2GQ0A

Crystal structure of the middle domain of htpg, the e. coli hsp90
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
256
structure length
256
Chain Sequence
AQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTSLLYIPSQAPWDMWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLNVSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDAEKYQTFWQQFGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein htpG
publication title Structural Analysis of E. coli hsp90 reveals dramatic nucleotide-dependent conformational rearrangements.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone, hydrolase
total genus 79
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.6.4.10: Non-chaperonin molecular chaperone ATPase.
pdb deposition date 2006-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2gq0A01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gq0A02
2O1VA 2CG9A 2IOQA 2O1UA 1HK7A 1Y4SA 3HJCA 2O1TA 2O1WA 1USVA 5FWKA 2CGEA 2GQ0A 1Y6ZA 1Y4UA 3PRYA 1USUA 2IOPA 3Q6NA 3Q6MA
chains in the Genus database with same CATH superfamily
1RHMA 2M32A 3O1JC 4BDTA 3ZKBA 2H00A 2O54A 3H87A 2GOYA 2Q3JA 1PWYE 2FFAA 3F9RA 3P4XA 2C94A 1QP4A 5DPMA 3HCBA 2CFIA 3H2SA 3IJ5A 4CFSA 2CG9A 1G6OA 1QMPA 2FSHA 2J59A 2IS6A 4DEYA 1TKCA 1YVEI 1WDWB 1ZGJA 2V7VA 1G291 1A95A 3BWBA 2GBPA 5T41A 1HE5A 1WZ2A 4K86A 4EB0A 2XYGA 3V5RA 5DX0A 3EMDA 2XA2A 4B6EA 4E51A 4YH1A 1NMQA 2PEZA 3DHWC 2AN5A 3H05A 3FBTA 5DHTA 3NX4A 5FUQA 4G0WA 4OQMA 3L0SA 2GUGA 5KOIA 2D06A 4EYGA 4DV2I 2RGRA 3NWPA 4JLJA 5EAIA 4ER6A 5HJ2A 4A15A 2YWDA 4M9SA 4Q4HB 3LP8A 3QVSA 3DBVO 4UBKA 4QOGA 1RXYA 2P67A 3I2HA 3TUJC 5EIEA 2RHLA 3ZKDA 1NIPA 2VJDA 2YXBA 1OT5A 3JAWB 3FBGA 3LGXA 3ONNA 5K0ZA 1F0KA 2HHHB 2EJVA 1NYLA 2CF6A 1L1FA 1E77A 1RWVA 4PX9A 4WBNA 4XZ3A 2J6BA 3DE1X 2H5JA 4H4DA 1PJCA 4JI3I 1ZVVA 4QVGA 4O5OA 3ZCXA 2I6TA 1YB5A 3IQWA 4TWZA 4US2R 3PD0A 4PLFA 4CR7A 1USKA 1VJRA 2HLDD 3DXZA 2CEAA 1VBKA 1L7PA 1ZN9A 1ZM7A 2Z57A 3L92A 4J90A 3THWB 1L1EA 2G9NA 4NJEB 4GNRA 2GJSA 4L4ZA 2UVDA 4Q6WA 4YDHB 5FORA 1EA6A 4P0PB 5B7QA 5BN3B 3E53A 3HSSA 5C51B 3O5AA 4LPFA 2ALJA 5JCOC 1NZFA 2EZ4A 2FZVA 2FEPA 1I94E 2YFKA 3HSYA 3U37A 3PGKA 1NJ5A 1N6OA 5HCIA 4CF3A 4WMLA 1PR4A 2PLNA 4YRGA 2CVZA 1AKQA 1H4TA 3CH6A 3MELA 5DHAA 1L8QA 2O1VA 3FFBA 1JYFA 1JIIA 2FPSA 2RDMA 1H2EA 2OV4A 3DULA 2DKOA 3IV7A 1O0CA 1L7MA 1MX5A 3V34A 2R6DA 2RHOA 2GD6A 1M2KA 1ISRA 4YQEA 4DR4I 4L50A 5K0GA 4N47A 1MO5A 4X91A 3Q3EA 4KKXB 3GXOA 2E7ZA 4WA7A 2OB1A 1PVOA 1GL7A 3FPBA 3GJRA 2H4ZA 4RD3A 5M04A 3IAS1 5DU2A 4AW9A 1BA3A 1LRJA 4DQKA 1XXHA 3P9KA 2QAJA 3NBAA 2JEBA 3VNUA 3VR4A 5DO9A 1EB8A 1TA9A 3LUDA 1RABA 1AURA 2GH1A 5FA6A 1Y7IA 1SC3A 1BYIA 1FJHA 1GL3A 2Y0DA 3GFQA 1L3CA 3IBSA 2V58A 4P3KA 3GGCA 3REQA 3TRDA 3BA6A 3U4QB 2GK3A 3GPCA 4GM0A 1P19A 2RK6A 3UV7A 3UHOA 3E22A 1GR1A 1EE2A 3FPSA 3MGKA 5LQNA 4WBSA 4JL8A 1QHSA 4XPIB 3R09A 3AERB 3LXUX 3AGPA 1A7JA 4IJKA 3CNOA 2GK6A 4K40A 3WRXC 3NKLA 1LRLA 1PG5A 1T6ZA 5IEJA 1YL7A 2XA9A 2KQUA 1WXFA 2IZ0A 2YVQA 4A9AA 1TMGE 3NAQA 3RVDA 1Y3FE 5KIAA 1CY0A 1QTIA 1PS9A 4LNUB 4ACBA 1L9KA 3ZJUA 3SE0A 2R68A 5ITWA 5I7WA 1O6GA 5EQDA 3RIEA 2F3TA 2PO2A 3ZUGA 1DX9A 5IAOA 1JLRA 2ABWA 2O2DA 2XKAA 4XM1A 1ELOA 5ADHA 1MDBA 5L3ZA 2V54A 4Q1VA 4DRXB 5JPIA 2EX4A 3EYWA 4FEYA 4R40A 3TAHA 5A02A 4EABA 3EG9B 2G25A 2ETXA 2XTZA 4HEHA 2FPLA 4RV5A 4YONB 1C7FA 4L85A 4C87A 4EEXA 4E1BA 4UPEA 3VH4A 4YCSA 4YRTA 2Z9DA 2O2GA 2PUJA 1FS4A 1O77A 4JA0A 3TVYA 1K5PA 4BNUA 4F7DA 3JAWA 2OV2A 2BI8A 3VAAA 1OQAA 5EPUA 3ROFA 2Q41A 4FD2A 2YMLA 1SXHA 2AI3A 1TECE 4I9NA 1MH1A 3CWVA 1SKUA 1ECCA 2PRZA 2V59A 3HZOA 3I28A 1E96A 1JIUA 1A82A 1Q1BA 1E5QA 2H1CA 2QU7A 2R8BA 3AP3A 3C3MA 3D1JA 4I5FA 3CLTC 5MGNA 1GPUA 3HFJA 4WKOA 3KZ1E 3EGCA 4RLQA 4HZIA 1J0AA 3V1KA 1NMSA 3RC3A 3OETA 3R9XA 4EY6A 4WZ6A 3UMSA 1TZMA 1PIWA 2CDBA 4MPJA 2GD2A 4ZYVA 5J3JA 3B48A 1T5TA 2B2NA 4KQFA 2NXWA 4YAIA 1I2AA 4DTCA 2SHKA 1E0JA 1K5DA 1GGJA 2QT9A 1U1CA 3BIWA 1PT7A 3R3WA 4Q1FA 1JTEA 1NAHA 3RSLA 1MNQA 2IEDA 2QRNA 2JGNA 2QW8A 1E2GA 3PWKA 5B1SA 3PT9A 4UBLA 3MCZA 1MIOB 4OKIA 4YNBA 5K3EA 3DV0B 3TRKA 1DKUA 4RY9A 4NCAA 1HT1E 2BGWA 4PTZA 3E03A 1ZUIA 3SYKA 5K3FA 4OY3A 3WSWA 3GU3A 4I50F 1U04A 1FJ2A 2HT6A 1O8CA 1UDBA 1BKNA 1OBHA 4U8GA 1EVEA 3OCYA 5DCUA 3TQQA 4Z86A 3TTYA 4HB2A 5EGNA 1JIVA 3WSTA 3VPSA 5LQKA 1Z34A 1P2BA 3ITEA 1Z6QA 3WGVA 1T9HA 4EYQA 3LCRA 1XEAA 4FNAA 5KPJA 4BY9E 2QENA 1ND6A 2WWYA 1OWNA 1P9RA 3K4QA 1HV8A 1WU8A 2IY9A 4MV0A 4URHA 1Z22A 2BAGA 3H99A 2IYFA 1FPMA 3RW9A 2ZIGA 4CGYA 3C7DB 4DSZA 3IKLA 3AF2A 3A70A 2WTXA 3S7ZA 1C7JA 5HK9A 4CEJB 1BCRA 2DERA 5KC8A 1AQUA 1Q5PA 2HGZA 1THGA 4IJ6A 4O4IB 1UPTA 4S1TA 1U3FA 4E4YA 1NP6A 1CYDA 3O6VA 5BSWA 4YLGA 4JGIA 1KZYC 1YQDA 1ZXBA 5GAJA 2PU7A 4JI5B 5HKOA 3AZPA 4EJ2A 3H9JA 5LZ7A 3KQOA 5JNVA 2V6FA 1FUYB 1G98A 1N6NA 1OH6A 2DPHA 3K8QA 2AJ8A 3R9XB 3GEPA 1KVQA 3DZIA 5DWDA 3I1FA 4FW7A 2G06A 4IUYA 2ZVDA 1ORVA 5J2UA 1CNFA 4GOMD 2PO7A 3PEUA 1D6JA 3HM2A 3A2MA 4AF7A 5A5DA 3IUQA 4U2CA 1J07A 4HTAA 1T3ZA 4D46A 1EM8B 2BDTA 1V8ZA 3AG6A 2OQRA 5FL7A 3SZRA 2WSIA 3N3BC 3VHXA 3DR3A 4GLLA 4OAQA 2H9IA 5DLPA 3CW9A 1JFFB 4BX0A 4ZZ3A 3DZJA 4Q0MA 5AHWA 