3OG 2D31A 3ARGB 3WV0A 5C8JA 5D8JH 1LP9E 4MHHG 1G94A 3SDAB 3KZ8A 3G04B 4QHMB 1IGCH 1NAKH 1RUAL 1SM3L 1XGTB 3X1NA 4GO9A 4JFOB 4G7QB 3MCLH 3GI9H 1KN4L 1X4ZA 1E43A 5FC9A 2NNRA 1EAQA 1SQMA 4M03A 3RE0A 1N2RA 2NY7L 4W9ZA 2WXHA 4KXAA 4JY6A 3UIZA 2Y9RT 2W65B 3UJTH 2Q87A 5JHDA 3UACA 3D51A 1WA1X 2I9LB 3OAZK 5A2JH 1AZZC 1SEBB 4H88L 1QR4A 3BAEH 2X4SB 3GSOA 4LKXB 4P5SA 3CMGA 5KJRL 4PJIE 3UL4A 2CPCA 3MNWB 4N3TA 4EI6B 2ZP9A 5A6LA 2DQCL 4GIAA 3FFDA 4PUBH 3BYTA 1H5BB 4UQ3B 5DRXB 1E28B 2J1XA 4MX7A 3MKKA 3MREA 1YNTA 4FA6A 3KLLA 2DWYA 3Q1EA 3C5ZB 5IT2L 3L4XA 3D8MA 3IMBA 5MEOB 3MGTA 3PP4H 5CZVL 1XSKA 3NDYE 2A3TA 4DN3L 4R7LA 5J4MA 5E08H 5IEHB 2EDYA 1OCWH 4ODTH 3P4NB 3JTTA 1KGYE 2WXJA 3IJEB 3Q1SL 3O3EA 4G9DA 1Z9OA 2BIPA 5C0JB 4PJ8B 1VFBB 4LQFL 3PGCA 2V9UA 3TCLA 4BCYA 4GP5B 4HQQH 1D7CA 2OW7A 1EV2E 1OE1A 5FO8A 1EDHA 3ARQA 4RNRA 1ZA3A 1BAFH 1UJ3A 5DHVA 1K85A 1E8WA 4TQ8A 3THML 3OBAA 4LVEA 3HJ0A 2FJHB 4JFFE 5EF0A 3Q6GH 2R0KL 1HKLH 1I85A 2ESVD 1RY7B 2XWTA 3BAXA 5E6YA 3V4VL 1ADQA 2CA3A 2CU9A 3S88H 2VM4A 3FCBA 4UILL 3VXPB 1KEMH 3RP1A 3WIHA 1PD0A 4F7KA 4Y8AA 4YHNA 1RHHB 4HIQA 4AQAA 5H4YA 1R17A 2P26A 1OOAA 1JVKA 3GTVA 3I50H 3MA7B 3US0A 5AOKA 3TBSA 4Z7VB 1MHPL 2E6PA 32C2A 3MV8E 3MJWA 2PP9A 2GJ6E 4HEPG 5I24A 5J9PA 2EE0A 1BZ9A 3ZZLA 4MKTA 4P5MB 2F54E 4YPGA 2X1WL 2CKBH 3ES6B 2AP2A 3IDMA 4DKAA 2W0FB 1PKQA 1XF4A 4H13C 4RGMC 4XBEL 5DUMH 3ZHLA 4IDJL 1OF0A 3TEWA 2WKOA 1WJ3A 2IQAA 3CC1A 5I18H 2IDFA 2APTA 3OZKA 4YDJA 2EEXA 1OLZA 2W80C 5DEFB 4Q4EA 5I1IL 2J25A 3DSFH 4GS7B 5EMYA 3FJTA 3W11D 5JXEA 3A67L 2DMGA 1DDHA 4PW3A 3WFHB 2HG5A 3OB0H 1BV8A 1HSBB 1MVUA 4QRRE 2I9TA 3KPTA 1MUJB 1AQMA 3T5WA 2UX7A 3JUZA 1XV8A 4QRSA 3C8KB 3NSXA 1GC1C 2P47B 3WBDA 1AD9A 3NQKA 3W0WB 4MXVF 3RHWF 1OT2A 4XPBL 3N44B 5HYJA 4M62H 1KB3A 4ZMPA 1I8MA 5CINL 3U1QA 1K4DB 3VG0H 3DOHA 2ADYA 2HKHL 2UZXB 1G4RA 3ATAA 1W72L 4MZIA 3TFBA 5EZOL 1MNNA 5CJ8A 3EJYC 5IHUH 4HWEL 1LO2H 2X6MA 5E5RB 2O4EA 1RQ5A 2YRLA 4U4BA 5FFGA 2YUWA 1ZV2A 4NUJA 1Z3GL 2I25N 4JVUA 4L8CA 1F4WH 4Q9BA 1Q94B 3II3A 2IANE 2AQNA 1QWNA 3UPAA 2QMJA 5FGBC 3QEUA 5ILTL 2RAMA 1QTPA 4NGHL 4A6YH 5BW7A 2VL5A 1USZA 1FJ1A 3LZFL 3LKPA 1SJVA 4ZRGA 4ZMXA 4G5AA 3NJNA 1E8YA 2V6HA 3H9HA 4JPWH 4HJJL 1WBYA 5AALA 2CPUA 2XBDA 4ZO6A 4A55A 1HE8A 1QPKA 2XRAH 5CLZA 5KG9A 2CBOA 1BM3L 3WUZA 1G7IA 1G84A 4HWZA 4WY7L 3Q01A 2Z31A 1Q38A 4OZHF 1OAKL 2DLTA 1SN0A 5D7LA 1NDMA 2MHAA 3LHAA 3OKKB 1F56A 5E2WH 4E9TA 5C6TH 4UAOB 4F8NA 5HYFA 5ICZB 32C2B 3JV0A 4WU5A 5AWNH 3MRKB 2DQMA 5E00A 2JKWA 5T3XL 4P2QB 2Y36L 3INUH 5JA8B 2ED8A 1JGLL 1O7VA 3QZWB 3FUEA 1FBIH 2OM5A 5FYLL 4JRXD 1LE5B 4J3TA 3QNXB 3SBRA 4X2UA 1EHLL 1A9EB 4K15A 1I9JH 3MOBL 1F00I 1BLNB 3GI8L 1HAUA 5MEQB 4JE4B 4QOKD 3I6GB 1NMAL 3BP4B 3U4BH 1UWFA 3FT0A 2VIRB 3TYFB 5SX4H 4XBMA 5SWZD 2NY5C 3VXQB 3H56A 4WI6A 1B0GB 2GTZB 3L3IB 3WFEL 1Z3GH 4GG8A 3GSQB 3OJMB 3BWUF 4MXQD 1TNMA 2DYSB 5B3SB 1X5YA 1CFVH 5H94A 4PJIF 2A83B 5BNXD 4CRPA 2EYSA 3F6LA 4LSPL 5AVWB 5J5EA 1P7KA 3EJPA 4A2LA 3A47A 1I3GL 4JRWA 1NC4D 4PBVC 3LNIA 3ZDZE 1HZLA 4Z77A 1I1AD 4JW3A 3I9GL 1H8NA 2L7EA 1F3DJ 5CKAA 4MMYA 4WW2B 3T0BA 4LFHD 2ADIA 2IQ9L 3FFCB 4P2RA 5C3IA 1CD8A 2ZSVA 4QRRB 2VH5H 1LK2B 3RZCD 3IXAB 4P3DB 1AR1B 2ED7A 3QIWC 4FQXC 2I27N 2O5NA 5ADOL 1NM4A 5C0EA 4NQED 1EEYA 3L3JB 1IEAB 4MA1C 4HIPA 4AC4A 2DH3A 4EUPB 1XGPA 1ZHNA 2WNWA 1BM7A 4U7KA 1VFMA 1SEQL 2AW2A 2XWXA 3K6NA 5H35B 3JWNC 4BKLA 1KV3A 3O6KH 3JYBA 1P9MA 2FJFA 5E6ID 1CXLA 3A67H 4OQTL 5AD0A 3G7TA 4M8QA 2PO6C 1UH3A 4FMVA 5GZOD 1ZTXE 3QIBC 5HJBA 2GB2A 3ZQWA 1PEZA 4NQCD 1P7QD 1P4IH 3WXVL 4WWID 1F4XH 1A14H 5DZPA 2G4GA 4F91B 3ZYZA 3IDNA 2VJ0A 2P8MB 1NGZA 2WGNB 5D7LB 1RK1B 4GSRA 4JGMA 1FRGH 1I8UA 1F42A 5C0BD 3HW7A 3SQRA 2ICWA 3X1FA 4WHDA 3MMEB 4YX2H 5F3HA 1HXMA 5IB2B 2GUYA 4JFFB 2KBGA 4NNYB 3S2AA 3S35X 4AJ0A 4X6CF 3L54A 2M26A 4N2DA 1XAKA 4C56A 3QO0A 4QXGL 3AU1B 3ILPA 3LRKA 2R0LH 3LRHA 4ZFZA 1G1YA 3DX6B 3GSRB 2XICA 3L3HA 3NCCB 3WUWA 2YEQA 2B9AA 1ZANH 1NPNA 3EOTH 3PY9A 1QSVA 4U1SA 3KXFD 4IRSA 4XPHH 2PCXA 3L5JA 1HESA 3BQUA 4QHNB 5CCKH 4LL1A 5F3FA 1CG9B 5CEZD 5EOCH 1V3LA 1GMEA 3D39B 4LLYB 4R4BB 2JJTC 1J05A 2B4CL 4C4KO 3UTTD 1AR1D 4K55A 4L3ED 2HAZA 4PCSA 1X5LA 4BK8A 2G3MA 1CXFA 3FFCD 5H37H 4AY0A 4UOJA 4D8PB 3W37A 1C08A 3GMQA 4F5CE 2NX5A 4PHZA 3C5SB 3T09A 4N90D 4XB8A 4R2GD 2QSVA 2RMNA 4D2NA 3C6EA 4NQCE 1ZD6A 2Z4QA 1E67A 4Y7OC 3SDCB 