2GQ0A

Crystal structure of the middle domain of htpg, the e. coli hsp90
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
256
structure length
256
Chain Sequence
b'AQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTSLLYIPSQAPWDMWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLNVSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDAEKYQTFWQQFGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein htpG
publication title Structural Analysis of E. coli hsp90 reveals dramatic nucleotide-dependent conformational rearrangements.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone, hydrolase
total genus 79
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.6.4.10: Non-chaperonin molecular chaperone ATPase.
pdb deposition date 2006-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2gq0A01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gq0A02
1HK7A 1USVA 1Y4SA 2CG9A 2O1VA 3Q6NA 3Q6MA 2IOQA 2O1WA 2GQ0A 2O1TA 2CGEA 1USUA 5FWKA 2O1UA 1Y4UA 1Y6ZA 3PRYA 2IOPA 3HJCA
chains in the Genus database with same CATH superfamily
4NBLA 1PR0A 2WF6A 2Y1XA 3BGSA 1T4DA 2FZCA 2C3MA 3G9XA 3PDWA 4IF4A 4Q1BA 5ALGA 3PYDA 2WEKA 4HV4A 2DQZA 4K8OA 4IOLA 3UFBA 1IY2A 3OVMA 1H65A 1ZBDA 2NUTB 2BWJA 3DAPA 3FGOA 1DO8A 4OJNA 4D7AA 1W7AA 1SPXA 5FNZA 4JJFA 4MS1B 2YIDA 1QIJA 2WSSD 4OHMA 3UENA 1V9CA 2C99A 1NSFA 2NTVA 3GUCA 4BO1A 1X38A 4DR2B 2LRHA 3C8DA 3PZBA 5TT0A 2YUTA 2O14A 4X6XA 1IBKB 3DO5A 3GPIA 1Q1NA 3BX1A 2V7QA 2W2PA 2WA1A 3GY0A 4IR7A 1GSAA 3VUFA 5C2JB 1I7QB 4BXOA 4S1TA 3OFKA 1GN8A 3WRYC 3JZIA 4ETMA 2Z8XA 4IIHA 1Z22A 2LZ0A 2XB6A 3FYTA 3VU3A 1J8MF 4ALNA 4P7GA 5KS2A 3K6SA 1P5HA 2IHVA 4HNQA 5ER9A 2A4MA 4H7FA 4R0VA 1QCDA 2OHVA 4HYYA 4WUTA 4UNSA 2JLRA 3V4OA 3FSGA 4TTIA 2HLNA 1D0SA 3L41A 3I9KA 5GZ6A 3O0DA 1DMRA 4RW0A 3K0KA 1RZUA 1TJ4A 5DRPA 1TVEA 1YV9A 2GVDC 4RK7A 3DA8A 3VJMA 5JLJA 3L7NA 3PRKE 3T1VA 1GKKA 4LTDA 2HADA 3VR5D 4X61A 4AFNA 1P45A 3H5AA 5H02A 2AI3A 5FHRA 1VE7A 1TPZA 3AVPA 4GUAA 4NBKA 2X5JO 2GYUA 3DL7A 1NQWA 2W2LA 2ZRPA 4PO8A 4LFAE 1QCYA 3HA5A 5CVJA 