3TVTA 5T8KA 4ISAA 3R0QA 1MKYA 4HADA 4FDUA 1W2GA 1P7ZA 4HR7A 1LV8A 4KE6A 1J4AA 4LNAA 4ER5A 2Z6UA 3FWPA 2C2XA 1P0MA 1HRKA 1Y7PA 2RHJA 4W6ZA 3A58B 4H1WA 3FCUB 3TKLA 4CXMA 3PE3A 3S55A 1EHCA 2I67A 3CSSA 2OHOA 3PVCA 5DK6A 4Z0TA 3QUCA 3E3LA 3WHLA 2IYTA 3H5IA 4IGKA 4JELA 2FWIA 4TT3A 3OHSX 2JAXA 1B16A 3LY9A 721PA 1ZSYA 2V6JA 1P62B 4HNTA 1VZ3A 1BDIA 3HBMA 3OT1A 4LQDA 2PL3A 3T3MB 4KFUA 3AP1A 1R5NA 3G1WA 5FO1A 1XBTA 5CDSA 1IBCA 1SPXA 1JHZA 2WFMA 3MGBA 1ISIA 1O7JA 1W75A 2OVBA 1JIKA 3L4EA 3HLYA 3BXXA 3QYFA 4R8LA 2BP7B 4X1KA 4XVHA 3VYTB 3ZCRA 1GTZA 1F51E 5TF4A 3WADA 4EPXA 3HZRA 3QIVA 2I2FA 3ER9A 3ZZTA 1H23A 2ZDQA 4J2OA 3PIRA 4R7TA 2E49A 4JL5A 4BMOB 5J1TB 1MIOA 1L8XA 1SCBA 3E70C 2UXCI 4V1CB 3DPSA 4Z9XA 3RFXA 5IMBA 2NIPA 5EWJB 2B83A 1IHPA 3HSKA 3LQYA 1IHYA 4EHDA 1NBMD 1L6RA 1NXXA 3BMNB 3OOYA 4OD0A 7AT1A 3NXKA 2E87A 2QTMA 4Z7QB 1A96A 1RJ9A 1BTOA 3LXXA 3NAGA 2UZAA 1NMXA 4PZ0A 5JSUA 3BGWA 1V0JA 3DZDA 4R9NA 3AVTA 3QFHA 3ORSA 4LBVA 3VHLB 3EULA 4XTRA 1PJ8A 1SZPA 1UDNA 1U9IC 3D3WA 3B1KA 1P4AA 3QE3A 1NQWA 2FPKA 4LXIA 5KNDD 5KWEA 4E6EA 5BUSA 4I4TA 1SVSA 4AZWA 2JZNA 1B1AA 3BMCB 2UUCB 1ZMTA 4JEUA 2ZJYA 1ZMXA 4K9SA 4OYLA 4TKLA 5M7EA 3VC2A 1K6IA 4PVDA 5AKLA 2IYXA 4ZC8A 5AI6A 1A9QA 1HMYA 1B42A 5IXJA 3R0JA 2IEGA 3BCSA 2VP3A 3AINA 2J3EA 4ATNA 2E85A 1WNFA 3ZK7A 3X1KA 1A88A 1OOEA 4NESA 4GHWA 3TD6A 3PIDA 2CFCA 1XD9A 4ENUA 4YJGB 3W9BA 3FGZA 4TTQA 4U7PB 4LWQA 3VO1A 3R5TA 3PVSA 4GLFA 3PYFA 4MUGA 4GP7A 3FF1A 4JJZA 5FPKA 1GNVA 2YQ4A 4JBNA 3MEQA 4UNNA 2MTBA 3FPLA 3NAMA 1UBRS 4N9QA 4N8EA 4EHNA 4C9BA 4EI2A 1FSZA 1GSOA 2VT7A 2JD2A 2NN6E 1CUGA 2WICA 1FRQA 1WULS 4JBHA 4U6SA 4DR7E 4EDFA 3IR6A 1K7SN 3JATA 3USES 2ONYA 3W5DA 4FIZA 3DGFC 2WUGA 2A7QA 3DMDA 3TK1A 2LRHA 5HFJA 4AZVA 3REFA 2GEVA 3C39A 3CLHA 4JEHA 4B0PA 1VA5A 2WFAA 1P1IA 1ORDA 2BM0A 2C8LA 4IUDS 5H59A 1A9XA 2NZUG 3T3IA 4X61A 1HURA 3M5WA 1JVBA 1N3BA 1XG5A 1GZUA 3BRCA 1S16A 1FU8A 2QR3A 3AWIA 3E35A 1FPQA 2BCEA 1VGRA 2XDYA 2C5EA 1RREA 1E59A 1KDTA 1W5EA 1DEOA 2E4XA 3EE6A 3HWRA 4NOLA 2OXCA 2XIJA 4D9KA 3K1YA 4YMHA 3VZRA 1UDQA 2KLBA 2MSDB 4Q3DA 1OZAA 4RVOA 3PLNA 5EYPB 5EXPA 2RHDA 1M2HA 2J3IA 1CRPA 4NLLA 3FPFA 5FV7A 2B6HA 4JU8A 2XF8A 1WS6A 2FQXA 4GI1A 1WXXA 3L6UA 5K3SA 3DD1A 3SXUA 4EMBA 1KO1A 3GLQA 4JMLA 4LGVA 3KKMA 3O8OB 5DTJA 4B84A 3DVAA 4TVOA 5JT1A 1W93A 1PVVA 3NGLA 4QNJA 2VYNA 3NRJA 4MVJH 1XI2A 2LTAA 2IX3A 4CMEA 2EX1A 4D0LB 1CJTC 2GR9A 4PYOA 5KNCH 4B3IA 1J2TA 1A04A 1ODLA 3IPXA 1L4LA 4UZFA 3FOEC 5CH5A 1E0AA 1NMEA 4DR1B 4X92A 1P33A 2FPGA 3VI3B 2ZI6A 1ORWA 4WEQA 5KQGA 4LVOA 3EPKA 2XE7A 1GM5A 1T8YA 1WPGA 2IOPA 2FJPA 3A6JA 3OQIA 5REQA 3TGLA 3HU1A 4Y1GA 4AN0A 4M8SA 3W8NA 3FTFA 3TI9A 4PPYA 1RRPA 4BO3A 3U1VA 4UXJA 5DZSA 1VBFA 3QKRA 3C6YA 4X64B 5GZ6A 3BK1A 2D0DA 4DQXA 4HRAA 3CBGA 2Q5QA 1ACJA 3GHHA 4XUGB 2JEYA 1CQIA 4HQNA 5CDFA 4YQFA 2CXNA 3SSOA 3SJAA 2ECPA 2WKPA 1VCHA 3KWFA 3ISVA 4GE0A 3AVXA 1QKJA 1RFLA 3HCAA 3B3GA 3PQFA 3PXEA 3Q2OA 2C3UA 3ROTA 4F3CA 1L5MA 5K8LA 4L0CA 1PR3A 1IJBA 1OX4A 1PJ2A 2P8JA 3DNFA 4OFWA 4QQNA 2FAXA 2IUYA 2R6JA 5HTOA 3DV9A 1UPFA 4I55A 3ERCA 2B8EA 3IAFA 4D4HA 4Q15A 2MDTA 1H2BA 4R41A 4DUZE 2DWOA 1CY8A 2QTVA 4RH0A 5NULA 1XTRA 2J48A 2NYUA 5CPFA 4CM7A 3FX2A 3O0TA 3OOSA 2ZI7A 1UWCA 4R1SA 5TRTA 4EG8A 4DV1I 1UZAA 3CWCA 3ZWBA 3WK5A 2BZ1A 4RV9A 2RH5A 1YHCA 4MKFA 3TXXA 4DL9A 4CKCA 1YWGO 2NN6F 1QQ6A 2XB9A 3F4LA 3E7XA 5C80A 1EFRD 2BSAA 4TLCA 2VXCA 4XDGA 2GKSA 1G3MA 1Y5NA 3D7MA 1I2ZA 3GGSA 3QLUA 3UUFA 3DD6A 3EC2A 5I4BA 1TCCA 1Z0VA 4X66E 3OKPA 2C78A 3GV0A 1MO4A 5HE8A 5JJ5A 5AJYA 3BIOA 4JAVC 1NLZA 2HN9A 2QUIA 3ZX5A 4DPMA 1KZ9A 4EYKA 5AKZA 1IC6A 1NYRA 1T9GR 5A5GA 1HA3A 3EVFA 4QWWA 1NZDA 5A4DA 5KHLB 2IWHA 3ENVA 3WKCA 1MD9A 1HZZA 2Z5EA 3HS3A 1G7RA 5JPCA 3HN7A 4L28A 4IV8A 4M1EA 1U2DA 2WF9A 4A0HA 1S3GA 2VA9A 4B47A 4F11A 1RP7A 1EYZA 4GECA 3D6MA 1GZ3A 4L4XA 4W7HA 2W2OA 2R8EA 4N5LA 5JXJA 2H4WA 1BJRE 2QT1A 2R7LA 4I7EA 2ZJ8A 4B3TB 3JQAD 4RMGA 1F48A 2E48A 1K7YA 1N8KA 2VSNA 1XP8A 4FJ0A 2P9CA 4F4HA 4QYWA 4DHEA 4X9XA 5JASA 4FFNA 2I33A 2FDCA 1ATZA 1ZD4A 2A5JA 3DT9A 5AJHA 4BMZA 4A6EA 3M6MD 1J90A 3EYAA 4GX0A 2A5YB 2BEVB 1YL6A 3WO0A 3SWWA 3PDCA 3W8EA 4MB0A 2PWAA 3Q9UA 1F8GA 4DR6I 3N5CA 4URVR 1LI4A 2FMKA 1K97A 5DSTA 1P6QA 4OI0A 4QPNA 5GGYA 4ALMA 4D43A 1NXWA 1UOPA 5CYGA 5KKNB 4WRRA 2Q1TA 2QN1A 4KDFA 4R8RA 5A6VA 5ADWA 1NVWQ 5HXAA 3QW2A 5HBGA 4XWYA 2B8NA 2VHTA 1VRCA 3ZU2A 1BGXT 2Y4OA 3ZKAA 1DQNA 3SZLA 4LF6B 2H8GA 5AOAA 4HH3C 1QO0A 3T7IA 4TXJA 1QRTA 1CZKA 1QGUA 2C2MA 1KQNA 1EJ2A 1ZDMA 1V5WA 2A0UA 2ET6A 2LIPA 4RFSB 3LPCA 4DANA 1WBBA 1LDNA 2C8VA 2GYVA 3CVJA 3HUUA 2PKQP 3QUSA 4FILA 5AQEA 2GNPA 4I81A 2O0MA 1EFAA 2FP4B 4F2PA 2I2WA 3RKSA 5GJWC 3M9XA 3H2ZA 4X7BA 2HPAA 1R0YA 3EXAA 2FSIA 3SF8A 4ZJZA 1P60A 4HGQA 3UN1A 4JJKA 3VBCA 3ZOZA 1VKHA 1VPVA 2VQ3A 4DA6A 1PZHA 1ZUNA 3SBDA 4DT1B 1AGPA 1KJIA 4C14A 1I4WA 4MKHA 1PJLA 2H06A 1JX6A 2IXFA 2IUSA 4MVJP 1E7WA 1NI3A 4WDQA 1B6TA 1I80A 4JHXA 4PC6A 3IXMA 5BQ5A 5CLJA 2ZTLA 2GZRA 1J22A 2V7BA 4UBMA 5EJ4A 1P0PA 3ZS9A 4A6XA 3KIPA 1FY2A 3FKJA 1KBOA 2OORC 3LUAA 3Q3IA 4LHZA 4QARA 4RGVA 4X3PA 4ND7A 2X8BA 1K2WA 5IZ4A 3B1XA 5ALZA 5BV7A 1E6UA 1WXDA 2GEFA 5LZ4A 3THXB 1N6PA 