3SY0B 2IFFH 3HC0B 5D5MA 3FMGH 3LZLA 3CDCA 3JV4B 4MFHA 1UJTA 2FUTA 4BFIA 3IRCA 3ME0B 3WD5H 2YD5A 4Y5YB 1C8PA 2YAOA 2R15A 4NKMA 3BIAX 1WBXA 3LH2H 5CZKA 3V0DA 2Y24A 3CFTA 3DXAB 1KTLA 4X6DA 5JQ6L 4AKPA 5LWYL 1FZJB 2IGTA 2YHGA 2XG5A 4JANA 1WZAA 5F21B 2BOCA 1LP9B 1O6VA 1RJYB 1HIML 4BZ2H 1D6EB 3JT0A 4FG2A 4FZ8L 2Z91B 4GQZA 2NY0C 5DQ9B 4FEIA 2MJWA 2FBJH 2R2HA 3HC4L 4OT1H 5IVZB 5JOFA 4UYQA 2GHZA 2MNJB 3NTCH 5D4HA 5DMKB 3EJZD 3RUGA 1L7IH 5AYUL 4CVXA 3CCHB 4D9QE 3MLXL 1FORH 1RVFH 4DUVA 4LSVL 4Z7WA 2XYBA 1NGYB 4Y5XB 1T89C 4ADGA 4DETA 1L9NA 1J5DA 2PCYA 3B34A 2DYRB 3G5YB 3QUZB 4WHTA 2X2YA 2V9RA 5EZLA 4BSJA 5F9JB 1T2JA 4I0PB 5DQJB 4LEOB 1R3JB 3CG8A 1KJ2H 3RWEA 3RY6C 1D7FA 3CUPA 1INDH 2WQWA 3IXTB 4TSAH 3UMNA 3RIFK 1SY6L 4Y88A 1BZ8A 2A77H 2AEQH 1I31A 3F12B 5FO7A 4YSQA 2H0PA 4XWGL 4ZDHA 3VU2A 4OCNC 3PWPE 3P4OB 2F61A 1CFSA 2HKHH 1DQMH 3WEBA 4OKDA 4AV5A 1FFNA 1JV2B 2Q7YA 3WN5A 2A9CA 5IR1A 1QSFD 3CZLA 3PDOA 3LPPA 1KFAL 3O4LB 5IEKB 1RLWA 2BP0A 4B9YA 1EEUA 2DBLH 5AW6B 1TJHL 1IBYA 4F1ZA 5IUCA 5EBLB 3WTSA 2WVSA 1IV8A 1RU9L 2JKRM 4N2MA 1WHOA 4OCYH 2FYYB 4DO4A 2CE6A 3VXTB 4OF6A 5K9OA 3P11L 2WUCL 1IEBB 1TDQA 1I3RA 3NJLA 1UYWH 1ZT4B 1IZJA 2AMUA 2VITA 4IOFC 4B53A 4W6WB 3ARGD 1NLDL 1CU4H 2VLRA 4X7CC 4OT1L 1PSKL 4WU7A 1YC7A 5LVEA 3WY4A 5ESQA 3OR6A 3VXME 1Y1UA 3U2SA 2GJZB 2ZX9A 4JG9A 3VRLE 3F7YB 1YEIH 3CK0L 4GKZB 2NY0B 4IGBA 1HI6A 1BHGA 2A9BA 4FABH 4S1SL 4YHZL 3CPLB 3QJTB 3T8XA 5BV7C 4J3UA 3F64A 3B43A 4WHYG 5D1XC 1MHPH 3IDYB 1QATA 4CSPA 4F8LA 3WD5L 3RKDC 2A73A 4H44C 4UQ2A 2XN9B 5C09B 5IROD 2R2HB 5IVZA 3W9DA 5GS0L 2JB5H 4KKBD 1NCBL 4OJDH 3WJMB 3U9UB 5T3ZE 3VSUA 1HNGA 2OZNA 2WINB 5CIPB 4WTZA 4XRCA 1AP2B 3SZ6A 5A6IA 2BP8B 5F44A 4X5WB 5DD1H 2X4RB 3RI5K 3RTQD 3ZTNH 1VPOL 5FDWB 1BAFL 4QNPF 3B8SA 4JM2C 1OD7A 1U95A 1UGNA 5E1GA 5FUZL 4HQQL 4B9GA 1THCA 2V3DA 1TEYA 2EECA 1ND0B 2C4FU 2H8PB 1B6DA 4Q89A 3T3PE 2R8SL 2Y1VA 5JW3L 1FNLA 3ARVA 2JCWA 4PLKC 4S1DC 1RHFA 2NTSP 3MQIA 3WKNA 1XF2A 3SYOA 1A1OB 4JPSA 3EHBD 3GTNA 4XXDB 2G3ZA 3H3BC 4U1GC 4JDZB 4EDWL 3SDAC 4WFED 5I2IA 1J8RA 5BV7B 4JPVH 1LILA 4R8WH 1GHFL 3HE6D 2ZG1A 1NMBH 2H3NB 1KT2B 4NQUA 2HZHA 2XDHA 1A7OH 4ZX5A 1HHKB 4A7QA 3WNLA 1E4KA 5F89B 1SRDA 1JWMB 4Z7VA 3V7AE 1SJEB 2DV6A 5TH2B 4ODXA 4JO1L 3D3VA 4NWUL 5JYMA 1G7QB 4NEHB 4OLYH 1WAEA 5HGHB 1S7XA 1UEYA 3IDXL 4UI2A 3D2UD 1MN4A 1ZWIB 1PGRB 1WAAF 2WXLA 2X4PB 4Z23A 3ATEA 4HIHA 4IRJB 1UXWA 1B3IA 2XTJB 2ZX6A 4HBQA 3U0WL 4HAKA 4OSUL 1Z6JT 4ZUWA 3HMXH 4B50A 4BQCA 3HVNA 1UVQB 3MJ6A 1G9HA 2YXMA 4A68A 5ICYA 1TG8A 3QCVL 1X4YA 3W56A 2OTUB 4HS3B 1YN6A 4KJYB 3BIKB 5HY9A 1DE4B 3P30L 4XVTL 3RL1A 2X0UA 3CN1A 3AREB 4AEHL 3VD1A 4WF7A 3B9KA 1YEHL 2ZKHL 1KCBA 4PJAB 5L4FA 1NC2A 4AI7A 1N7MH 4S11A 4GEJA 3HMWH 2V2XA 2A73B 4UQ2B 1DUYB 2HMID 4H8WH 1URZA 1AOHA 5ENWB 3MV7B 5FA4A 4E5XA 3FUKA 1KJVA 4KO9A 2Q1EA 3CZJA 3AQDA 4LSUH 5CLWA 2AAAA 2GTQA 5AQ0A 3B6SB 3FQTB 3GK8H 3VWJD 4OCSH 1KFAH 2HA1A 3CBJB 3D1MC 2UYLB 3J2PA 3KLAA 2G5RA 4FYRA 3NK3A 1YYML 3OAYH 1G7LB 2JXMB 5KYXA 4WFEE 2YA2A 1IAMA 1LMKA 5FEBA 1OGAE 1CLYL 4A7VA 2D0HA 3OXRA 3DECA 2HP4A 1I7TB 1U91B 2N3JA 1UXMA 2IPTH 4J3VA 4GNKB 3BXNA 5AW5B 1QFWI 2WKGA 4I1PA 2Z8SA 3K4DA 4EVNB 1BZQK 3FRUB 5H4ZA 1A1OA 2R0ZH 1E3XA 2Q8BH 4RRPM 2HLEB 5D1QD 3SDYL 3VI4A 2ZXBA 3BAIA 3NSJA 2XPYA 4JJ5B 1Q4NX 3SBWA 4WV1C 4HF5H 1N0XL 2UXGA 4YUEL 3VFNB 2Z7YA 3DVFA 4H1LG 3N43F 4DWHA 3OZLA 1YNTF 1FNSH 2YD4A 4LSQL 1RZQA 4ZNCD 4NN7B 1E6JH 3IPFA 4WI5A 3DHJA 1EHLH 3G6DH 3DJTA 1S8DB 3MUGA 3O9WA 3P9LB 2BZ7A 3S0PA 2O5ZH 2X4TB 5IB4A 3B7SA 4OTXL 5CP3H 1MVUB 1QSFE 1W72B 2DI9A 2EDMA 3IN2A 4TNWF 1MRCH 3ARBD 4PR5B 3TBTA 5LWYH 2FATH 3MV9A 3DMMC 4AW4A 4KDWA 1W8NA 1A7PL 3QFJA 3DA0A 4EMZA 5GZNC 3RPIA 5FW7A 2IANA 5HHVH 3VJ6B 5D7IA 5GGQH 1N10A 5C0AA 3RILA 1T6VN 5I6PA 3ZJAA 1XMWA 3LKNB 4PLJD 4WK4B 3ULSB 5MEPB 4NQDD 1R3HB 4K3DH 3EW3B 4R5VA 1A9VA 1G0YR 4BK5C 2EDWA 3FSVA 2A0LD 2DMKA 3GC3A 3SE9H 4ELDA 4JAMA 2JELL 2D4FA 4PJ5A 1SEBA 2MOGA 3EFDH 3GLDA 3P0YH 3SKNA 4A7TA 3TTSA 3CN3A 1PTZA 5I75C 3QNYA 3GMPA 5E6ZA 3B7TA 3FFDB 3L3GA 3UTSB 2R29A 4Y89A 4DAGH 3DO7B 5I30H 1ZLUK 5IKCB 1EWHA 1KPUA 3TBBA 4UV4H 1NICA 4HUVA 4MDIA 2FEEI 4KV5F 1KCKA 1WHPA 4LLQA 1IQDA 4JZNB 5D1QE 5C86A 3GRBA 4ZFGH 1OGPA 5CEXA 2BERA 5E2UH 4AEFA 3VG0L 3IETB 4PJBB 2IV8A 4BRVA 4ZFOA 3MFFB 1N0LA 1P6FA 5E24E 1MFAL 2FHCA 2YQ3A 3MGOA 2PXYB 2DMCA 3FTUA 