1S01A 3ZCTA 1Q7EA 1MB3A 1SZDA 1O3YA 1C4OA 1W2WB 1GCUA 3DMTC 3UJCA 3IE2A 4QOIA 4HT3B 5FUYA 2BFPA 1RC1A 4YRMA 2Q45A 2XWPA 2P6NA 3DC7A 2I34A 1EFTA 2VVTA 1ULZA 2WTBA 3DS8A 4RK1A 5FRDA 1MU5A 4R2HA 4HGOA 4LF5B 5JISA 1W8DA 4FINA 4MUXA 4M7WA 3TH5A 1JUDA 1KAOA 2P5UA 3H19A 4RJIA 4FGLA 5IW8A 1W88A 2C2YA 1LPSA 3G9QA 3TZQA 4C0LA 2GFHA 1XU7A 2BGTA 1XRMA 2VT6A 2VYQA 3OLXA 4IIBA 4HNVA 2FR1A 3L0OA 1OREA 4HDCA 4RMHA 1SO8A 2RGBA 1JKJB 1UJBA 2EBWA 1DU4A 3K0KA 4NJMB 4TYQA 1F3OA 1Z3CA 3L7MA 3MSCA 1BVYF 1C3EA 1XTUA 1U4NA 1OE0A 5HDQA 3DYBA 1ZGHA 3AESB 3VR3A 1F6DA 2YWCA 3O8NA 4TYWA 5BSFA 3VGJA 1XAJA 4MPDA 5CB4B 2R86A 1EVIA 2QRKA 2WM2A 2IZ1A 3KEQA 3ZY6A 5DI9A 4CL3A 2OK8A 3CKLA 1Z33A 4FMDB 4WJZA 5D7BA 3TTSA 3A37A 4F3NA 1U28C 1XCLA 1ZUHA 2AF4C 2B3DA 2HXGA 2ZM6B 4NU6A 3V8VA 4G5GA 4OKSA 2V2VA 2QGNA 4OYRA 2G1JA 1CW2B 3QI7A 4A16A 4R6XA 1P0IA 1T8WA 2IS2A 1RCUA 3IQXA 3ZWVA 3RABA 5JC1A 1SGWA 2BFBB 4EY8A 2O8EB 2PD4A 3FMVA 4EA7A 5CDHA 2X3YA 2D3WA 3QSGA 4CQLB 5ITZA 2HQ1A 5M2QA 3I32A 3EAFA 2CXRA 1ODTC 1W5SA 4Y2RA 3DMFA 4DV1B 5IBRA 4PEVA 3VR6A 2VWPA 3LI2A 3RAGA 4PRYA 1OX6A 2OZLB 3I1JA 1QV7A 3PYGA 4RFSA 5ALSA 4EUEA 3PEWA 3DAOA 2PS3A 1P4HA 1FBNA 1Q92A 3B5EA 5LIPA 3QT7A 5TQVA 1ONNA 4RHCA 3OU6A 4RPHA 5JY1A 3A3PA 3OY7A 4CMJA 5IH3A 1J00A 2WFLA 4ARBA 2ODEA 3IBYA 4ZYWA 4PZUA 2BGLA 1HT0A 1YCGA 3PPVA 1N4AA 3O7MA 1K6MA 4IFBA 3S5UA 2MSWA 2JZOA 4V0MA 3EPJA 1G5QA 3SS8A 3GEHA 4JR1A 4JG4A 5BWLA 4DIFA 3AF3A 4ZKEA 3CZ5A 4CCWA 2XGJA 5CB6A 2WOOA 4RVNA 2P6PA 3R3YA 3OLQA 5FLXQ 3UQYS 1OLSB 5FBZA 1R6UA 5LQDA 1CY1A 4GOJA 4JCOA 4X1IB 3C3PA 4KKVA 2NUTA 1PLLA 3UYLA 1PNRA 4I4LA 4DM3A 4N41A 4JR0A 2CB0A 3H1EA 2B4YA 1FCJA 1Q6ZA 3K6KA 1GWNA 4IG4A 1BJTA 1OI4A 2P9BA 4GYWA 5CX4A 3ZE7A 4LC9A 3NYRA 1WTAA 4ECEA 4Z3KA 1QFYA 1P91A 4BFCA 4LJYA 3T1YB 3H2YA 3UMGA 4DILA 5B7NA 5J4LA 1V37A 3D0RA 3HL0A 2CLMB 1NQVA 2OPBA 1H0SA 2FKNA 3AL2A 4QFBA 1B4DA 2DTEA 1CP2A 3A4NA 3JSAA 5EMMA 5EZ5A 4S12A 4HV4A 4ZZIA 1VG9B 3QELB 2Z9BA 4BAUA 4XGNA 4XX1A 1GRRA 2PNZB 4E1AA 5ED0A 4DMMA 4MYHA 5F98A 4J29A 5SICE 2BTEA 1N6HA 3DDOA 4G0VA 3WU6A 1ZK2A 3AILA 1EFVA 4YJ2F 3UWPA 3TMAA 1KEZA 1WMDA 4FCVA 4F3KA 2POQX 1CHNA 5DBEX 4C4OA 4JOSA 1LTKA 1UDWA 3P2MA 3VR4D 2HDNB 4OH1A 1DARA 1P4JA 2IHBA 4QNRA 1WHTB 4C30A 3ETHA 1RT9A 4MVWA 1KO4A 2YASA 3N6XA 4K6HA 4GWLA 4AD8A 4DABA 1WKBA 4DWJA 4UEQA 1V7ZA 1VMDA 2ZS8A 3FCOA 3ZWXA 1R12A 5CB4A 4JV5I 5T4EA 1Y63A 1PT8A 4BLOA 5JVDA 3I1IA 4F9FA 3PYMA 3SC6A 2Z3ZA 4Q66C 1N33B 2VJKA 3E1KA 3C6ZA 1R3DA 4KZPA 1E5LA 4RK4A 4UPDA 4D56A 1EDEA 4E13A 1HTBA 5AVOA 5E1DA 4HQ0A 2C3YA 5GOZA 1R4NB 3D8RA 3PF9A 1X74A 4RS3A 1WZNA 1JHOA 2L18A 4J8PA 1GTSA 1TNDA 3ZYZA 3IGFA 2IHZA 2JJ1A 1MT3A 2CDCA 4LAFA 3Q3HA 2NO6A 1BHO1 3BF7A 3BGOS 1CUXA 1E0DA 3NIWA 1BFKA 1M73E 1S1MA 4UMVA 3W5UA 4ECAA 5AKYA 1UZNA 4EFDA 5T57A 2CNNA 5CMLA 5K45A 1SVLA 4A8HA 2JK1A 3X1WA 2HXYA 3IAHA 3RC8A 1P0QA 1QE5A 5M5BA 3SEQA 4IHJB 1UAYA 4JJ7A 4O4JB 1J97A 1YR7A 1WXHA 1E94E 1KSHA 4OXIA 2BY4A 4Y6PA 3HKBA 4MCJA 2PLFA 4CIWA 5JFGA 2H59A 3COPA 2WNRB 3GAMA 4Q47A 3ZWWA 3KTAB 4TV9B 1CY7A 3GH3A 1JZSA 2YS7A 3WYDA 1MB4A 3K1AA 2WUFA 2Z6AA 5LDDC 3P76A 1XTBA 3DDHA 5EA2A 1XQXA 2OHXA 4Y7CA 5JSHA 1OLSA 3VPBA 2PGNA 2DWPA 2QRUA 4G0NA 2GF9A 3H9EO 4X1IA 4HBZA 3UAZA 2TMYA 4AYWA 1S4QA 4KQHA 5JBQA 1P3Y1 3NHKA 2J30A 4RNDB 5D3MB 1KHHA 1NW7A 3STUA 1X1AA 3WZ2A 4CETA 2VDKB 1CR2A 3WVNA 4DSNA 3WXMA 1Z88A 1AGXA 1T36B 1IYZA 2R6GA 3A6EA 3C6MA 4XWAA 4BWGA 4ZT3A 3B1ZA 2A3RA 1A1VA 3NT2A 5LLSA 1R4ZA 3IMGA 1KMNA 3WYGA 2ISQA 3QXSA 1LQTA 1XMOI 1UOOA 2ORIA 4EFLA 5BSHA 1Z6ZA 2HSZA 1J0DA 3H16A 4Q7JB 4W4TA 5F35A 3IPAA 3E1GA 1GAXA 1GG2A 5E6UB 2I6UA 4X71A 1GU1A 2C20A 2GS8A 3ZV4A 1FP7A 3MOSA 4FOLA 3QELA 1VHJA 2JGDA 2O3UA 2AOUA 2VDJA 1PR9A 3LC2O 4FMCB 4ITUA 5C7YA 2OV1A 5MFZA 2HO5A 3N0VA 2YZMA 3QVKA 3EUAA 1FLAA 2PPLA 5ELMA 1WWKA 1YR2A 5CB8A 5JNTA 4XIIA 2H16A 2XD4A 2XOKD 4J9UE 2FGKA 1D2MA 1V16B 1N34I 3A1CA 4RHFA 4WK6A 4YRDA 3HXMA 1V47A 3DFUA 1RI3A 1EFDN 1XRQA 4KMRA 1SEPA 3OQ6A 1KRHA 2Z98A 1IQUA 3TTTA 5HS4A 1NGSA 2YTZA 3CLSD 2V0GA 4D81A 2XRFA 1M2GA 4PSDA 1H22A 1LU9A 3NEJA 1T1RA 3NYQA 1NT4A 3WBKA 4DMCA 5KWSA 4D3ZA 1Q1QA 4GR4A 4IG9A 1T9ZA 3AHCA 4YUXA 2O2SA 5CCBA 4EUKA 4DA8A 2VDWA 5JYDA 3Q1QA 4BCCA 2W6JA 4UUAA 3UJ7A 3BFKA 4CM8A 4FYVA 5LYYA 3KOWA 4LGMA 1HNZB 2A9PA 4REQA 1EUCB 1SKYE 3QY9A 3NVKI 3EUEA 3EBLA 4GQUA 2YBDA 4G5RA 4HAUA 4YCBA 4BVFA 2EW8A 2A67A 2BT4A 2V6BA 3M2TA 4Q93A 2EZ8A 3BQNB 4JJ6A 5JAQA 2P7HA 1E2UA 3RVMA 4D9GA 5B30A 1BU8A 3LL4A 3W6OA 3JX9A 2KSQA 1KAEA 3H9BA 1ESCA 1LI7A 3EXHB 3ZE0B 3ZNQA 1J21A 1FX1A 1KEKA 3IOBA 2IS4A 5FL7D 3A4MA 3MRVA 3FCXA 4JEMA 2J46A 1LPMA 1CDEA 1RMQA 3IT2A 1DB3A 2ZSKA 4F1WA 3QP9A 1KK2A 1KAQA 3LNCA 2O8DB 4AYTA 2V5UA 4IL5A 1NJGA 3KTAA 5AIAA 3SKVA 5JJCA 4R54A 3KDPA 2XWJI 3OE4A 4W1PA 5SYAA 5ICMA 1HOTA 3CNLA 2FVYA 3OLCX 1D4AA 5F51A 1EK6A 2ATXA 5KI6A 4O5AA 1Z0WA 1DVRA 1E2EA 2QP9X 2UZ0A 4H16A 2BM8A 1QTNA 2GK7A 2W4QA 3A6PC 4TT3D 2JD1A 1N2GA 4TLBA 3B6EA 1Z5AA 1E3WA 1NBEA 3INGA 4NDNE 3HGTA 2GLUA 1QP0A 2FUG1 5FI5A 3GNSA 2HKJA 4JIGA 5EMJA 1NQXA 2ZUWA 3R1IA 5I3ZA 3RSSA 5DTQA 4UXHA 2FN7A 2IOQA 4PX5A 1IUNA 4Z7NB 4UE3S 3CPSA 1FRZA 4IUBS 4ZEXA 4NFSA 2B4TO 4F3RA 1Z08A 3FDZA 3D64A 3DLTA 1M2OB 2ZRLA 4HS4A 2V7QA 3QLVA 5CUQA 5FP0A 3UJ3X 1COWA 2PMDA 1VI6A 4N49A 3LW7A 5AOBA 1RYMA 3EVBA 2D59A 1Z0TA 3KQPA 3LPAA 4HLCA 5DLYA 4ABYA 1SK8A 5E4TA 3A26A 1SKAA 2CBXA 1PJRA 2F9MA 2BI7A 1SUIA 2VA8A 2VUHB 3FF4A 4GPBA 4M98A 4NPCA 2P6UA 1I33A 4GR5A 5AW2A 2IV2X 2XXAA 4ZVLA 4WZAB 1T24A 1L8OA 4O8CA 1DRWA 2Q9AA 3OO1A 4LV6A 2R7KA 1PTJA 1XQYA 5A2QC 3LCVB 4NICA 1GPKA 2K7ZA 5FTNA 4WW0A 2I80A 3TL2A 3HCNA 3A31A 2CHGA 3CXRA 4PYJA 3UCFA 5A3SA 2HNKA 1TQHA 3UEOA 3HPQA 5KU1A 2JGEA 5IM4A 4N12A 4LSZA 1CZLA 3FB4A 4HVLA 1NP3A 1EP3B 1AKVA 4XVCA 4XQGA 3GRUA 1XTJA 2BOVA 1JR4A 3IJPA 4U7JA 3FHCB 5EUMA 4RE6A 1E2IA 1RPTA 4PYNA 2IPOA 2VH2A 3NFYA 5FBLB 5IH7A 1EG2A 1G21E 2HA2A 2OCLA 3IDOA 1EINA 3VC3A 1X1DA 3ASUA 4FYYA 3ED5A 4HQLA 4NXNB 1M8GA 2X9NA 3VOAA 1PN3A 3QVVA 5A05A 3EB9A 5AVUA 4JQCA 3M6XA 4LFAE 1GVHA 2I1LA 2W2TA 3DMHA 1A5BB 4C7KA 4Q03A 4A0GA 3ONDA 1XVUA 1Q91A 3T5CA 2Z8YA 4O4LF 2UYGA 3GA5A 1UJ6A 2UZ1B 2PVSA 4WOCA 2E1RA 3N2KB 4OX9Y 2FJ0A 3BREA 2L69A 1RZ3A 2V6GA 3D4LA 2FYTA 1ML3A 3OJOA 5B3KA 1NVFA 5TX7A 1QVRA 3W0LB 3NYIA 4WKGA 5TT1A 4KFRA 4BNTA 3O2NA 2PSHA 4NCBA 1PGPA 4AM8A 3JR7A 1TYDE 2D8MA 4FFPA 2AOWA 5L3JA 1L4UA 2HQSA 2QM0A 4DR2I 3CA8A 3IBTA 1C3LA 3EGXA 1PBNA 3M2PA 2ZG6A 3S2IA 3TB4A 3JAMC 1NVVR 1XZQA 3WIOA 4PN7A 4CLDA 2YMMA 4YQYA 1HR0B 4AKIA 4IZHA 1RVDA 3BEDA 4QXPA 5FULA 1XYYA 4S24A 4WOKA 1JFVA 4PZAA 2RFLA 4ZDJA 2QUAA 5JROA 3QX3A 1P9WA 4X62B 2AFHE 2HU5A 3E9MA 4GDMA 4JMPA 3CX3A 4MUFA 2GXSA 2ADOA 4G86A 2ROQA 5A4FS 2OEPA 4M89A 2OBFA 3AT1A 1M34B 1B8UA 5U9CA 3KG2A 2GWRA 4I3HA 2J3LA 2ZSDA 4KQXA 4J2TA 3L5OA 4Q7QA 1SH7A 5LP1A 2A58A 2ZBFA 2FRDC 4EK9A 2BUCA 3PZBA 4S3MA 5B2ZA 2GAAA 2VYND 1QHEA 3KQKA 1C30B 4U2BA 3G0OA 3ESRA 2VRBA 4D98A 2R6R1 3DPUA 1T8TA 4F9TA 2IBTA 3QFCA 1VB3A 2O8NA 4DMGA 2QXUA 3MBKA 4JA2A 4NYMQ 3GI1A 4UBIA 4BJ5A 3QU5A 4P4NA 3H4TA 1IY2A 2HH9A 1Z5GA 5AM5A 2H1OA 4X6XA 2C3OA 1P2UA 2VRWA 2DEJA 1HG0A 1ZN8A 3OZUA 1IJKA 4NPAA 1YASA 1NNEA 4QDUA 4DC9A 3FKSA 3KLBA 2CBGA 4TTSA 4WLEA 2ZBUA 5TDHA 3A8TA 1UC4B 3WDKA 2PZJA 3JQQA 1SBCA 1I4DD 3LIIA 4WX2B 3ED1A 2XQGA 4A0QA 1B8NA 2EERA 4J1TC 2A8YA 4PO8A 5C8VA 5JSQA 1GITA 1JI0A 3PFFA 2Z95A 4HDQB 5EJFA 4ZARA 2ASEA 3UTCA 1GFZA 1GL6A 3D2AA 3EAGA 3NBZC 3L1KA 3RT9A 3TIXB 3UY4A 2WVHA 2LDXA 3ONWA 1W1UA 4XFDA 1EFCA 1UWLA 3EMKA 3I92A 1J8DA 1JN0A 2HPHA 5E6SB 2C7RA 3WLKX 4RK7A 5EGSA 1VIAA 1FXWA 5EMNA 3OCUA 2XT0A 3GT3A 1XEXA 3RRYA 4F3YA 3EVNA 4CVNA 1H65A 2PNMA 2AZMA 3WFIA 4ZMSA 5E3HA 4G1CA 4M83A 5K2MA 1MV8A 1GRQA 1O96B 1UPBA 2HCRA 1D0IA 3BE6A 1U1EA 4V3BA 4OHVA 3KP1A 1DKMA 1BDBA 1JA9A 3B5JA 2NPIA 1GPBA 1XEFA 2GSWA 1V2GA 1NONA 1XA3A 1DELA 2NYRA 4R4JA 1CY2A 1M6YA 2QRMA 2VUTA 3ZUPA 4BN5A 3DMGA 4U2GA 4RGQA 2IHNA 3AEQA 4HGNA 2QU8A 1Q7RA 1WB9A 5CW1A 5IJZA 1RMYA 3ASZA 2PO0B 1RM5A 1E3LA 2HJHA 2CKDA 3N2KA 2X8WA 3OY2A 3SHFA 2BA1G 4ENWA 5JEAA 2G9VA 1A9RA 3A3YA 4QDZA 3THYB 4BJ1A 1DKPA 4MQ6A 2NX2A 1EU1A 3H5WA 4B7CA 4WXMA 1CDDA 1X38A 2MU1A 2P68A 3TNJA 3T9BA 1KYWA 2CVFA 2ZRAA 4XB1A 5JO9A 2B6NA 4B4UA 1V35A 3CSUA 3DVQX 5A9SA 1QQAA 4ZI5A 5AXCA 5BOSA 1ECLA 2H6EA 1CQZA 4G5HA 4O2BA 3C48A 3QY0A 2D2FA 4EVRA 5KTRA 3M6UA 1WUUA 3PLRA 4FFBA 1ZN2A 1YAJA 3ITDA 2HKIA 1AVTA 1XNRE 2NZWA 3LBNA 3PUHA 1FNDA 3JYLA 4MR9B 5E2BA 3U7JA 1RHYA 1E9SA 3DMYA 3WNVA 4BNZA 4ZOLF 4GLJA 5IUNC 4JXXA 1IBMB 3ASVA 1XDGA 1C8VB 4OJTA 3S2UA 3ZEIA 5G1PA 3LLUA 4E2ZA 3OZDA 1T3HA 5HZKA 3X2EA 3JYHA 2Z6QA 3O91A 3NWEA 3J80A 4B3SE 2NAPA 1AHNA 2X7JA 1HY3A 1T1SA 3TEJA 3G17A 4AKHA 4NG5A 3ZHZA 3CR8A 4HPWA 1FFGA 4OO1C 3BHIA 4JLAA 4KU4A 4P4SB 5J59A 3UA3A 4FYPA 4KL8S 1JA0A 2XWQA 4IOMA 2B2CA 3O83A 1GG5A 2ZWOA 5AW5A 1MG5A 1V95A 2ZE8A 2CXXA 4EG4A 3SD7A 4K05A 4CMAA 1NV9A 5L6MB 1W35A 1ZCJA 3TE7A 1DT5A 4LOHA 2FWJA 1EWRA 5DISB 3ETLA 2PDAA 4M9RA 1YR3A 4OJQA 1UMCA 3WE7A 2NV6A 2D3TA 4JUAA 4ZYUA 1KYQA 5I3CA 1E20A 1DLJA 3NZKA 3N2GA 2D2VA 2WUVA 1OH8A 3HBLA 5KTPA 1E1RA 4EB6B 3KJFA 1PJSA 2IPNA 2ZRDA 1Y9EA 5CDYA 1W87A 4JB2A 1LF0A 4RVCA 3OT5A 3FH0A 1UKBA 2Q1YA 3K72B 4QDKA 2WWFA 1NUTA 3KE8A 4D4JA 5BSGA 5JDCC 1ORTA 2WPNA 1KXJA 3CF4G 2JJQA 2WBLC 3TLYA 1JLMA 2FEOA 1CWUA 2P3OA 3ON5A 2XX3A 5C8YA 3WDLA 1TT7A 1I3CA 5KJ6A 4BFVA 2KE5A 1QUFA 1I36A 1QE3A 5CLGA 2D1RA 5JOQA 4X94A 5HILA 1GTMA 2H2FA 5H1YA 4BLWA 3QPCA 3IEXA 1BQEA 1NNUA 3VRHA 3G1TA 1TCUA 1Y7LA 3K1TA 3NG1A 4MQYA 2O5RA 4C7MA 1LK7A 2BCJQ 2FB9A 4Q4JA 2EQAA 2QJFA 3EUWA 5BN5B 3NDBB 2O59A 3RIGA 3TOCA 4EYEA 2MSEB 1TB4A 3Q1KA 3ONVA 2GKOA 1WBJB 4G2NA 3BJMA 1JILA 4YCMA 2AE2A 3EXFA 4ZU3A 3A27A 1E6EA 3BGVA 3KM0A 3WL3A 4ENVA 1E2BA 2J8ZA 1G8HA 2G4CA 4MRMA 4DNFA 3PICA 2X9VA 1QS0B 3G0BA 1AUQA 3F3SA 3CNHA 3DT8A 4IFTA 4OGGA 1ODKA 1GFIA 2GYWA 1UIRA 2O4UX 3EY4A 2WHQA 3OEWA 4IX9A 1LTHR 5H0IA 5JS6A 4BMNA 4FC6A 3SSAA 2YRXA 3Q41A 3WMEA 4G09A 1T1EA 2FMIA 2HHJA 2WKRA 1D6MA 4GYYA 4YCJA 5DGTA 1YKFA 4M53A 1SBNE 5AW9A 1VHDA 3QPWA 3S7TA 4BMSA 1GAWA 5IZCC 3VX4A 3AIMA 2HWUA 2CJWA 4MR9A 4QFMA 2WJAA 1SVMA 1LI5A 2QTWB 2WMDA 3RVSA 1J1IA 1YR1A 1UEXC 2OY0A 3D5EA 3KPWA 1QOQB 4RD2A 4W1SA 4X65I 3RVLA 3H9UA 5BR4A 1DBPA 4KQ1A 4FEAA 1FYFA 5D01A 2P9TA 1X9IA 2F1OA 4II3A 1UF9A 1E9CA 4M1QA 4QQFA 4N0PA 1PP4A 4DKJA 1EUZA 2UXDE 3G6KA 