4YGAB 1XIWA 1PPIA 2G2NA 1XMEB 2R1YB 1A6WL 5K1NA 3T71A 3AXHA 2CG9X 1U93A 2WQUA 4HBCL 1PZ5B 4MJHA 3VI3B 5I1EH 3II2A 4TLSA 2V2WB 1TQBB 1ZHBB 2VQUA 3W9EA 1JV5B 1WAPA 3ULVC 1RFDL 4J2XA 3DGDA 4B9ZA 4LVHC 3BWZA 1JGVL 4ZW8A 3FQNB 1AQDA 3P4LA 4JFEE 3BZ5A 2QSTA 2IADB 3IN0A 5ITBL 3HNVH 3K8MA 1RK0B 4L8SB 5IQ7H 3BRDA 4RZCB 2YOCA 3JT2A 4GRLB 1BOYA 1I82A 1HCFX 1JS4A 2NY5H 1CGSH 4KKLC 1DN0A 3IGUA 3UBXB 4ZFOL 3T2QA 4ZAKD 5A16A 5IV2A 2ZUXA 2F8XC 5FYLE 1G6RL 4G1EA 2F5BL 3ATBA 1IC7H 5GSVA 5SX5H 1K9TA 2J20A 2V7NB 4PGDB 5A2BA 3QORA 1R1CA 3ECQA 2CO7B 2HFGL 2R29L 3GQFA 3QXAA 1P7KB 3L5HA 4O02H 4XNZC 3S5LG 1UQSA 3DX6A 4Y5VA 1UB6B 4R2GB 1M7UA 1S7TA 2IBZX 2XOTA 1NDGB 1BF5A 1BP3B 4RISH 1TQUA 3O3AA 3VXUA 1TQBC 3D9AH 1CE1L 3SD2A 3KGSA 4LBEB 1KTJA 5IHZB 4N0UB 3ZYOA 1DQQB 4ODUB 3FO1B 4OGQC 4KKNA 2YK1L 5E2VH 1IM3B 4Y16D 3OXSB 2BSRA 2QKIB 5EIIG 1FDLH 1Q9LA 2IGLA 3TT1L 4YC2C 1CFVL 2JB6B 4X4KA 4ABUA 5DLMH 3TGXA 3CVCA 2EE9A 3ARDD 1ZT1A 4J3OC 3TT3H 3UGXA 1C08B 3IS1X 3UZEA 4N0FA 3ZHFA 2KH2B 1WP6A 5B7FA 5CN2A 3LD8B 1NKRA 4GOSA 3PAUA 4OD2B 1HYSC 1MI5A 4RAHA 2K3TA 4F58L 2XYCA 3GSXA 4OF0A 1KIUA 1OPGL 2A74B 5D2LB 3UGUA 4FP8H 3DBXB 4H5SA 4ZS7L 1BD2B 2Y6SD 4CC4A 1BMZA 1HT6A 5E94B 4X0NA 1WA2X 3RVWC 3X13B 1FFOB 1TIUA 5AENA 2LW3A 4W9DC 4M8UA 3QDME 4OH2A 3BEWA 3B3BA 1RZPA 1GL4B 1NGXB 1N19A 1RIHH 1WFMA 1QFHA 2ZKXA 2HFGH 3Q8BA 2DLIA 3IYLW 3HFFA 2PCPB 1P69B 3LSOA 3O41B 1MFDH 5KG9B 3HI1B 3V7MA 1JGVH 1O9VA 1WITA 3L1EA 1EERB 2WQAA 5KVMC 4JDTH 5EULV 1CVRA 3PAVA 2BFVH 3HE7B 4XN4A 2BHFA 3BSZL 4OIBA 4WHYH 1ZLVK 3O6ML 2O93L 2ATPB 5E8OA 5IBLC 1UENA 2E47A 2M83A 3BKJH 1F8TL 4JHAH 1RUQL 1LHZA 1PKOA 5GGVY 3GSVB 3BWAA 3OF6D 2ZYIA 4PWEA 3SGDH 1MFAH 3IFOA 3UDWA 1PZ3A 4JN2B 4ORZC 3BO8B 3HAEB 2QVTA 3QNXA 2EYTB 1M6UA 4A39A 3T0WA 1NFDE 3QYMA 2IH3A 2R2EA 2BC4A 3RWDB 4DK6A 4S10A 2E7DA 4FXGB 2GT9B 3SCMD 3LRMA 1AMXA 2A7BA 2ORBL 4PY7A 4R96A 4HBCH 4ONOA 1QI5A 2DQTL 1QR1B 4ZTPH 2VLJE 5I6LA 3K1DA 1U33A 1VACA 4XP6L 3KLKA 4UT6H 2APWA 3QI9B 4QYOA 4G8EB 5DJ6B 2P80D 3B7YA 4WI4A 2DWDB 1T03L 4XNYL 2CLVA 2K1MA 3KLHD 3WDJA 5HSFA 4OCRH 3FO1A 4UM9B 2D9CA 3HTLX 2RA1A 3C75A 3ABLB 1RURH 2ESVB 2VN6A 2J6EA 4XP9L 2GK0B 4AUYA 1NEZG 4JFEB 4UT9A 5L8LB 2NY6B 4M93C 5GGSB 4NJ9H 2BNRA 1A6PA 1NCGA 3QDMD 2A74C 4OD3H 4QHLA 4BJLA 3M1OA 1UM6L 4Z77B 1JPEA 5DEFA 1YYLL 3RX7A 2E6QA 4JZJC 4O02A 2FSDA 5SX4I 4WTQA 4JDTL 1QX1A 4XHQA 5B1AB 3HLKA 3U36B 2J71A 1YJDH 2Z64C 2C3GA 5IMMA 1H3GA 4M4RA 2EDLA 3HI6L 1W16A 4F57H 4TVPL 4RFEB 4FXGC 2FHBA 4YHKL 4GAAA 3A4FA 4Y2OA 4ILDA 4QF1A 3U2IA 1KPRB 2ZOOA 2C9SA 3ILQC 2HMIC 4UTBA 4E2OA 1I8MB 3QA3A 4CN6A 4E9XA 4PS7A 3OPZL 1BX2B 3QFDA 3RNQB 2YAMA 2GITA 2KQNA 4NKOA 4OJYA 4XNXL 3HNSL 1AGEB 1H3PH 1WUZA 1MIEH 5CILL 3TO4D 1KENH 1X9UA 1CLVA 5I71B 3HI5H 4LLAA 3GXTA 3FAXA 3JWNG 4BE6A 2WINA 2I5YL 3ISWA 3U82B 1A7QL 3VDBA 3BUTA 2VDPH 3TNMA 4GBXD 1E4XI 5AAMC 2RQ8A 3RNKA 2XN1A 2VSKB 3SOBH 4A2GA 4ENZA 2KLRA 4LKCA 3FO0L 3BAKA 5JZ7D 2HJLB 3L4VA 3Q2VA 1BSIA 4YSEA 5JQIB 2VN4A 3K2KA 1JNLH 1A6VH 3FU8A 4KQ4H 3SDYH 1L9OA 5F1SA 2H0EA 4JG0H 2PPDA 1BLIA 3QC5X 5ABZA 1GS8A 3JVFC 1ZS2A 4N1HB 3NCJL 4UQIM 2GVYA 5I8CB 5LJYH 4IKKA 1JPTH 3L9BA 2F53E 1S5IH 4LOEA 1IAIH 3B4NA 3HMWL 4BH8B 4Q6IB 1YEJL 1QYGH 5C07A 4YXKL 1VCAA 2NY3B 5EU5B 2X70A 4N68A 4WW1B 2WSDA 2ITEA 3C6SB 4L4VB 1S5HB 1OD9A 1K5NB 4HH9A 3L9RA 3IMSA 5T1MB 1BQUA 5J0BA 4JFDB 4LSUL 4QMEA 2QHRL 3H54A 5AVZB 5E5UB 4QGTA 1II4E 5C2BH 1ZA6A 1FNGB 5HPMB 1KMGA 2NY5L 3QUMB 4M5ZL 5EIQA 2UV3A 3ETBF 3ULUH 2J8UF 1GGIL 3KPNB 4CW1A 2YUZA 4WHCA 1DVQA 1XGTA 3BUDA 3TP4A 4XO8A 4MVBC 3U30C 2DYPD 3FU3A 3U9UA 2F5BH 2WTOA 4DZ8B 4XP4L 4YSTA 5GGTL 5IIEA 2A0LC 1TJMA 4Y5YA 3U46A 4PHXA 1OGAB 3SSGA 1XEDA 1BOGB 3T3MF 3WE6B 2ENSA 1YN6B 1MCLA 4KJYA 4N9GB 3HCVB 3AT0A 3OKNA 4RZKA 1D5XA 3GMNA 1BFOB 1S7SB 3X3FH 2OMTB 1CTOA 5D8JL 5C0CA 1BX2A 5EZPA 1GYUA 3QQNA 3CHQA 3EGSB 4XCNA 3GRWL 1SY6A 3NFSL 5CJXC 5DD6A 1A66A 2P24B 2D7QA 3IDXH 2V17H 2GBVA 4NWUH 4K5PA 3IJ9A 2HN7B 4L3AA 5IMOA 3UJIH 3ARPA 4OLXL 5I8OL 1IE5A 5AB2A 5CLTA 3L5IA 5ESAB 1KLUA 2AJUH 1FL5A 4PGCB 1ZHKB 5C08A 4AITA 2PR4H 1FZMB 1WH0A 5C9JA 2H3NA 3MZTA 1EX0A 3PL6D 4KKAC 4YDKL 4I85A 1NUNB 3N0AA 4ELMF 1PX4A 5C09D 3QFGA 4WENB 1U8OA 4OLUH 5E03A 4XNDA 4MD4B 2P48B 4OJAA 3DARA 4F7EA 2QADC 5E7BA 4QY8A 1W91A 4KMQA 1T22B 5I76A 4W9CC 3AZUA 5H37G 4ZW6A 5FKAB 2A9DA 1MEXH 2BS71 4U6HA 