3ZLBA 4QDXA 1WRBA 1DEHA 3C7CB 1E63A 1M75A 3I30X 4HXGA 3O4JA 4L75A 1FYVA 5CJ2A 3DTTA 4DREA 4ZFNA 1U63A 2VDLB 3LPLA 1E89A 2F1IA 4DXLA 3VR3D 1OI3A 4U8HA 1EWTA 4O4HA 2E89A 4OLFA 1I3MA 2XZOA 4K03A 3P9NA 2GJ8A 5DXFA 3TRJA 3LBIA 1AGRA 4CMHA 3AI7A 1HQDA 2WHPB 2BFMA 4BRUA 2BYTA 4XXHA 3Q6IA 1NPTO 2J6CA 3JQGA 3JVVA 3KYDA 4BQRA 4BX8A 2Z2YA 1Z56C 2YZ7A 3WQRA 3PVZA 4MSUA 3P1JA 5K8VA 1JQBA 4R1PA 5KSOA 1Z47A 1GPMA 4F7WA 3PQEA 5IUKC 1TI7A 5JO0A 5E6RA 4GI2A 2AMYA 3MSXA 4MVJA 3UGTA 4G0YA 1Y9ZA 1FXSA 5D1HA 4QGSA 2FW6A 2QMYA 5KNCA 2IEZA 3LD9A 2O19A 3JWJA 4PQEA 4U9HS 2EIXA 3LUKA 1QHYA 1K6XA 2B4RO 1VE3A 3JQCA 3RWBA 3DXXA 2FZLA 3GN1A 1OXMA 2CNLA 4NENA 2J0UB 3ZV3A 2Q2VA 4MUHA 4YP0A 3AX6A 4X8MA 3HCPA 1MU0A 5DRTA 5FJJA 4FQ7A 5IAEA 3G79A 4DF3A 1PFYA 2PUTA 2J9GA 3ANXA 1NWCA 3G6WA 3BMOB 3PC8C 1PG0A 1YA8A 3QEMB 4UTRA 4ZI3A 3J7AM 2WSMA 4FT4A 4JI1I 1ZH6A 4C1BA 5KOJB 3UAYA 1I4OA 4JFRA 3CNBA 1W5FA 4LDAA 2FLWA 4GWGA 1IY0A 4UM9B 2XUPA 4OP1A 2IZ5A 1I3NA 1SXJE 3RR2A 1B7GO 1DADA 1JQLB 3I05A 4BRWA 4E4TA 5J63A 1QS0A 2VNAA 1H1DA 1YA6A 1RM0A 3G89A 4GBED 3RYIA 5MFPA 1Z7EA 2O8BA 1AUOA 1J5EE 1M6EX 2QLTA 2Y1CA 3BXOA 3OCVA 3OZGA 4WN9B 1EUYA 1EP9A 3I83A 1YUBA 2YN0A 4K3VA 1Y4DE 1Z2EA 4AXXA 1Z4OA 3DLAA 2BFDB 1M5TA 4HDSA 3W2HA 1KI8A 4DV3E 4OX9I 1H2AS 4AUMA 2A1TR 2I65A 3R3ZA 4TMXA 5DWVA 1JFSA 3IVAA 5MN4A 1TM1E 1WP4A 2II6A 4AM3A 3VTKA 4EUHA 4FWDA 2VPPA 1MQ8B 4B6SA 1ZZEA 3ACBA 3ANMA 2FCAA 3PCTA 2YC2C 3V1UA 4YY3I 2CDNA 4EG7A 4MIYA 4S0ZA 2PO1A 1Z5BA 2AMFA 4QA9A 5ITSA 3C3XA 4KWEA 2HYDA 4P58A 1Z17A 1ULSA 1AB6A 2ZEJA 4PG4A 4KEAA 4WE3A 5HRUA 4GL2A 4QPDA 5JAMA 4F4CA 5L7WA 2O2ZA 3S40A 4QLOA 4A73A 3T1TA 2O1UA 4XQ0A 3S1AB 4BV3A 5B57C 4IOKA 2JGAA 1DAKA 2Y05A 3D1LA 1UK6A 1Y3BE 3AC0A 4A0SA 2Y66A 5HUHA 5HZGA 4L5BA 4AWXA 4IVQA 1QAMA 1N1EA 3CVWA 1I94B 2BBTA 2ZBKB 3FUUA 3NDPA 2LDBA 4BTLA 3KPVA 1RBMA 2WHPA 4FBLA 5LP6C 3E9ZA 3ETNA 1G8YA 3QVGA 3DMRA 2BFCB 1ADFA 2NSJA 3UXYA 3D5TA 5LMCA 4JDUA 2BR2B 1BHQ1 1TZKA 2EFYA 1H8EA 4NAHA 4RTLA 2JANA 1HDRA 2HFSA 4GGOA 4QE3A 3LKZA 1LEHA 2WM8A 3STVA 3H1PA 4IHQA 4B73A 3M49A 3RRMA 4OM8A 3AHIA 3RIMA 1E6KA 2NTJA 2JJ1D 1X3SA 4HDMB 4I50B 3DFZA 4O08A 4NXMI 1EXMA 4ZAZA 2CUZA 1E0SA 1NKTA 1IZYA 4RPKA 4TV8F 4NONA 1P80A 2AJ4A 1Z4JA 3LX4A 4G67A 1R2QA 3NO4A 4M76B 4E5DA 1HYQA 3BWVA 3D3EA 1FWLA 3TL3A 2A59A 2F43A 3DYVA 4ZVMA 1LC3A 4RL4A 2IP1A 3EVDA 1NW9B 5ELXA 4Z7CA 2XVAA 1TDJA 4EQZA 1R9MA 2FZGA 4QDJA 5AW7A 5MN6A 3MIZA 2G7ZA 1P17A 4F1JA 1FVFA 3ICQB 3K9QO 1DWOA 4WOBA 1IHXA 3LA6A 1JSLA 4MO2A 3AL3A 4RKFA 1C0LA 2O7QA 1B00A 2GVZC 1SIUA 1YNOA 3LQKA 4TLMB 1QM5A 4LZAA 1L7NA 3PDUA 1Q44A 3DHNA 2E55A 4DCOA 4C7VA 5I7SA 5ED4A 2ZUEA 1EHIA 5DH9A 2EZTA 3OZEA 4OQNA 3IKJA 3RS9A 5LQCA 1UKEA 1MJFA 2NNWB 3KJGA 3ADOA 1NRJB 3TNYA 3EWNA 1C1HA 4OQYA 1TPYA 2WV7A 4DLRA 4LOMA 3ZGXA 3DF7A 3FY4A 1E2MA 1JH8A 1P0FA 2H3EA 2QD1A 4GOKA 4ICIA 1AK9A 1P4SA 5DOVA 3KQNA 4H27A 2XQVA 4IWXA 4YP1A 4CMGA 1R16A 1X0VA 2FPWA 5BQXA 5BW5A 3T1VA 1IBKI 2AQHA 4EHIA 2OXTA 2YC4C 1GPAA 1E3JA 3F7NA 1AF4A 3IUMA 3CS3A 3OFSA 4G9EA 1QIFA 2G7MC 4K6MA 4OHWA 3VOTA 1W6RA 1IHUA 3KQQA 5IJ0B 2FQ1A 5K0CA 1JWLA 3RADC 5HOEA 4YAEA 4BB9A 3AY0A 1DAMA 1GT91 5BSMA 4HNGA 4GKJB 1QQ7A 1SD2A 2RGGA 3OE7D 1LLFA 4FFOA 2PKQO 4Q3LA 3WTBA 4L4RA 3NUQA 4Q01A 5AUNB 1LNQA 1KOJA 3O74A 3HPRA 4EF6A 3T9DA 2AOXA 1ZXMA 2A1UA 1KIJA 3HJUA 2ZJ1A 4PFQA 3TI7A 2IHYA 2BGIA 3G23A 3DBIA 1Z2OX 2QGZA 4QVKA 1LVHA 1XRNA 1U1DA 1I9CA 4KXQA 1Q0PA 1Y6FA 3RC2A 3RJTA 4UKDA 2ZTSA 4LX8A 4UHDA 4LFBI 1HE8B 1TEVA 4IO0A 1U6IA 1IN6A 1M6VB 1J8YF 2C2OA 1GNTA 2RGNC 3KKLA 4KTVE 2C95A 4MIEA 1D09A 4FTWA 3S1AA 4CHGA 2VS1A 4E2WA 2W42A 1OVGA 1H0RA 1QZTA 2YUIA 4OMUA 2AOVA 4F4DA 4XGRA 3A9VA 4RJTA 4KDEA 5IJXA 2NPOA 4DVJA 2QPAA 4BA2A 2I7CA 2G8LA 1QZXA 2NZYA 2RG1A 2NV2B 1SCUA 2PMFA 2ZI9A 4IPTA 4BCBA 5IEBA 3PKJA 1CNEA 1KFEB 4ARAA 3G0CA 4WLOA 4OHZA 1I1NA 4ZQBA 4JH0A 3N8DA 1CIJA 2J4CA 3OOEA 1GUAA 3L77A 1DO2A 3KKNA 1Z26A 3X43A 4M88A 2FW1A 1ECFA 2XPCA 3JZIA 3QG5A 4J0GA 2ZLBA 4GZLA 4JT8A 4NZNA 2J0VA 3N2EA 3D6HA 2W6JD 3MWKA 1VGQA 4GIBA 1N75A 2YN2A 3T6KA 1W29A 3QUBA 1E9RA 3L7ZA 4KBYA 3DCYA 3A7DA 4HAIA 5AUOB 3U4DA 2J0SA 3OIUA 1I3LA 4HYEA 4XVRA 3DKIA 5CM2Z 4YJDA 1A76A 1PNVA 3T54A 4FFVA 1CS0A 4E2XA 2C83A 1ZSNA 5AKHA 4ZEOA 1U3WA 3KWJA 1E9VA 4KIGA 4DPUA 1KYIA 5DASA 4AIRA 2PGLA 4O8ZA 3TUZC 4C4SA 1HE2A 4DGSA 1XAGA 1JHRA 2M9MA 1P1FA 1YI8A 3JARA 1IB0A 3OJLA 2GM9A 5AM2A 2LBPA 3CDJA 4MYUA 3Q8XB 4MWCA 3ORFA 2E4ZA 4HFNA 3H1CA 1WVGA 2QT0A 4I08A 4U3BA 2Q27A 4BE7B 2O3RA 2NMVA 2A30A 5AKKA 2ZFUA 6ADHA 3JZAA 4PU0A 3EGDB 1OXUA 1I7DA 2FKAA 3C24A 1E8DA 3L07A 3L4SO 2O57A 4OQLA 4REOA 5ICFA 1UBLS 3MHPA 4YA6A 3EPRA 3AOEA 2XDWA 3KUKA 2V6IA 3N0RA 2CMHA 1CZUA 3PC7A 3QVXA 2IYZA 2PTHA 5LUBA 3DFFA 3G0DA 3LLCA 5KJFA 1QRSA 4UATA 3WFJA 4AMGA 2RHRA 5TPWA 4DMUB 5LPNA 2PZFA 2ZJ7A 4U63A 1Z59A 4K1LA 2NGRA 2RHWA 1W46A 3C4JA 1FFAA 4MP3A 4MDTA 2VDRB 1KGDA 3DOEA 3S3TA 1Q7TA 3TQFA 4KFCA 2EGGA 4L4SA 4V0NA 3KEOA 2M1ZA 1ZD8A 2XCQA 4MGKR 2R5NA 2V7QD 2Z09A 3LX8A 3IX7A 1COWD 2NU7B 4U00A 4MH0R 4KPFC 3V8BA 5KYGA 1FP4B 4JNKA 4UAVA 3F46A 4M99A 4LJ6A 2RCYA 2XUQA 4M1ZA 4PQRA 5E1OA 1XTVA 1JSRA 4JYMA 5ES4B 3NKFA 1YD7A 3Q85A 1LSSA 1UKCA 2NZVG 3MK31 1TUBA 2AYYA 3F8SA 3QFFA 1GCOA 5AKIA 4TX1A 3TFQA 4D82A 3SP1A 4MMZB 3RSZA 1QG4A 3QZUA 3TQIA 4HAWA 1EWYA 1T3GA 5EIAA 3U3JA 1DE0A 4UVEA 1A4IA 2UZIR 4Q7MB 1YMVA 4XD2A 5E4JA 4CL8A 2F8MA 4U3JA 2XODA 5EKDA 3WAKA 2DTDA 4ENTA 4FWTA 1EM6A 1OX5A 2F00A 1EHYA 2XJ4A 3PEVA 3TEFA 3V8MA 1T3LA 2BBOA 1NG1A 2X36A 2GEKA 3QU2A 4UBOA 4AKSA 3ZNNA 1MC1A 2COEA 2WT4A 4J3FA 4BS9A 3F6RA 1YQUA 4I6EA 1N0VC 1C3OB 2Q3EA 1U8FO 4LYJA 5DTIA 1NBOA 3GELA 4FBGA 8GPBA 2CHEA 1CF4A 3Q3VA 4UQLA 2XB4A 4MZDA 4OGWA 3M89A 3WLIA 5U4QA 2JEAB 4WLNA 5DW3A 1A9YA 1P0CA 4YV2A 1XPOA 4HEQA 1SM4A 2C00A 3VHQA 4NYIR 3QUAA 2ZIVB 3LT0A 1TKBA 1MEOA 4BZZA 1Z0ZA 3ZDCA 3HV2A 1Z0AA 2Z5BA 1QWSA 4EHFA 1ENZA 4DLAA 2OOSA 3V2HA 2HHAA 4HB3A 1BWPA 1L3BA 2FN4A 2FFRA 5EJ2A 1L7BA 4OHRA 1U4SA 4RIFA 4RZIA 5GV7A 5DWQA 3S81A 2PGDA 5BT8A 3KLPX 1G5HA 1LWNA 1Y3CE 3CH5A 3GFOA 4BWYA 1SG0A 2EKZA 2EF0A 3B51X 4N7RA 1GZ7A 2GBLC 2L19A 2MIIA 2PNFA 2X0KA 3PC4A 4PHCA 1DIOB 4GGPA 2X0FA 2M2IA 3H5VA 3DDUA 3KXIA 2EV9A 3ZY2A 1RHUA 4BQIA 2V7GA 3TDMA 2FPPB 3M4XA 1ESZA 4PSAA 3D4JA 2REQA 3P2EA 5CVUA 4RDXA 4Q12A 1L7DA 2C2BA 2ZR8A 3KELA 3PX3A 3M34A 3SZMA 4O2AA 2Q1WA 4K6OA 1DPFA 2E5WA 4W8HA 3N8HA 4ZQGA 2CMGA 4A2WA 4HVTA 2CHQA 2EKQA 4IDHA 4K0RA 1MZPA 2NN6B 2H2AA 3T3DA 4CLRB 4RW0A 4DR7B 3DUFA 4MQFA 1MHTA 4Z9AA 1BX1A 2C4VA 2EJBA 1NUQA 3IBGA 3KO8A 1GR0A 5CITA 2C39B 1BQ4A 1Y3DE 3INTA 5DF1A 3I2IA 4DMHA 1K8QA 1YR9A 4Q82A 2OYCA 2XUKA 5JPDA 1K47A 4AL4A 3I23A 3ZU3A 3D6VA 2QZ4A 2BE7A 1O9HA 2NU7A 3B6ZA 3L7AA 4JLSA 1FP4A 4XASA 3X2SA 2CFOA 4G23A 1OY1A 4LHEA 2O1TA 3QJYA 4V0SA 3S8YA 4YCNA 2CN1A 1HQYE 1QG2A 5C0XB 3LVRE 5AW3A 1M9NA 1Q0ZA 3EPHA 3LGSA 3FKSD 4WPGA 5AOVA 4K0KI 1E3QA 1X7XB 4UZSA 4CT5A 1DWUA 3G59A 4WLUA 5DROA 1WUYA 2VSFA 4NV1A 4X97A 3F7TA 3WDMA 4E5YA 1BJKA 5F64A 3F3YA 3V2IA 4DPXA 3CRZA 2P2ZA 7MHTA 2IUTA 3CG4A 5EP1A 3I62A 2WJYA 3SNKA 2AS0A 3OH8A 4J4TA 4FDAA 3INYA 4MLDA 4IHKA 1HF3A 5K8IA 3C16C 2WP0A 4GKKI 4ZKDA 3OOHA 5BR8E 3IOEA 4N3AA 5CCDA 3RBAA 5EJ8A 3GLHE 3OM1A 4HMOA 1FBTA 2GN0A 1UXIA 4IKEA 1T6NA 4IQ4A 4IBOA 3ZD6A 2HWYA 3ACDA 2JKYA 3ABOB 2ZT5A 3DO5A 1II0A 5DP2A 3A1VA 2NVUA 2JEAA 2PSSA 1E69A 4IDGA 3TO5A 4FM9A 1JDUA 3AGQA 1OFHA 1E79D 3OPNA 3OX4A 4YFVA 4C5CA 4YR7A 5GTDA 4KI7A 1U7XA 2GPJA 2L0XA 2GILA 1XVTA 2RBKA 3HDJA 2WMOB 3HRHA 1ZC4A 3C6KA 3GCXA 4ON9A 3U3ZA 2MSKA 4AN1A 3CVXA 2PL9A 5F9MA 2WAXA 3D3JA 3NHSA 4Y9UA 2DHCA 3WIEA 1W581 4ESHA 4HKTA 4MR8B 1RZRA 2VF8A 3MRXA 3CPJB 3H2BA 1V1RA 3B1YA 2DP4E 2IEIA 3LVQE 4DLXA 1R8XA 4LY6A 5SYNA 5HHTA 1JEAA 4RS4A 2QRVB 2WF8A 1JLLB 5CNKA 2HMVA 2GGSA 1N25A 3JWGA 2V6MA 2H9YA 2XCTB 1CDOA 1DWPA 4CV3A 1R50A 2A94A 4RKEA 4ZCLA 5BNWA 4Q7EA 1I13A 2WT8A 4OK3A 4DYVA 3K70B 1T0JB 3V42A 2HA5A 3PCRB 2WTEA 4TRMA 4Y6GB 4F5WA 3W5IA 3Q6NA 3LFTA 4ER7A 4W5OA 3LH5A 4M1YA 3ET5A 3WMFA 2G77B 3ABZA 4XIFA 4LXGA 3NI2A 2CD9A 5A1JA 1KJNA 1MC5A 3F6PA 2OAEA 3GVPA 4GX5A 5FTMA 2IV3A 1HWYA 1SXIA 4ZO4A 3EXEB 1VPEA 4MICA 5I9TA 1VP3A 2BJWA 3TW8B 2HMUA 1A8HA 1BKSB 1NULA 2UU9I 4LXTA 4PZEA 5CAEB 4X66B 4E94A 1C7RA 3C3EA 5FWAA 4D8YA 4DV4I 3KLOA 4DCPA 3N2YA 2WJ4A 4D1YA 1Y34E 3FJ1A 3IAUA 1KSGA 5JS8A 1SMKA 1OI2A 1ZJWA 3CV3A 3W9UA 2O1EA 1UBEA 1C1DA 4R6WA 3WJ1A 2CV2A 3Q7PA 2EIHA 1P7YA 2QIOA 1AKTA 2HXSA 4GMHA 3LT1A 5FBKA 3WGQA 5FX2A 3ABIA 4WK2B 2PX8A 4XCVA 3S29A 3C3JA 5FOVA 3ZZ1A 1PR1A 1VISA 2QVYX 2IZOA 3QF4A 3EDYA 2QW1A 1GUFA 2OZEA 3DEAA 1E1RD 3CUWA 3DZ8A 3FMFA 4KTTE 3X1XA 4ZGBA 3IUEA 2QAGC 4TYPA 2JFGA 2F1RA 3M9LA 4P4UA 4EI7A 1MA0A 1QGOA 1VYTA 2IP4A 3AF5A 2P91A 3QE0A 3E2MA 3O94A 4OHBA 2IXGA 2RJOA 4QRIA 1VL1A 1WDMA 2AG8A 2AR7A 2PJRA 1WPQA 2CDRA 3KXKA 3MCWA 4F0JA 3JTEA 4QQKA 4QUIA 1FP1D 2DHRA 2UUBE 2FEKA 3FOZA 4ND3A 3VM6A 2GWHA 5ALWA 1VKNA 1KQPA 3PB3A 2Q4EA 3KQUA 4C07A 1JG4A 2I7VA 1U0EA 4MR7B 5BXYA 3Q3CA 4M46A 3JVUA 1N2ZA 3OVMA 1ECGA 4PHGA 4U6QA 4C78A 4YCCA 4CF4A 3VZPA 5JJIA 3I72A 3K9HA 3R75A 1IN5A 2LKDA 4NBUA 4ODIA 3NRCA 1A8UA 3RRNA 2W6PA 3I76A 3LZ6A 3PKIA 3RM3A 1BVHA 3R3UA 4WADA 4JI8I 3DAHA 5H80A 3VU8A 1J0XO 3H0CA 4FPXA 4X84A 5AHRA 4BVGA 1WABA 1E2NA 1REQA 3C0KA 4RF4A 1R6VA 1O54A 4R9UC 1XK7A 4WXPA 3RC7A 3SM9A 1TZCA 3SOZA 3HA7A 4R9SA 1E58A 1R0BA 1RYFA 2A57A 8ATCA 2PUVA 4DCUA 4GOOD 4MAMA 3UPDA 4HK4A 4I4IA 2AV6A 2O6LA 2C38B 1J24A 4G6ZA 5CX1A 3Q40A 2JFPA 3EZ2A 3UOGA 5D87A 4Z4IA 3L7OA 3QOXA 1ZL0A 3GLIE 3K3PA 2JCXA 2SKDA 1EZ1A 4IFDE 1VJ5A 4PGAA 3W7BA 2IYLD 3FCYA 2BR4A 2P77A 1V6CA 3NP9A 1D6TA 3K2BA 5T8KC 2GN4A 3IS3A 1JLLA 2JFQA 3Q0TA 4Y2XA 2UUAE 2W6QA 4OSPA 4DLZA 3NNDA 3BHNA 3BXPA 2IE8A 5MN5A 1U7OA 5K6AC 1JHDA 3EA0A 2ZKIA 2XDAA 4RZHA 1BXRA 1OLXB 1N6RA 3INRA 1IM8A 4LF7I 2PWPA 1JHUA 2DPMA 1V11A 3FYUA 3HDVA 2DE0X 3L82B 5CRIA 1K8RA 5DI3B 1PO7A 1VJDA 3OTOI 3EXEA 4MHOA 4RMIA 4QVIA 4YC7A 3I9V1 3CINA 4RULA 3KXDA 3P96A 4PYQA 1GGNA 5CAEA 3I3SR 3K5IA 3RIXA 4CQMA 4M0UA 3T5TA 1ESEA 5JEDA 3BF8A 5EIBD 2IH5A 3A36A 3P2KA 3KKOA 2H8KA 2XOEA 2X4IA 2ASVA 1J0BA 2QN8A 4YRJA 3R7AA 3VNBA 4BVEA 2LP4Y 5L51A 1RYYA 1QJCA 2JI6A 3FLAA 4H31A 4OSOA 4QOEA 4YRCA 3T3EA 3CG0A 3IAEA 2WTUA 1C1XB 2ADMA 4IV5A 1P72A 1XVVA 4URUR 1JS1X 1CD5A 3L06A 3PHCA 2XH8A 1OPRA 3EIQA 1BXZA 1P1HA 3H8VA 4B3RE 3FPJA 1IZ8A 3G85A 2ZW9A 