2GSGB 3V4PH 4ZMYA 4R7NA 5JHDE 2ROYA 5IFHL 4OGAC 3ZYIA 3K72B 2DY2A 5SV3A 3TOPA 3Q8AA 4ZUVB 1ZS8A 4RFOL 4YHML 4NO5B 5ICYB 1WE5A 3D52A 4G43A 3VI4E 3BLBA 2YAQA 4S1SH 3WNNA 2PCFB 3HZVA 1IFHH 4F3FB 1DBJH 4O2FA 1MRCL 2JI3A 3D09A 4UT7L 1YEIL 4A66A 3KJ4C 4PI2A 1FVEA 1NCBH 2LTQC 3HRZB 1KIQA 3I85A 3GPEA 4P2AA 1ZA6B 1MAJA 4LIQL 1M71A 5TFSL 1KGXA 3DNKA 1N5YL 2W88A 2BHUA 5E7FA 3VXRB 2OP4H 2NX5E 4LIQE 1BD2D 1J0ZA 1PZAA 3MBED 4PRPD 4U1HB 4FQ1L 3A5VA 4F2EA 1N0XH 4ZUUB 3MXWH 3KMDA 3BVVA 3NIGB 2KZKA 4P9ML 2R0WL 2VERN 5HI3C 4YEFA 5CIPH 2I26N 5DVMA 4XWOD 1QWHA 2A6IB 4F8PA 5IB3B 1MCHA 1BVNT 5AVSB 1KTRL 3UC0L 5AVUB 5FB8B 2LVEA 4NO2B 4A67A 1OSZB 3BP5B 4ZSOE 5HD8C 4HCFA 4PRBA 2YD2A 1AZUA 5B1BB 3F5WB 4L1TA 1C8QA 4DGWC 3WIIH 3P77A 4XBGB 3S3JA 3EXLA 4MMXC 4LL4A 2HFFB 5EDSA 4U1MA 2BNQB 1CE6A 2VUYA 4C59B 4Y9FA 4L0YA 1WAAA 4OV6F 4JG1H 4TQEL 2HLAA 43CAB 4XBPB 3MRNA 5KS9B 1TJHH 5AW8B 1KTCA 1OLLA 2I7SA 6PCYA 2ICCA 2W60B 1DQLH 2JJSC 4TSBH 4BK5A 1F11B 1HH6B 5DFAA 5I9QC 5BZZA 3OG6B 5H8DA 3V6BR 4HAFA 4MCMA 2O5XH 3C08L 3R1GH 4UUJB 4NFBA 1SN5A 3FQ4A 3V5DA 2DS4A 5GS0H 2QLYA 3MLRH 2DWEB 4NQXA 1IGFL 4ODWB 2XFXA 3CWGA 1M7DB 1GGBH 2AEQL 1FE8H 4OQTA 1U8LA 4K23H 2ZAGA 4JFYA 3HUJF 1AE6L 3LEVH 3DMMB 4HJUA 3OKLB 4Q4IA 2BSCA 5IB1B 1DQDL 3E8UL 2KS0A 1YEDA 4FFWC 4RIRB 4HW6A 4HHWA 1OCOB 2R0WH 4MJ2A 3VWJB 3G5YA 3T0EE 1YEHH 2FLRT 3ECBB 4JB9H 3KM2A 4HUXA 1WAAE 3OLEA 2BWDA 4R26L 3QXDA 4H0HB 4Y9EA 3LXAA 1QSEE 3UFIA 2GQHA 4BEIA 5DZVA 3O8XA 1JCVA 2J12B 4RDQF 5T1KD 4PV9B 3UYPA 3KXFE 1ZSHA 4LIQH 4PSPA 4KY1L 5TFSH 4AE0A 4X7TB 4AQ8C 2CA4A 2XU9A 1ZVNA 2XQYG 2J1WA 3FU7B 2V7NA 4PGDA 4YGVA 4LOVA 3SYAA 1L0PA 2H0JA 3NZ8B 3L5XL 4MCZA 3HG2A 2X2JA 2FT6A 2F5AH 5GS0D 1LVEA 2XZAL 3AABA 5BS0E 3KD4A 5DDHA 2WAQA 2AI0H 5I5IA 3AB0C 3ZK0A 1QFOA 4JO1H 1MCPH 1OXYA 2XKNB 5KSVB 1MEXL 4GXVL 2BY2A 4PW9A 2H32H 5IVXB 1N5AB 5CBAB 1JNJA 3QG7H 1DANT 2CLZB 1QLEL 5C0FB 1TVBB 2WWKT 1CD1B 1WVZA 4QTHA 1Y1DA 5GS0C 1O9ZA 1LM8V 3JV5A 2EIEA 4LESA 2MPVA 2HFFA 3IWVA 3VWKC 1IVTA 3LVTA 5DSCA 1JGEA 1ZHBA 5IGXL 4BGLA 2OSYA 4EUPG 1AGFA 4XNMB 2J8OA 4QT5B 4YK4C 1S9WB 3KYAA 5ADPH 4QXTA 1U92B 4HPOH 1H19A 1U8QB 2R59A 1KFGA 4KRLB 3TLRA 1LEGB 2EXYC 2YKKA 5IQ9A 5ABAA 4ZUSA 2MCPL 4HHAB 2V9TA 1CGWA 35C8L 1M6OA 4PGJA 2CUMA 5DD1L 1ACYL 3E0GA 3HBGA 4YFLI 5E8PA 4WFGE 1NBVL 4UF7C 2R9HC 2PW1B 3OKEB 4XNAA 2BHYA 1CK0H 3UBFA 2ID5A 4ZD3H 3NSFA 4HSQA 5DGQA 2WWMD 2GPZA 1QLRB 3RX8A 3MJ9L 4OCLC 4GG6B 1JWUA 5DMJB 2HLFC 4FLSA 4JVWA 3VYPA 5KYYB 5DJDB 4BV1A 1QA9A 5HDQL 1J8HE 3M46A 1QKZH 3DETC 4U0RB 4WV1A 3SKJH 1WC7B 3WFBH 2EXTA 1D5ZA 2ZWSA 3IJSB 1MHEB 2QSQA 3HR5B 3ULAB 3TZVC 1FFTB 3FUNA 5KUMA 2WP3O 4MNGA 3VTMA 1W72A 3G6JE 3DYMA 3CDGA 3IKCA 5EN2B 1H0DA 4C58B 4F15B 5CM1A 3QFJB 4XXDA 5DZNA 2VAJA 4G6FB 3GZKA 5FF6A 4POUB 1KXQE 5AUMA 5E6SB 5C0AB 4BKSC 3NRFA 3BDBA 2HFEB 4XX1E 1EZVY 1JHKH 3WKQA 5CN3A 1E4WH 5F71A 1K3ZA 2YBGA 1NCHA 2X4OB 4KRNA 1CYGA 5F8QC 4MCYB 4PWKA 1K6QH 2DQJH 1K8IB 3ZGHA 5IFJB 5DK0A 3LN9A 4KXDA 1MCQA 1I9RH 3LEYL 1A3LL 3QNFA 1LK2A 1CLOL 1UWYA 3NA9L 3EG9B 3G9AB 4J4PA 3QUYB 1U36A 1CYWA 5D6CB 4HJ0C 4M61A 4RDBA 4FYQA 4W9FC 3OKOA 2VZOA 3CFNA 5EEXA 3GEFA 1N2RB 4W9IC 3UO1H 1T1XB 4NHUB 4O2EA 1E4XL 1INQA 3R06A 3Q13A 3VX0A 3NTCL 3B1TA 1JVLA 2DYPB 1PYWB 2YA0A 3ZKNC 1VEOA 3BKMH 2XTJD 4RGOH 4HHAA 2YAPA 5AZEL 2NXYB 1EXUA 3FPXA 1J1OL 4P9MH 1BG9A 2VDPB 3OMIB 2V5TA 4HIJB 1A25A 3O4OB 5I17B 3ALPA 3MOBH 3FFCE 2BNQE 2CUIA 3CH1B 4MJIA 4WEUD 1OAKH 1L7IL 5FLVA 2W5PA 3L3DB 4AENB 3OKDA 4OI9A 3OJDA 2GTWA 4K7PH 4PJHE 4X9IA 4YHKH 3IU3B 1PG7X 3TNNB 1QWUA 4KMLB 1JRHL 4PIRF 4FNQA 2I07A 2O26U 3P9WB 1MHEA 4RSVA 2Q3XA 3CFEA 1OP9A 2MQ0A 4UB0L 3L95A 4XN5A 3NIGE 3L2NA 1KC5H 2ZUWA 4NQSB 1LTXA 3II1A 4PJDA 4GINA 3HNTL 4QRUB 4ANUA 1EFXD 4MHHI 4XPAL 3BQUB 1XQ4A 1J05B 3QEQD 1KBGL 3VCLA 3CSFA 3FTWA 2D73A 3FB8B 4LL9A 4BH7B 4Y5YC 4ZTEA 5C0AE 4D9LL 1EZVX 4TPRL 2R1WB 1B6UA 3RY5A 5AKTA 2UUDH 4N2IA 2ZOTA 2E7LC 5ID1B 4YZFE 4TNGA 1E6OL 3QQ9D 3QUYC 4R7XA 3OB8A 2FSEA 3VD9A 2X4NA 1P84J 4DSYA 3ERXA 3CZNA 1TLMA 4LGSB 5AVQB 2Z4QB 1A6UL 5F9DC 1J8HB 1I1AC 4I48B 4PS4L 3WI9A 1G9MC 5F96H 1R6VA 2F15A 1QVOB 5EFIB 1MG2C 4RAUA 1T21A 2CXGA 2VR4A 3QAZB 3RNQA 4ZG1A 4HJGB 3O4OC 1JWSA 4X6FA 3Q2LA 5EIIB 5H2BB 1MI5B 3HLAA 1QMUA 1SHMA 1T1ZA 1P4IL 2O5YL 2W9DH 1MXGA 2K9FB 5HHOD 2YBRB 3QIWB 4NSKA 1LDPH 3ARWA 1C12B 4XP5H 1TKWB 4N9GA 5TDPB 5C0BE 5GRUH 1MELA 1MW3A 1PD1A 3V10A 5I18L 1EMTL 2XIDA 3VH8B 1HK6A 1CF8H 3B1UA 3VFUB 5DD5H 3RGVB 1Q0YH 2VDRB 4N24A 1IGYB 2JWYA 3W0WE 2CLRB 4K7PX 4CN4A 5CHNA 2ZXWB 2CNZA 5EU4A 4MQTB 5JXED 1XB6A 3MR9A 3NIFF 5CMAB 4WSKA 2JTYA 2K4WA 4PS4H 5DQDH 5BO0D 2WCPA 4K94H 2TSAA 1I1FA 5IJKA 1JF6A 5JHAA 4NQSA 2YIHA 3OX8B 4E9SA 3DETD 4R5TA 2RTTA 2V8MA 3MDJA 1FN4B 5F97E 4TRPH 5BS0B 3WAJA 5EF2A 1QBML 5KEZA 2H8PA 3QDGD 1RZKL 2AJYL 3O6FA 2QDVA 4AG4H 1VACB 4H8VA 1JZDC 4FTVE 4TOYL 4QD2E 3VFTA 1OWRM 5E5MB 3VXTA 4B9FA 5D7KE 2EDHA 1UACL 3DRQB 4M00A 4Y9CA 1IL1B 2A6KA 5L0QC 3IFNL 5TGBA 4U6HB 4MNQD 4P2QA 1Y07A 4B3EA 3V4VB 1HC1A 4K94C 3K72A 1JN6B 3FS9A 3KR3L 2D03H 3GMRA 2WMPA 4JM2A 5LAXA 3DUSA 1HKFA 1NGQL 4GXFA 1I7UA 2IALA 5ICXA 1EBPA 4AK1A 5MP6H 4PJ6A 5IW6B 4GW5A 4XNXH 3K6IA 3OVUB 1RUML 2OCFD 4GKZA 1WQVT 2DWSA 4IGBB 4R6UA 2BVTA 2FTAA 2AKRB 3GI9L 5LNEA 5KSBA 1TQSA 2CO3A 3KM1A 4HUKB 2FECI 4HGWA 1FHGA 3ZKMC 1A6ZA 3QQ3B 2MFNA 1T04A 2FEDC 2YPKB 3BAEL 3ZDXE 4DP9X 4GG8B 2GCYA 5F6HJ 4TLTA 5CD3A 5ITBH 4V1DB 4AMWA 2Y36H 1XCTA 4GAJL 3HZKA 3PIQB 3ULUF 3DVNB 1A02N 1PZDA 1U8PB 4AQEB 1LYQA 2BY0A 2Q76B 2CH8A 4PSRA 3NFPA 1UXSA 3CHOA 4YHIB 1UWXK 1DVYA 3ZHDA 1IQWH 4D9QD 4ELKB 3MRGB 4KXZI 1YJDL 4MB4A 5SWSE 4B5EA 5KS9E 4FCAA 3F83A 1QEXA 1QRNE 5ISZE 1OCZB 2EICA 4Z5RA 1WWAX 4WY7H 3KE0A 1NAKL 1B2YA 1MIMH 5E95B 4ZPTB 1CXHA 3RFRA 2F1EA 1WLHA 1JZHA 5CFAA 4QXVA 2IG2L 5FFLA 2XJKA 1D6VH 1UC6A 2CHWA 1VADB 3SPVB 5SWZA 4BHUI 4G8GE 4QKXB 5KAQF 3FB5B 4P59H 2IXQA 2QJDA 4FQCH 4R7NB 3QUKB 2EADA 3LCYA 4K0OA 3SE8H 5HHPB 4KZDH 2HFTA 1FCGA 4L8BA 2E7MA 4XCCL 2DQJL 1FNEB 3QUHA 4H1LB 1BECA 4GAYA 2VLMD 2GAZB 1ZPLA 1NC4A 2BSTA 1OW0A 2HTLD 3GDBA 1DJYA 1IILE 1VFAB 3MROA 1GS7A 3QEQB 2OSWA 2JIXA 3P2BA 1JGDA 3QUXC 5E8DH 3T2LA 2ITFA 3SDXF 1R0AL 3H7BA 1W6LA 2JELH 2F68X 4NYLB 2EDQA 3QI9D 3QWNA 4NM4H 3AUWB 3K71A 1U0QA 2VDRH 1BZOA 5EU5A 5EORL 3ARED 3KPLA 4V33A 5FCUL 5HGGS 1CVSC 2APFA 2ZXQA 5BRZB 3RWCA 5T5FL 5JHDB 2YS4A 3S5LA 1CFNB 1NIDA 5E6IA 2VXQL 3FB7A 4F5CA 2H45A 4QHUA 5HVFB 2AEPL 5JHLL 5GZOA 5I16B 4P9HC 2FATL 3L4UA 3MCKB 3QDGB 3SGDI 2R2BA 2OMYB 3U9PL 3CLWA 4J3OD 1VA9A 4Y1AB 4NQCA 4KX7A 2WTPA 3UAEA 4HGWB 2CCVA 1BZ7A 1MY7A 5D7IB 3CFDB 2EZ0C 4F92B 1D5BA 2ITDA 4ZQTA 3G08B 4Z3EA 2NXYD 5EUOA 4E36A 1SVZA 2K0RA 1ZXKA 3C6LA 4A7GA 3U46B 4OM0H 5HYSA 3QUZD 3OGOE 2BVQA 4XGZA 4PJ5E 1PAMA 3GHBH 2MCG1 1MPAH 3U4EA 4HF5L 4PJEE 2N4IA 3RPBA 3I50L 4KFMA 1N5AA 1I75A 2G3NA 2WOBA 5C0RL 2RR3A 3PAYA 4KC3B 2ITCA 2AJZB 2HX8A 4Q8BA 4ZTOH 4Q74A 4G9DB 4KO5A 3SGJC 1SBBA 3O3BA 1YQVH 5GQBA 2F58H 2HLFD 3NP4A 2VXSH 4QXUH 5FECA 2Y22A 2BNUB 4MBRA 3AJ7A 2HVJA 3DO7A 2NZ9C 4NBXB 4KVCL 2AQRA 3KXFA 4QTIH 3WY1A 1KIRB 1MWAH 3MV01 2ICES 3ISYA 3V4LA 2QV4A 4YIQB 1ZVSA 2BFGA 1MRFL 1VCBC 3PABB 4ADIA 4APQD 5B7MA 4AMKH 3VFVA 4ATWA 3BVXA 2PR4L 2QBWA 4YXLH 3JWDH 1ECZA 3W0WD 3LEXB 3QC6X 5DJ2A 3VA2C 5KBDA 4AQAB 3UTTA 4OKVA 4BM7A 2FH6A 3DSNB 4NFDA 4X9YA 1OAZH 2Y2WA 3WS3A 5T3XE 3TJEL 4NPYA 1R4XA 1U8OB 4DP7X 4X5LA 4XPGH 2PW1A 3OKEA 4ISVA 5AW4B 3ESMA 4XXWC 2CR0A 3T77A 3ZRCC 4LHUG 3TJHC 5I1HH 3QRGH 1JGDB 1E5AA 2C9VA 2HTKD 2WQXA 2OQJB 3GXPA 5HHQA 2SODB 2KDGA 3P30H 1JGUH 1N6QL 2IPUG 3I9AA 4N3UA 4DN4H 5MEND 1RJZB 5JO5A 1PLGL 2ZOKA 4FFZL 3IPEA 2P45B 4L4VE 4N0UE 4ENEC 4WNQB 1F2QA 2AV7A 3WO3B 3B2PA 4FDWA 4HHGA 3MLPA 5GIRB 2EUWA 2EXSA 4U49A 2JCCB 1ICTA 5E4IA 4NT6B 4MDRA 3QR2A 4ZS6D 5IHWA 2ZCZA 4K2UL 1HH9A 3T4YA 2WXKA 4OGYH 3FN0H 3PFQA 2DIEA 5JR1L 2O30A 4L3CA 4AZUA 4KNUA 1T0MB 4LSRH 2ENQA 2YKLL 1TVBA 4N2OA 1U9KA 3BE1H 5K1JA 4P5RA 1KEGL 1YRKA 3WN5B 1JHLL 2QHRH 1A6TA 4IU3B 5DZJA 4Y1SA 4X7SL 4OFYD 4K3EH 2J6EH 3MLYL 4L5FH 3WIFA 5IEKA 4WO0A 5F70A 3SGKA 5CD5D 4HIIB 4UDTB 3UP1A 4CBPA 5SV4A 1VGEH 1LE9B 5DS1A 2UY6B 1NKGA 3CFKA 2JVUA 2Y7MA 4P46D 5DD3H 1YEFH 2FX9L 3QUMA 4NQVA 4OGXL 3G5ZB 2DQUH 2E9IA 5E8PB 1OSPL 4UV4L 4IEFA 4ETQA 1CLZL 2BSBA 1DJXA 2AGJH 2X4UB 1G7PB 1YNLL 2ZUQC 2BIQA 3GLAA 5AZ2L 1V27A 5TDNA 5A43C 3QH3A 2IMMA 2VCOA 1L9QA 3BWSA 1QQDB 4CU8A 4WEBH 3GGWB 3HZYB 3KPPB 3UO8B 3SOBL 2HJFA 2DMBA 1CBVH 3TBCA 3ARFB 4HPYL 4LEXH 3FQNA 3FT4A 1FIGH 1RK7A 3CFJB 3NA4A 4GRLA 3J8F7 3FT9A 1FH5L 4YPJA 4YHYB 5EOTA 3VWKB 3QCTL 2VUOA 4YH6A 2YSSA 3UTSD 1FP5A 3T2NH 4G8GD 5TQ0L 4UU9A 5LCVL 5HHVL 3BH9A 4I9WD 1U30A 3MLZL 1ET7A 5E6RB 4Z7OF 5KSBF 1UHVA 3SO3C 3OKDB 4FI6A 5LCVH 4IS6B 1JDCA 3VD3A 3FO9A 3TH4T 