5CHYA 5GQSA 1FNNA 3QWIA 3RQIA 3D0OA 2PAAA 5F3DA 2O8FB 1DBSA 3GD5A 3LXMA 4MWTA 4ZAWA 1NZJA 5KX5F 4KR2A 4L07A 1GTJ1 1H0KA 4RMNA 4ZGWA 4ZI2A 2XIQA 1BN6A 2VBIA 4MVJD 1U0SY 3U48A 4CUKA 2QYHA 3WWYA 1PS8A 2W58A 3GYBA 4PNHA 5KNCD 4IWYA 4BGUA 3VPHA 5HR5A 1L4EA 1WAMA 4KIUA 2NU6B 4YJ2B 3SZUA 3JASA 1VIYA 2I2DA 3ORQA 1UZLA 5C18A 1RBYA 2Z5VA 1RWBA 2WMYA 2PUCA 2CXOA 2REOA 2QTGA 3QLJA 5TY0A 3KVYA 4FGUA 1ZXLA 2QD4A 3GIDA 4P6VF 3SAJA 4RF5A 4H2DA 3HVKA 1XXEA 3U44B 1R9NA 4BO0A 3BZBA 3TIIA 1UDOA 1M72A 4Y98A 2INGX 3ZV7A 1JGTA 1L4HA 1X86B 4X45A 4Z9YA 1DKRA 4KNVA 4KX3A 5BMVA 1ULBA 1OWMA 1XRPA 3ZOKA 1NNI1 4ERNA 1FDIA 1YBVA 1NM5C 1XGKA 5KYNA 4PPQA 1P1KA 1RBZA 4XOIA 1E1CA 3TKYA 1QRUA 2XCSB 4LA4A 1JXAA 3L6RA 3CKKA 1AE1A 3LWZA 4S2UA 4TTAA 2I4TA 4OHCA 1XJQA 4RQBA 5G3ZA 5JSKA 3ZZNA 3PNYA 4DLYA 3PI6A 1TAUA 2A1TS 2ZRKA 3V7FA 1YO6A 1M2WA 1QBGA 2ZWMA 4C89A 4HVCA 4F2DA 1D8TA 1ZOSA 3GUHA 4DV5B 4IFDF 3ISTA 2O5EA 3N8GA 2GRJA 5ES3A 3F1LA 1QCYA 4YALA 3E5HA 3M85D 2DY1A 1ESMA 3I6MA 3NBKA 2P9QA 4H7HA 3EDOA 4BN0A 2UXBE 1PBTA 2R8OA 1LNZA 4L5CA 4DR3E 1CULC 2HJVA 4WN3A 3U3KA 3PDIA 2CW5A 3V1TC 2Q9UA 5GVSA 1NC1A 1NX6A 1YH3A 1AHIA 2AFIA 1NVBA 4OREX 4QTYA 3ZM7A 4D3FA 4QJIA 2WVAA 4UHFA 3W1EA 3CQ9A 2RAPA 3D4BA 3MQ4A 2VJPA 4L9AA 2UZ4A 5IJ9B 4QUGA 1B8VA 2Y3IA 5EE3A 4FFDA 3K6SA 1C2TA 1DI0A 2X76A 5GY7A 3EVEA 4HNSA 3UFXB 2FG5A 2ZM5A 3W5VA 2R5WA 4ZYLA 3OIVA 4RA9A 1OROA 4CBVA 3NLLA 3FTCA 3TBFA 2E2WA 5CA0F 2C2GA 3SCZA 2H1FA 2LPMA 4FLEA 4JOBA 2ZUBA 3HI6A 221PA 3BERA 3EH1A 2CY0A 4UCFA 1A8IA 4DADA 5TE9A 4H7DA 2PMCA 2FRVA 3QMVA 3HKEA 2JFZA 2VXOA 1M2JA 1I7PA 1JEJA 4M1SA 3BH0A 3GFBA 2FPUA 3QEJA 5IAJA 1KZHA 1YTLA 3A0UA 3QMWA 3L0YA 2BGNA 4YCDA 4YQZA 1H8ED 3R74A 1FOEB 1M6HA 2BZGA 2JFXA 2VPYA 4IIUA 2IPLA 4DWVA 2O8FA 4P2GA 3LOQA 3MQFA 5THXA 3IFSA 3BFPA 1N57A 3WQQA 2V65A 4RHXA 2LUOA 4YMIA 4LJKA 1B76A 2BMWA 1KBZA 1QIGA 1PV2A 4CIAA 1ZLXA 4CEHA 3RPEA 1SRQA 2QWXA 5JHGB 2FN3A 1EPUA 4PPGA 4B4VA 5JMWA 3TTXA 1UR5A 5KC9A 1IQRA 3ENNA 3N74A 4KDRA 4EY5A 1DOZA 3KRTA 1N92A 2K87A 3DOJA 4ZODA 1KGSA 3WG9A 2RARA 1C41A 2H11A 4QFCA 1QG6A 5IYZB 4CEIB 5B3JA 3NONA 2FUNB 2NN6C 4GPAA 4ID9A 5CNJA 2ZJ4A 2ACEA 3Q7EA 4A1OA 1YCHA 5LZ9A 5CVTA 3OZTA 3U44A 2A2ZA 4XARA 4B83A 3DLHA 2V0CA 3JWIA 1LY1A 1L5HB 2WR8A 1NE2A 4RY8A 4MWZA 4IJVA 3AKCA 3UNXA 2WUDA 1CZNA 4HNAB 3N9IA 3OPYB 2JAUA 4RQTA 2ACKA 2AD5A 3OUZA 1SJ9A 1XTSA 4UM9D 4UTNA 4LRTB 4UEWA 1A9ZA 4N3BA 2ON6A 2XE4A 2AEEA 1MEEA 2G0TA 2HRBA 4ZVTA 2VYFA 4P7BA 4I9GA 4CM5A 4GXQA 4E5PA 4R7ZA 1KYXA 4CG1A 5C0XC 1RAEA 4XGQA 5M29A 4OKGA 2P2SA 2XW6A 3AUJB 3UOAB 1VPLA 1OILA 1TLTA 3U9TA 4DDMA 2R84A 4G8DA 4LK3A 5LNK1 1RC8A 3GP8A 1VYHA 2FEWB 1K89A 1HM5A 1P5FA 4AZ0A 5EWLB 4EQ6A 1F8XA 3R5FA 4GMXA 4EAAA 4DRYA 1HZZC 4XGIA 2GO1A 1E3PA 4PFSA 5A0FA 1CKEA 3BVPA 3PK0A 1LVUA 2XWBF 1U2DC 4G26A 1VECA 3MA0A 2H5LA 2O20A 3QWHA 1ONOA 4JLNA 3TB6A 3ZQUA 5BUCA 2IDJA 4WXYB 1NQUA 1KARA 3D3KA 3AJEA 4BLRA 1BRTA 1MNAA 4Y2TA 3SC3A 4M38A 1OYYA 2B30A 3EQ8A 2PZGA 4QO8A 3H18A 2W6OA 4RV4A 3R4VA 2Q1SA 3D6JA 1HNWE 3L4BA 1L5ZA 3CF2A 1EB9A 2XRYA 3WIUA 4WAUA 4JY7A 4YXWA 1SVKA 3LX5A 1TAHA 1AXGA 3E3MA 2QB5A 5CXSA 5ISMA 2PV0A 2ERXA 2WP8A 1GQSA 2ID9A 3CEAA 1XNGA 3MCUA 2WA2A 3AFHA 4YUYA 1AG9A 1S89A 1Y8QA 4QELA 5DHFA 3SVZA 1AO0A 5SY9A 3VJRA 1SURA 1OTXA 1RJDA 4KN9S 3M1AA 5TF0A 1N0HA 2GF2A 3WQSB 5LJLA 3K16A 3CWZA 4YPFA 5H70A 4PRLA 5GONA 1NU8A 4GXRA 4J16C 3DCIA 2O50A 2C77A 3TX2A 2Z43A 1UK7A 4LCFA 1KOFA 4II7A 1PR0A 2J67A 4PX3A 4WZBA 2C4NA 2W90A 1BROA 1ZFNA 3GA7A 1JJFA 3MF4A 4TMWA 4W9RA 3RNOA 1VSBA 3PIIA 2Q4TA 2DQKA 2IU0A 1VLJA 1DRKA 3MWJA 5BNIA 1DTEA 3NDIA 3ECSA 1Q1EA 1PT9A 3FOBA 1KKMA 3IMFA 3SI7A 4MEAA 4PLWA 3T99A 5AI9A 4KIJA 3GLGE 4OHFA 3X44A 3FWYA 1JG2A 1E1NA 2HMAA 3RHZA 3TGWA 3VR2A 4KO8A 4EPVA 2XXJA 4BASA 1JHXA 2Y0PA 5K3AA 3PHGA 3WA7A 4MQBA 5ALPA 1ZU5A 1Q16A 4D9BA 5H4GA 1RXEA 1SCKA 1L5HA 3CY6A 3X1JA 2EP7A 3ENWA 4JUDX 3KZVA 2H3HA 4LJ9A 4AJ2A 4C0HA 4OQFA 5ER9A 4BO6A 3K2QA 5JAUA 3ROMA 3STTA 1K88A 2VO1A 1B0UA 5FOUA 1XHFA 4Z99A 1X7WB 3UJHA 4D3SA 5HGJA 3D2CA 3GC6A 3JQBC 3QTTA 3ROZA 2MINB 3D2LA 1SKYB 1Z36A 1PIEA 2BA0D 1NRIA 1H6DA 1I8TA 2QLFA 4JVOA 4BGIA 1Q57A 4O4LB 3ZLUA 4AZ3B 4TMZA 4DNOA 2O07A 5EVCA 2J32A 4EPWA 3BULA 5ULLA 1QV9A 2IC5A 4WKBA 1D7AA 1KNXA 2W2KB 1VIDA 2EFJA 2YFHA 2Q49A 4DMLA 3HTXA 4KOEC 4QKQA 4E07A 1Q7CA 1Z4IA 4EFNA 4UU8A 1W96A 1XZAA 1UPCA 1YT5A 4KFSA 4EX6A 1V71A 1OLUB 4Z4EA 2C61A 2EZUA 5E4FA 4LW8A 1U7HA 1R0KA 3PPXA 5DGHA 4LOLA 1J39A 1HGXA 3UM9A 2ZSFA 1UWVA 1UBSB 4GD3Q 1O94A 3T95A 4MZXA 5HQ3B 5DNVA 1TQ2A 3PA8A 3WYNA 1XB2A 1H1LB 1YRWA 2XA1A 4UHKA 2YYYA 2FMTA 4PX2A 1L5VA 4KXUA 3SYLA 4WACA 4JX9A 4D4GA 5A03A 2YJZA 1YDEA 4A5SA 1BFUA 2LE0A 3MJSA 4Q19A 5L7YA 2ZANA 3O9VA 1B74A 2BEUB 3N8KA 5CYOA 3H1FA 3SX2A 4H7JA 4EZEA 4O3MA 3IILA 2W70A 2B4AA 3K05A 2A0FA 1OYWA 3GJ8A 5DVZA 3UMRA 5DYWA 4DJEC 3FXAA 4EPTA 3H11B 4JVLA 1NMYA 3GMEA 3EF1A 5LSAA 5A7HA 2FEMA 2Q99A 1ZH8A 2X14A 5K8UA 4FYXA 3V6LA 2OGZA 1KORA 5C4IA 5KYXB 1KS2A 1WCXA 4OI2A 3DEKA 3U7QB 1Y48E 2DBRA 1JTFA 4HZUB 5JEEA 1GQYA 4BX9A 2R1VB 4UT4A 5EL0A 5FPHA 5BT9A 1NW3A 1Z6PA 5F1OA 1RJGA 2HQOA 3FOWA 1P2FA 1P7WA 3EXIB 4JI5I 1N5MA 1P9NA 3DDWA 