5CCJA 4LU5L 4CJ0A 1JYVA 4M1DL 4XH2A 3SY6A 3SJVD 5EF3A 3LDBC 4KJPD 4G5ZH 1E9PB 3BN3B 5F1NB 4AVJA 4DPAX 3GMMB 2WZ5A 4IGBD 1CU4L 2NPLX 3L3KB 2VXTL 5TE6L 5DUBB 2ATPA 3LIUA 3ZQ9A 4BA0A 1F58H 4IK7A 4RFOH 5GJSH 1JVOA 3UCQA 1ADQH 1AGCA 1CB4A 1JF1B 1TFHA 3VXUB 3V95A 3T2NL 3A4AA 3ULUD 2WCSA 3MBXH 1A4AA 1AIZA 2WWKO 4YR6B 3ZL4H 1UADC 4YE0A 3EFFA 3V6OE 1T66C 2BZDA 4OGXH 2P8LB 2Z92B 4HIIA 4UDTA 2WM0A 4P4KB 3MRPB 5F1IA 2NY1C 2ZOLA 4DEPC 2WYTA 4UYPA 3RTQA 2FH8A 3N41F 4KMTH 4U6XA 5HHME 3WXWH 4ZNEE 4F37K 1KIQB 3X11A 4K7PY 2XWEA 1V55B 1Y6KR 2XZQH 3P73A 4TUOB 2ZP8A 3MRBB 4KBPA 4XCCH 6PAZA 2ZWNA 1MJ8H 5F7HA 1ZSDB 3GSXB 5D2LA 4ZMNA 4KUZL 1QFWH 2W9EH 4X6BB 1KJ3H 3U83A 3C2AH 2EC9T 1Z0MA 1NAMB 2E7BA 2VLJD 4L3FA 1Z9LA 4TUUA 5J56B 2WQSA 3IJ8A 2GTWB 4GS7C 4G6MH 4M8VA 3TBVB 3QDMB 3SYCA 5K69A 1UURA 3GSWA 1XH3A 1TO4A 5SWQA 4M02A 4J5VA 4JKNA 1HEHC 4JFED 2NT0A 4AM0B 1DQJB 4JHZA 4JO5A 4K5MA 5F0LB 3VGAC 4ZMLA 3MRLB 1HILA 1JHLH 4F9LC 3NN8B 1M9SA 1M2OA 4MQXC 1C5CL 2NR6D 2ZX5A 3FUIA 3MBEB 4PCTA 2HB0A 3IAQA 1DN2A 3HC3H 4OSUH 4ZQKB 4GRMA 4LVNC 2X0VA 1I8IA 2IOIA 2KERA 3MNZB 2NY1B 3NJIA 3K4ZA 4N2KA 4P5TC 1R5VB 3S9DB 2ADGA 5DJDA 2VO8A 1ES0A 4H8QA 43C9A 3GT6A 2GSMB 4R7DB 1TCRB 1MRDH 3ZDXF 3G6JA 1TTFA 3KLSA 4HUUA 4NKDB 1MW2A 4E68A 4H8PA 2V7HA 2XXCB 2ZOWA 2IVFC 1U21A 3OGCA 4P57A 3ZE2E 1I7TA 1U91A 1Z32X 2IFFL 1YMME 3F7KA 4Z78B 3D50A 3L3HB 4UV7L 1N6QH 3LXBA 4FG6C 3HJEA 3AS1A 3MYJA 4FP8L 3PNWB 4S0HA 3TN0B 4XCEB 3UBGA 3LMJH 2AS5M 1XEUA 2DJSA 5DMIH 4GO8A 1PNCA 5FYKL 1NC2D 5AOZA 2OJZL 3QEHA 2X9WA 5D7IE 3P9MB 2FJHA 5H37A 2GK0A 2CBQA 4Y1AE 2R27A 5EUKB 4G42A 4R0LC 4U3SB 4JFWA 1J9TA 3VQMA 2DQDH 1CIDA 1SLXA 5LCVA 3VWJA 3CAFA 4OR1A 1AMYA 1PFOA 1YQVL 2JI1A 3GMQB 1KLGA 1U8MB 3HE6B 3J7HA 1TZGL 3M88A 4ZXBA 3HHRB 5IB4B 4J6RL 3G6AB 4YQXH 2FZ3A 4KK5D 5PCYA 3SY0A 1UH4A 2DJMA 1B9ZA 3L8QA 1TU2B 1H8SA 1WWWX 4Z3JA 3VFSA 3DOIA 4AZ8A 5IK3B 3C6SA 2ODHA 2B14A 2VKXA 1F1AA 2UZPA 1YNTB 1CF8L 1JTOA 4WI2A 1OCRB 3DIDA 4U1KB 4P46C 5I6NA 5JPNB 5HGBA 1TYEB 3NJGA 2UWEA 1MXDA 1ILUA 1SJHB 3C87A 3PHQB 3P02A 1Q9WA 15C8L 1U3JA 1WFJA 2CHXA 4KJWD 3D69B 1UD4A 2Z91A 4JL2A 5DQ9A 7FABL 4YHZH 4FABL 2VABA 2OZ4H 1LDPL 3VFRA 5CHNB 1OT4A 4W4NA 4YZWA 5C3TA 4H1LH 4FYTA 4I88A 2IAMB 4KTDH 4MNHB 4FQHB 1VENA 1XCTB 4OZFG 5I8KL 5F7WC 5IQ7L 3BVDB 1J8HD 3QUGA 3X3GH 2CXKA 3ARBA 1RD6A 3MLUH 1U3YA 2V2TA 4TTDC 2VZUA 4XN1A 4J23A 1S7SA 1E4JA 1OAUH 4OQTH 5JA9A 1WG3A 4JRYE 4PJGB 4L3EE 3TN0D 4OV5B 3ELAT 1GRWA 2BWQA 2NY4B 4GUQA 3ZKMD 4EIUA 3UTSE 2EDNA 1HQRA 3KPQA 4F9LA 3FBQA 3WHE0 4BSWA 5DYFA 2E9WA 2P4AB 1BXAA 5E2TH 2VMCA 3RWJA 1MFBL 5I1AB 4N2EA 2MNUA 1G7MA 1KJMA 3L95B 2PTTA 4V1DE 2PPFA 1OTTC 5I73B 2OMZA 2AEIT 3FO2A 5DTFA 2WB7A 2X70B 3UG3A 3W9EB 1OK8A 3RFZB 1OP4A 4EI5D 5FLUA 3D85A 3GEWB 1MHCB 4LLMB 3VD2A 3QIBB 3QJRB 4F7MB 4YSCA 1K2DA 4I0PC 4WW1A 1G7IB 3T0ED 4JQVA 1A8JH 5F6HI 2GG1A 2WKLA 1AZRA 4PG9A 2A6JA 1DBML 1K8DA 3WFHA 3EH1A 1XCXA 3M7OA 4OB5L 5BVPL 4BQ9A 2ARWA 3EBAA 5I76B 2K6YA 2ICWJ 4NP9A 2X4NB 25C8L 3EOBB 1NMAH 4AXWA 1PZBA 3HR6A 4KUCF 1FNFA 4IKNA 5GGRY 2X89A 4MQXD 1IIIA 2A4CA 4MAYA 1R3IL 1I9JL 4RESB 5IWLA 2FJGA 3L3OC 3D48R 5DS8B 3O0RL 4RMSA 2APSA 4WU7B 1H6EA 1O5PA 3S5LB 3WJJA 2VDQL 1UQSB 3ARYA 3UZVA 3VXSA 5MEQA 3BH8A 1J10A 2ZCHH 3BLPX 2MQGA 1XO8A 4LLWB 1NSNL 1GGUA 5GRVK 3VACA 2WBJD 3TS8A 1V7MH 5C0NC 3CNKA 4GRWE 3NJMA 4G83A 5JHDD 1IMHC 2M8XA 2YMXL 1XGYL 4I0CC 3RVXD 4NNPL 4PJHF 2VQTA 4KTEH 2EXYD 1IM9A 1C12A 2QSCH 2YGPA 2ATKB 5IROC 2MWCA 1BJ8A 2X2HA 5IMLB 1X4XA 4Y2DA 4APQB 1ZGLM 1AZNA 1HU8A 3FSAA 4YUEH 4QTFA 2NYKA 4R4FL 4A7SA 5IZ7A 3O81A 4PIBA 1J88A 2H6PB 4KXCA 4JM2F 1D2OA 3FU0A 2X1QA 3MV7E 2Z31B 3O6LH 4PJHA 1FCCA 2OCCB 3OJ2C 1EEQA 5JHLA 2B20A 3AWEA 4QY8B 2KLSA 2VXQA 1M7IB 1THAA 5LG1A 2NCMA 3I75B 1FDLL 4MNGE 5T5FA 4M7ZB 1D5RA 4CVWA 4PJ9A 3MX0A 3H4HA 1QBBA 4JFTA 3ZIMA 5E2VL 2ZKMX 3EDDA 4L8DB 4MLIA 3U6RB 1J0JA 1VKXB 3PWVB 2XWBA 2Y06H 2AJVL 3HFMH 4G71B 4XMLH 5DR5L 5I6XB 1MWAB 4XPFL 1MI5E 3LSOB 1RZJH 5E70A 5KZCD 4DTGL 3POCA 1QBMH 1AH1A 2PF6A 1HCZA 2Y5TA 4Z7QF 3WNPA 3US9A 4R4NC 3ESVF 3DURA 3NZHL 3KS0H 1PIFA 4UQEA 1MCOL 1K8DB 1P4UA 4BWTA 1FA4A 3LNEA 3SKOB 3NMEA 3CFQA 1ZK5A 4KJWC 1EUTA 1AC6A 4I13B 3GDCA 1M71B 1NBCA 3G04A 3V52H 3EH3B 4XPTL 3DGGB 4N90E 4RBPK 3IFOB 3SE3A 1T1YA 4JFOA 2VSCA 1UXWB 2EIKB 2PW2A 3EJJX 4U2YA 3SYQA 3VSVA 4QJ3B 1P0SE 4XO3A 1SHSA 5K9KA 3QCUH 1QLFA 4XMZA 5FHBH 4PU2A 4KAQH 1TZAA 2VAAB 4PJAA 3K8LA 5CSZA 5E6UB 3PJSA 2VRQA 1UD2A 1CT8A 2IBZY 5J1TC 1AXIB 5SWZE 1HWWA 4AGMA 1UD8A 1Z9PA 4KZEH 2NXZC 3NGBB 3R18A 1Z5LA 2MCPH 3DI2B 2CDEA 2WO4A 2JH2A 3TURA 5LGKA 5GXBB 2I69A 3PREA 4XNBA 4LLUA 1PJ9A 1LE9A 2GJ6D 3QIUC 5DFTA 1IIKA 2Y7OA 1HDMA 3GLZA 2Y23A 2F54D 4N6RB 4DTGH 1DBKH 1FZOA 3U0TA 3STZA 3QDJA 2C9UA 3ARDB 5B38A 4Y4KC 3O45B 4AYSA 4HFWA 4M7ZC 4FFWD 5FYKE 4FXKA 1JXDA 3AAZB 5C09E 3O2DH 1QG3A 4JN1L 1UCTA 5ADPL 3SDCC 3LQZA 2JTDA 5L88H 3D7PA 2PWDA 1ZIAA 4XC1L 3VM7A 5FGRA 2YRZA 5ALBH 2K3HA 1BPLB 3KNBA 3CV5A 4RRPA 5HDOA 5IMKA 3KPRE 5DC9B 1XH0A 2AI0L 3NK4A 4RA0C 3SZKC 4DOHE 1OM3L 2EUZA 4D7PA 4D9LH 4DGIH 3BEVB 2GIYA 1KLFB 2NZ9D 2YARA 2NXZB 2BNRD 1KGJA 2F8IA 4C83B 1AYOA 3ZDZB 4XE5B 3ZE1F 1OGSA 1W80A 2RD0A 5IESL 1LD9A 4OIAA 3BVNB 4RGNB 1QPXA 4YBLB 2ZSWA 4B41A 3ZBMA 2Z31D 4JX0A 3Q9QA 2B4CC 2VZ1A 3HG5A 5DRNB 1NUFA 2J88H 4P23D 4AT6A 4HUMB 5A2KH 3GKWL 3MBWA 4KZCA 2ZOUA 2ARJA 2OBGA 3D39A 4R4BA 1UATA 1B0WA 1KN2H 2UWEF 3L7EA 4WV1B 4BDVB 5F9JA 3PG2A 1PFCA 4YGVB 4TTGA 4AIZA 2VT0A 4N20A 3GUTB 4XVJH 3TIEA 4KKQA 1A1MB 4PJ7E 3APMA 3FQXA 5J57B 3H9SB 4O51A 3RDJA 1BYNA 4G7VH 1HS6A 3C5ZC 1FSKB 2BPBA 3EYFB 2VJXA 2HPTA 4BWWA 1UCBH 2C1OA 2LU3A 3MNVA 1KXHA 3A22A 4FLRA 5B38G 1JFQL 5GGVL 4P99A 1J87A 5FIEA 2E7LA 3GXNA 1X5AA 4JHWH 4OCMC 3QFJE 4WCYH 1EAPA 4D9RD 1U3HC 3GB7A 2O5XL 4RGOL 3OKMB 3MUY1 4LLUB 4JY6B 4TSBL 4EZKA 3HUJE 1TVHA 5L2KE 1QFWL 1L9RA 1U92A 2W9EL 2Y1AA 4LRNH 2B59B 1TMCB 2J2ZB 3A3YB 1GCFA 3N40P 1AGFB 1FFRA 1N18A 2A4ZA 1LEGA 4XNMA 3RVWD 5B39G 4QO1A 5LKNA 2ITCB 2DH2A 4WTZG 4FGMA 1I3RB 1YEGH 3IS0X 3GTTA 3M1BA 2Y25A 3NA9H 4W68A 1P4LB 3V9EA 4JZJA 2NTFB 2ZNWA 3U1SL 3FUHA 4FG4A 5L6YL 1E28A 1YCSA 3ZTCC 4MMXB 3LQZB 3JYCA 4FULA 1NKOA 4NQEA 3QQ9C 4O5LL 1WBZA 4IBSA 5HDBE 1K6QL 3QPXH 4DESA 5CLYA 3MBXL 1QA9B 3ATDA 1XVSA 4M5YL 4F9PC 4PFEA 1GJWA 3U4AA 2E7HA 3NCFB 4NCC2 1SMOA 4NO3A 4AYEC 2JKTM 2XWCA 4HLJA 2R56H 1KGWA 3UJJL 5JNYB 1JG9A 1AY1L 9PCYA 4XNUL 5DJ8A 4ABVA 3F12A 3RA7H 3KW8A 3PHOA 1P7QA 1U8JB 2XT1B 5D6DC 4WJ5A 5EH1A 2CAKA 3U0WH 1CXKA 2O1AA 3PQYD 1JOIA 2NYYD 3T3MB 3CTTA 3VFGH 4PRIB 2OSLA 4MDJB 1B4TA 2HTLC 1G7HB 2BOBB 5GSVB 5C0BA 5EBWA 1U8CB 1D5MB 3H1ZA 1DJZA 3D39E 1XF1A 3KYKH 1U8IB 1U3HB 2NW3B 3UTQB 1I7ZB 3A6CH 3V9FA 5G5DB 3S88L 1NOFA 3LQMA 3WMPA 4PWFA 4WLCA 1H8LA 3VXQA 4FQIL 3AG3B 3N42B 4JPVL 4DGIL 3IBEA 4K73A 1QOKA 3P9MA 4KKRA 2CBPA 1UFGA 4MGXA 3VGGA 3FRPG 3ENEA 4IU3A 2F9BT 3MRRB 3DV4B 3LDBB 1G1OA 4P4RA 1LO0H 5DT1H 4AYFB 1S9YA 5E9NA 3T1FA 2CR6A 4N87A 4LNVA 2DLEA 4WQOA 5F7DB 1F4AA 3MV8B 3N1QC 1FVCA 2E56A 3ROOA 3MN8A 4JCWA 5C08D 4LHUD 2VDOH 3GBEA 1T0OA 1F97A 1E9QA 1O7SA 4J1UB 2DL2A 4GXVH 4QO1B 2FSEB 1HSBA 3UJIL 1CJYA 2EE6A 3FFCA 5HI3D 3L3JA 4HWZB 1F13A 3DO4A 1DHKA 5C09A 4I3RL 5FYKH 3JTBA 3KH4A 3BT0A 3VD5A 5KSUB 3GNMH 2J1KA 3NFNB 4B0MB 3G08A 4X80L 3NZSA 4HIJA 2QKSA 1HEZB 4D3CH 4OLVH 2VE6B 4KY1H 1KIPB 3PXLA 2N01B 1BZEA 4P5TB 5E9DB 3C09C 4U1JA 5BVJB 3WTYA 3IRPX 3KGUA 3CSYA 3SDXE 3EO1A 4JFQB 5D2NC 1W0YT 3BMWA 4YEEA 4Y7MA 4MYPA 3EJCA 2FJUB 4N86A 5DVLA 1KCSH 3F2LA 3IJYB 3T0AA 1NGWA 1T20B 3VSTA 4L4VD 4UCFA 4AQOA 2X7LB 1GGCL 2ICEA 4LPVA 4WKZA 5DEGA 3WLBA 1BAWA 3WLWC 3DX3A 3IVKB 3WE1A 1FE8L 3ZTJG 2UVFA 4LVNB 1AY1H 5GJTL 3BGFB 4PRPA 2WKOF 3V0WL 5KSAA 3OAWA 3V4UL 3Q6FA 5C71A 2P5EA 2ZUYA 1UM4H 2Y2TA 3B2VH 1I1AB 1MREH 1M1XA 4YXKH 5I1KL 3ZL1A 2K7QA 1U8IA 3F7PC 4L23A 4ZMZA 5GS1A 4KI5F 1NQBA 5C2BL 4W93A 3L4WA 3UTQA 1OAJA 3MRKA 5FO2A 4MMYB 1H15B 1PLCA 4X4ZA 1YAIA 2WSKA 4NHCL 5E1AA 1SJXA 4N6QA 5BPPA 5L6YH 4AIXA 1B88A 5ACMA 4G11A 5HDBB 2DLGA 2NLJB 3IDJA 5KS9F 2AVGA 3QUXA 4F7CA 3WXWL 1I3GH 4U1LB 3MTRA 3HPLB 3MJ9A 3VXRE 4LLYA 3FTGA 4HK0B 4FG0A 4H0GA 1XGPB 1QSFA 1ZHNB 4Y9GA 5EPMB 3U1PA 1ZHLA 4NO0D 1BFTA 1AIFA 4HUCA 2VDPL 4P2QE 3TYFA 1LQBC 3FOMA 4KDVA 3VFRB 5K9JL 1XGQB 4OI8A 5TJWK 1JYNA 2X6CA 3HUJB 3L81A 3ME0A 1H9VA 5D1XA 5E2JA 3IMTA 1TKWA 4LOUD 1UWGH 4Q56A 5FUOL 4BCZA 2YQ2A 6TAAA 5ITFA 1S7UA 4X9GA 2L3BA 3UPRA 1DFBH 2EO7A 2ICWB 1UWEH 4PYHA 2H2SC 3IU4H 4P9HH 2GJRA 5HHNB 1QP1A 2XTLA 4MXQC 1KPVB 3NAAL 1GAFL 3JV6A 5DHXB 1XGZA 5I15H 4JFHD 4GKLA 3E1F1 3TO2A 4FQXB 2J88L 1FGNL 3EJUA 3O8XD 3PGCB 3TCLB 5T1KA 5M94B 3M45A 4J6IA 1G7PA 1SHWA 4HD5A 2HT4C 4F8QA 2FJFB 4D0BA 4N0YL 3S36X 1WEJL 2OR8A 1EEZA 3PXHA 5JLZA 1NFKA 4QOKB 4M5SA 3ULVH 1T1WB 