1PNTA 1HNNA 1Y6QA 2IQ5A 4QYMA 4TS1A 3OC0A 1WF3A 3WMGA 4C2BA 2PUGA 4D0NA 2BBWA 1TJYA 1TK3A 2X8AA 1O6CA 3OWOA 4IH9A 4PZZA 4ZQIA 4ARZB 1R5OA 5EXDA 3KEFA 2XNSA 2GTPA 4PAGA 4TLDA 3ENZA 2B0CA 5K7SA 1M1YA 3DTVB 4BFUA 3TYXA 3A1SA 2GYUA 1KO7A 3MS7A 1Y4UA 3OTIA 4ZEVA 3SKYA 4LJ8A 3PS2A 1W0JA 2DAPA 4LN1A 3MZ0A 4CKYA 1N1MA 3RTCA 1BEEA 1CS4C 4HGPA 1IK6A 1EFHA 4PCLA 3UJDA 4OK6A 4CKWB 4E5VA 2YXNA 5HF9A 1RRCA 2YVLA 4AJLA 2F55A 1KI6B 5CVCA 2VWGA 1I6MA 4QPZA 1KEEB 3V80A 1HK7A 3NC0C 4WCFA 3PL1A 4J7UA 2VXYA 1CUIA 3WJAA 4PRXA 3K0HA 4KGVA 2CNDA 2M6RA 2Z56A 4R2WA 1FB5A 1W0KA 4LMRA 4UTZA 1II9A 1JEYB 2UUOA 2JFWA 4LFAB 3E9DA 4P5EA 3EFOB 1NW5A 4RZSA 5G0TA 3PITA 3SQLA 1T9AA 1V3QE 3H8WA 3U3OA 4RAOA 1DCTA 3K9CA 2EL9A 2HSJA 4D25A 3WLPA 2UVQA 2ZSBA 3EEIA 1BOOA 1EDBA 1MAHA 2P4SA 5I8ZA 3B52X 2YJ4A 3HLKA 4JBLA 1LPBB 1FTYA 4Y0VA 3OIGA 1L7EA 3MWLA 1EXNA 1X80A 4HUQA 2D00A 3KALA 1HH4A 1M2EA 3MT7A 4PR3A 4AG5A 4MLZA 3HXOA 3CIOA 1TEZA 1EK5A 1NJSA 3P19A 1I4TD 1EESA 3TQHA 3L7DA 4HAXA 4XLLA 1DQYA 3QHAA 3RUHA 4V1CI 4A8PA 1OLUA 2VAWA 1HC7A 3DQPA 2YOHA 4YRFA 4DJ5X 1FFXB 4ZEMA 1LLCA 1SXGA 2EYUA 4HXFB 4FYIA 4OV6B 4OQDA 3CNQS 3HBJA 3BRWA 2VSXA 1NTOA 1UQTA 1QC5B 3EEFA 3IDZA 2O8CB 3LRXA 5D85A 4DPTA 2AFHB 4ZOLB 1C7IA 2QL6A 4E88A 4ZQEA 4KLNA 3WGKA 2O06A 3LPNA 3SG0A 4A82A 4DDVA 4EBFA 2AQIA 4EJMA 3R0IA 4EW2A 5FFMA 1FDSA 2BW0A 2NTNA 4NR0A 3ADKA 1NP7A 2UUCI 3CBQA 2IUUA 2JB9A 4BNFA 3M4NA 1U3TA 1PT6A 3PD7A 3RT7A 1CFJA 1WZUA 2CNOA 1B3RA 1KE2A 3R7NA 4KAXA 3TLXA 5D86A 2N0SA 5HJEA 5K0FA 5GADl 1D2RA 2HUPA 5E7IA 1YU6A 1H9BA 1APBA 2YOFA 5H7XA 1ZD9A 3B53X 4IMIB 4RM2A 4BB6A 1C8KA 1S8OA 1SZJG 3GCWA 3GLSA 3O92A 3R20A 4O25A 4PCAA 5E95A 2WIBA 3R7LA 3K5PA 3DL7A 4PCVA 2GQ0A 1AS2A 1WB6A 3C7KA 3O84A 2JARA 1HYHA 3BHMA 1RD4A 4LOJA 4OMFG 1N5IA 3DO6A 4X1YA 4X00A 1A8QA 3P9IA 4JJGA 3VAYA 3R4CA 1XRSB 1U3GA 3EGEA 2GCGA 4BNMA 1W49A 1USWA 2FTKE 2YVUA 3HCDA 4Y2HA 4NSNA 4TQAA 1HRDA 1NT2A 1QFZA 1IE3A 3DEYX 4URLA 1JEOA 1HE4A 1XVIA 3EFBA 4XB2A 5LZ5A 4KQGA 5IPFA 2I55A 2EKLA 3U09A 1N2CE 4JQZA 3OX3A 3IIJA 2D2IA 2AT1A 2EKDA 4PWZA 4OAOA 4F6RA 4CKWA 3Q8LA 4LRXA 2LIVA 4O4IF 4P2BA 4R98A 5BNTA 3RVKA 5HZHA 1MW8X 3KUDA 1KI6A 1G21A 1CJSA 2GN1A 5LCXA 3DKRA 4BKMA 5BORA 2QUZA 1I3OA 1OFUA 2GNAA 3JRXA 2V03A 1N2OA 2YWBA 4O1MA 2W11A 2BHNA 1JEYA 4M21A 3PQCA 3QX9A 2OFPA 4C0WA 4OMDA 2YWEA 1FA9A 2B7BA 3LDAA 4DLWA 5IK2D 4B6QA 4L27A 4MINA 2OLEA 1XUOA 3GVIA 2J33A 4I6JA 1N2EA 1YZLA 5JD6A 3HJHA 1DC3A 3L4KA 4Z8XA 1CF9A 2KBFA 3AMVA 3N2LA 1PEYA 2OPHA 4J03A 1JALA 4UUQA 2E5LI 3ILYA 3KT3A 5FWYB 4GKVA 3HGQA 4C6SA 1LBEA 3ZJ5A 1CXZA 1T4DA 3CXUA 4HTFB 1U3CA 4L8WB 4UMEA 4DR1I 2IV7A 4CKEB 4PZLA 1G5PA 1H0HA 1ZICA 1UOQA 3OIFA 4BKUA 1V6SA 5BUQA 1TVEA 2SECE 4G5SA 1DOAA 3HN6A 3QW4B 4V0RA 1FQWA 1DAPA 5DYTA 1IZ7A 4MYDA 1WW2A 2DMRA 5JG7A 1KEVA 1XZBA 2EU8A 2PGJA 3H6HA 2CL7X 3P5BA 4MAAA 3R0VA 3K30A 3V2GA 1XNRB 2XQKA 2O8CA 2Q21A 4DNPA 1C14A 4X64I 2GPYA 3GLIA 2QKYA 4DV6E 3ORYA 4HRVA 4WECA 1E1LA 2MMGA 3AHHA 4UVDA 5IVIA 1VMIA 3GLFA 3O8RA 3JYPA 3N7TA 5FNVF 4ALJA 4BMPB 5A3VA 2Z3VA 1WMFA 3E0QA 4QZVA 4B3SB 1GPH1 3OAAD 4XQCA 1FFEA 4L6AA 1GUYA 4H7KA 3HG7A 4QG3A 2AVDA 1N0WA 3LM8A 3LY8A 2YZKA 4P80A 1U8YA 3RDPA 1A8SA 4MWGA 3A9RA 3PGMA 4Q3AA 3WNCA 1HT3A 4DR1E 2FLKA 3AR7A 3MGGA 5EXTA 4RJJA 4B6OA 4GZ6A 1G60A 4NJOA 1DEKA 4POAA 3O75A 4P9NA 1ORHA 1IBLE 4N5HX 4MCIA 5LBIA 2YHIA 2ZREA 2VRCA 4AMZA 4P34A 4X1YB 3T5BA 2PQ0A 5HNKA 1CZRA 1DBWA 1CHDA 1RE0A 5FFNA 5TJ9A 4YPOA 2XAUA 4ENPA 4CT0A 1QF6A 5HIAA 2O2CA 2DQ4A 4HQRA 4URYR 5K3BA 1M3SA 3TBKA 3KAPA 3S70A 2AE1A 4X6YA 1UMBB 3DBRB 1Z2AA 2O6HA 2R66A 1KVRA 2Z58A 4WVFA 3DZCA 3IDAA 1E6CA 1Y5MA 4LNHA 4RORA 1WKVA 4IIVA 1NBHA 2BF7A 5B1IA 4ALKA 5BUZA 3BWDD 3VKUA 5BV8A 4Z4QA 1JKMA 2NZJA 4XUDA 2Q2EB 1JPVA 5CH8A 5AKGA 2Q8QA 3MJFA 5LXTF 3T9FA 1JEEA 2VJNA 2RC5A 3SEZA 1KZ4A 5BYAA 3EW7A 3W7AA 1UFOA 1VHQA 4F93B 3UGQA 5AVXA 4O0MA 2BGUA 1YHYA 3BA1A 5FI3A 1N8NA 3A04A 3CWQA 3HNPA 3PPWA 5JU6A 3K70D 5FT9A 3W06A 1NXOA 4IFEA 1EK2A 4UDXX 3J81C 4YR9A 4Y2PA 3KOZA 2AZ4A 1MO2A 1H7UA 4ZYZA 1FYXA 4MS4B 5HUQA 4BA1B 2AG1A 2YXLA 3N59A 3ZDXB 4B3TI 4FNMA 2PBLA 3EN0A 5CBKA 1L4FA 1XKQA 4P7GA 2AW5A 2IIQA 2W2MA 5D7NA 4KR6A 4EGCB 1KWKA 2OECA 3WWEA 4U39A 2AC2A 2RIPA 1DEXA 3JTMA 3WOHA 3V8EA 1QMGA 3B9RA 2FCRA 4NE7A 2VJMB 4DUGA 5K5EA 4NQRA 3QLVC 4IJMA 4RADA 5DNXA 4H6PA 4CKEA 1B6SA 4B43A 2P6OA 5EMLA 3O4HA 3U0VA 9MHTA 1VSQA 3TOXA 2PGAA 2JCGA 4KMOA 1XMQE 1E7MA 3GDHA 5SZKB 3ZY5A 2CEKA 2OV3A 2XEDA 2DKFA 3GUUA 4GW3A 4NZPA 2UYOA 3OU7A 4DLLA 2JLYA 1K63A 1N0UA 3T1HE 1ZNWA 2OL4A 1TIPA 2MR5A 3GH1A 4PANA 1A2QA 2YIMA 3K32A 5KAMA 3SHQA 2Z8XA 3I5YA 4IOJA 4LF6I 2HJGA 4M0PA 2IHUA 2V4ZA 4GI5A 1C0KA 4H0FA 4JB8A 3O8QB 4P33A 4YMWA 1UT5A 1JQKA 4BJHB 2BMAA 3GGJA 4BNYA 2EL7A 1Q17A 3IDSA 2UXDB 3PQ2A 1I0ZA 2PZAA 4PGHA 3R7DA 4Q5IA 2X2FA 3DE2X 4G36A 2Q5LA 3A6LA 4RPJA 3FCAA 2WJJA 5AYVA 4DOMA 2FSFA 2NM0A 3BK7A 1F14A 3M7NG 1J9EA 2PA0A 5I01A 4YWHA 2DG2A 3MTEA 3UFBA 4I1PA 2PTGA 4PWYA 4YI5A 4IQ8A 5GIOE 1FUUA 1FVHA 3CEJA 3W2IA 1L3IA 2D2EA 4E3WA 4U2KA 3ZW7A 2C9YA 3WGLA 3VR5H 5B3AA 5A2QQ 3ZZMA 1I51A 1YOVA 2X41A 4WCDA 3SMQA 1CUDA 1ZL2A 1UBMS 3KVOA 4JKIA 2FA9A 1BE6A 5F2EA