1DP0A 4G70B 4TUJA 1ES0B 43C9B 4AMXA 1BIHA 4FC3E 5I0VA 5A40E 5JORB 1C16A 2X10A 2WLKA 4QHKI 2H3XC 4JO2H 1T03H 1A3RH 1FZKB 3ARFC 2AJXL 5I71C 3GMOA 1RHHA 1A1NA 1EDYA 3EFOA 4DOHB 5EZJA 3N04A 4BH8A 4S2SA 3LOWA 4BIKA 4BZ1H 2NQDA 4GI8A 2D0GA 1ESOA 4P48A 2NLJA 3BVWA 4WK2B 2FX9H 1KG0A 5TQ2L 2SEBA 3IF1A 4QRPB 3DO3A 4H1LA 3IDGA 4A6YB 2VRAA 1JSYA 2V17L 1I7UB 2IALB 5C7XL 5J1SC 4XPBH 1FH2A 4HIXH 4KRPD 2GAZA 3SODB 3MRQB 3MJ7B 2IG2H 2BY1A 4V2BA 2WXNA 3HE6A 4JFDE 3W39B 3NJVA 3LS4L 1F41A 3LH9A 4XP6H 3IJ7A 3G6AA 3L3OA 1TENA 5JIIA 3QJOA 5HTSA 1KSRA 3IKCB 4EN3B 4DCQA 4JR9H 1FYHB 3VFWB 5IIEB 1XR8B 3L17A 5EO1A 2PP8A 1P7BA 3D2UA 4JRYA 4O9HH 4BFJA 5BW7C 1QFUH 1FRGL 5IKCA 1MFDL 5ITFB 3KJ6L 4Q9QH 2EKSB 5FHBL 5E99H 5DC2A 5GHWL 4O2CA 4X7EC 1A14L 3HPJA 4DP8X 3CQQA 5KBLA 2JK5A 5IJBC 3FAWA 1GZPB 1P7HL 4BUHA 4EE2A 3EGDA 4GMTL 7FABH 4IIQC 3QVAA 3P0VH 1OAQH 1TVDA 2QGDA 3FU5A 3KBPA 3WJMA 1B0IA 3RU8H 1JZFA 4IIQA 3B9KD 4GQPH 5AVVB 4X9FA 2YSTA 2R69H 1AI1H 1DSFH 2P5WE 1M3JA 3AG4B 3EDEA 3CFUA 3H2WA 4GW4B 5BMFL 5IJVA 4Q6KA 5HPOA 3WEXA 2BMKB 3LJ3A 5B3NA 2IO5A 4I4WB 1XH2A 5C9JB 1FL6B 3AM8A 1B4LA 3T4AA 4B9JA 3JZYA 2UY7A 3B5HA 4JO3L 4L1SA 4TNVK 1I1CA 1OGTB 4U6YB 3EO0A 5ETUB 2CO6B 1F3DH 1S5IL 4PJIB 5EC2B 3PWJA 2FRGP 5AVYB 4PJXB 4XC3H 1CFQB 5CGBA 4QAMB 4ZX6A 1BVZA 4QR7A 1ZT4A 2PWGA 5I6XC 4AH2A 1ZV9A 1PLBA 1PZSA 3BDXA 1DVUA 2YXFA 4B3VA 1L9PA 2DW5A 1S7WB 2V4LA 5DHEA 2AXGA 5EBMB 4JFXB 3EGXB 4WW2F 4LAJH 1HJBC 1FL3B 4IHOA 2YK1H 3VTAA 5JUEH 3AACA 3GXFA 2VDMH 2BP5M 4GUPB 3S4SB 5C0RH 2XZCH 1L5GA 1RXLA 3U4BL 1HXKA 1XXDC 4EN2A 2P44B 3RU8L 1N64H 2CRIA 1HHJB 4P2OA 1S7XB 4ZDHB 5LGJB 4PRNA 4GMTH 3MLSL 3QNZA 3ZW3A 5IVOA 1J12A 4OZIE 4NS0A 2EVJA 3O9WD 3LN4B 3LKRA 2OTWA 3F7LA 4AQZA 4M5TA 1TQWA 2G9KA 2DQIH 4N0CC 2YMXH 4PCKA 4Y19B 2CDEB 5EUOB 3PDDA 4DK5A 3F01A 4JLRB 1JD7A 3MO1B 4KK8D 2WIIB 2XETA 2A83A 3PHSA 2Q8AH 3FU6A 5D1ZB 1URLA 2CD0A 3QO0B 6FABH 1BIIB 3ECVA 3O3DB 1XSOA 4MJID 4WWPA 3NJXA 1NIFA 2VLJB 3MCLL 2FD6H 4O4YL 2EYSB 3AFLA 3TO4B 4NQDA 5HYJE 1NC2B 3BDYL 1A65A 2YXWA 2F1BA 3WOVA 4HKXA 4F33B 3ARDC 3GRWA 4E5XB 2EVGA 4N28A 2QGCA 1MHHA 1P5UC 5FV2A 1LMIA 3DBXA 4ICXA 1A4JA 1ACXA 3QPQD 3D30A 4QYAA 4HFUL 5BVPH 1F4WL 3VFMB 4BKLB 4XAKD 1GTFA 5J89A 1GZHA 5EOCJ 1EFXA 5GGTA 3I6SA 3MODL 1QVOA 5EFIA 5HJDA 4JRFA 1QSZA 1QD0A 1BEYH 2N56A 2AHIA 4LRIC 4U33A 2E9JA 2DQTH 3GSNH 4D94A 1QAWA 4LBAA 4UQBA 2FWOA 4JZJB 3AU0A 4IHBA 4U6YA 2C34A 4R97B 4QIRA 3HZ3A 4X4ME 4WVRA 2F8OA 3MC0A 2QQQA 2DQGH 1OT1A 4XNYH 1E0OB 1X5XA 3N85H 5C0IA 3T77B 3GBNL 3T8VA 4OLEA 5KN5A 4XTRD 4Z7QE 2ZOKB 5JHBA 3BP7B 4PMEA 1D7BA 4OAWA 4XPAH 3BDYH 4HUXB 3TJPA 4YHLL 1TZIA 4LP8A 2FD6L 2AZUA 3RIAF 1NCAL 2IH1A 4HX1A 4NC1E 2GJPA 3GHEH 3RBSA 4DGVH 1IGJB 1PVHA 3CVBA 1TOXA 1F45A 4MASA 2Z65C 4FLQA 2GW5A 1G9MH 3WL9B 2GY5A 3EYSL 2VDNH 5DJAA 5B8CB 1FV1B 1S78D 3BSZH 3CBRA 1A6TB 1FHNA 2ZQKA 2Z7UA 3REVA 2LQRA 2X40A 1NINA 4OLWL 3SGJA 1A3ZA 2H32A 4XN8A 5HP5A 3V0EA 3HRPA 2PYFA 1UZ8B 5F9OL 1PY0A 3L3KA 4U1IA 5A7EA 2J4WL 1NGQH 3RG1C 2DQIL 2F0CA 5DJYA 2XWJA 1JERA 1YNKH 2EDJA 3LB6D 2GI0A 2QADB 4H0LC 4LEXL 4HKXB 4IBWA 2X4PA 2GSIA 2EJ1A 3T08A 5D6DA 1A7NL 3FNKA 3IFLL 1UT2A 3QSKB 5C0FA 2HSIA 2DOCA 4OJFH 3SQBA 3SJVE 1D3CA 4UTBL 2BWIA 4XMXA 4AXWB 1IQDB 3SCMC 4PRDB 1Q0XL 4XMVA 2Y2YA 2CQVA 2FJGB 2LU5A 4NUGL 5CEXB 5HD8D 4PTUB 1HFUA 3SIKA 5J6GA 1R3KA 2ZTBA 3L08A 5I1DA 4FQ2L 4AYDC 1N0LB 7CGTA 4GIOA 1I9RL 1Y0LB 1F3JB 2AVFA 2DQUL 1I8AA 1TTBA 3N1FC 4LHUB 4TLKA 3ARDA 3S8GB 3MACH 1ZMYA 2AEOA 3MRBA 2DPKA 4LEBA 3E7JA 5TF1H 4FXKB 3O6FD 2P5WD 4O02L 1KUMA 2CR3A 4N2HA 1C7SA 2Z8RA 3SPCA 2YPKA 1T04B 2FWUA 4PP2A 2IMNA 1MI5D 1JRHI 2AXFA 5KJ7E 2F7PA 4MA7H 4AYMC 2KYIA 4V1DA 1BQHA 1G6RH 1GW0A 5T3ZL 2XV2A 1Q9KB 4UT9L 2EO1A 2CCWA 4HC1H 4UV7H 3TPUB 3OHXA 3NIDE 2MTPA 2J6EL 3MLYH 2DQCH 1GIGH 3KVPA 4XMKH 5DA0B 5DJZA 3WMQA 1TMQA 2COVD 4IK6A 3V5HA 3ZO0A 1JK8A 2YRBA 3D0AA 4TVPE 1RK0A 3FUFA 5ECGA 3BE1L 3ZE0E 4JM2D 2NW2B 2CIIA 4QRTA 1UZ6E 3ARGC 2OI9B 1BBJA 2F74A 5ABDE 3E1ZA 3EF4A 5EN2A 4CN1A 3B56A 3H6JA 2VDLL 5E8NA 4CNIB 4ZFQA 1R5IB 1JXFA 2YGQA 2XCMC 4C4BA 3HOGA 4PJ7A 3WFDL 4P3CL 2BO0A 4HMCA 4DKDC 3LIZH 3QUYD 2YEVB 1TZ8A 4G3YL 1EZSA 4AKQA 3MTXA 4H2AA 4K3GA 5JXAL 3O8XC 3H42H 1CURA 3MRPA 5F1IB 1OM9A 3OF6A 3S5YA 2PYFB 4CSSA 2R7EA 3BN9D 1P1ZB 3BSZA 3H9SA 4O51B 4F15C 1T2QL 3X11B 3SCMA 1IAOB 1A6UH 3RWGB 3WTWA 4M56A