2G06A 4DMCA 1T3SA 3N2GB 5CFOA 1GVHA 2PX0A 4NYMR 1NBME 2N9UA 4G5FA 3CLSD 4H0FA 5A3VA 5IM5A 3KWJA 3OUUA 2JGDB 1ZVJA 3WWYA 2GAIA 2OV6A 4HQRA 4XEUA 4PCVA 3E5NA 2XMPA 4R2JA 4S05A 3QH4A 5I7EA 1RNLA 2GZMA 2F1KA 2VTKA 5J43A 1GG2A 3IDSA 3MGCA 1OB5A 3ZM7A 2H0RA 4MKZA 3Q7IA 3AETB 3EHEA 1BWRA 1LXCA 3LKVA 3PDUA 4OQNA 5DNCA 1G8MA 1SFRA 4K81B 3TUJC 4D9KA 1MPTA 1PJZA 2XKAA 2C94A 2OUIA 4PYOA 2XDQA 3G13A 2WLTA 1Q15A 4IZKB 1LTKA 3PPIA 5E9AA 2NZVG 4YWJA 4Q66C 1RWKA 2IYNA 2XA9A 2G40A 3CUEF 1POWA 3L7CA 4XA8A 5G0SA 2WSBA 4ZC8A 4KLAA 5DX1A 3E03A 3VPSA 2IPOA 1QF6A 3U4CA 1LRLA 1DZ3A 1U2PA 13PKA 2XQVA 5FOXA 4BMDA 4YV1A 5ALMA 1ANKA 4QDJA 1Y9DA 3LXRA 3H1FA 6AT1A 4OX9Y 3L8ZA 1RMTA 1NUHA 2IF0A 5BP7A 3TL6A 3A28A 1EVQA 1KIAA 1XVAA 3V2GA 1HSOA 3DEZA 3H4TA 5DVZA 3EQ8A 2RHHA 2GARA 3BKXA 3ESRA 4CMEA 4AU1A 1U04A 2UVDA 1NXVA 2RJ3A 1IG0A 2W7TA 2QVYX 4C5AA 1FBTA 4D6PA 4KAJA 1E66A 3G85A 4E5KA 5CFRA 5JZOA 3G23A 1NY5A 3KAPA 5GVRA 4JJ7A 5ALIA 4BE4A 3A0RB 1Q7GA 3LCMA 1UAYA 4Y2QA 3WNBA 3O2JA 4EA9A 2XCIA 4R1PA 4TQ9A 1DAMA 1KWKA 1H05A 3F7MA 3D5EA 3IIEA 1QFYA 3COSA 3TINA 4IH9A 3BMCB 3DEHA 4AN4A 3LQRA 5CRIA 5IJ0A 3LT5A 4JGGA 1QAQA 1L5OA 3BMOB 4MKHA 4MX8A 1LNSA 3RODA 5CB6A 3GLFB 3E70C 4HLUC 1A96A 4ID9A 3O0TA 1AB6A 1EFRA 2BGKA 3GRKA 5CFNA 2CFOA 3GIDA 3IMGA 4YRFA 4C5CA 4EEXA 3S8EA 2JKZA 1SPBS 3AEZA 1E6UA 4RVCA 2WTBA 2OM2A 2P1DA 4C4YA 4EJSB 2I2CA 2QRGA 3B20A 3OPYA 1Z74A 4FB4A 3HBAA 1H74A 3ZWOA 4MV1A 5BNIA 3TQOA 2C57A 3RIMA 1U8ZA 2NO7A 4NDAA 2QZZA 4Q48A 4XIFA 4JWKA 2FWBA 1G0NA 2JVIA 3DDZX 2GCEA 1MD9A 3K9HA 1YSCA 3O90A 3WRVA 4CMGA 2NP7A 5A9SA 4LI3X 3TLYA 4HFJA 4OB6A 4XXHA 5GMOA 1TKRA 3N8GA 5TMEA 1J5EB 3H42B 2Y93A 1QHHB 2NVBA 1JFLA 2AGVA 2XWPA 3KR0A 5K8JB 3PEWA 3ZHUA 5K6AA 1LY1A 4BZQA 4J0KA 2HGZA 3NHPA 4UM9D 1V7ZA 2ZQ5A 3QU9A 3L4JA 3KZ1E 4UTVA 4JI4E 3L8YA 4N18A 4L7QA 2BMFA 3E7XA 5D00A 4YY3E 3FZNA 3OCUA 4B79A 2VA9A 1RWVA 3VR4H 5LMUB 4FFVA 2IW3A 1E92A 3FDZA 4WDQA 3WGGA 1V1MB 2V7BA 4BV3A 3NGXA 1NAIA 3ETEA 2HT6A 1BMFA 2ASVA 2BP7B 2X86A 1V9LA 3K5HA 2ZRQA 3Q40A 4PXYA 2QN8A 4U8HA 1C7RA 1JHXA 1R0WA 2RGYA 2YX1A 5LWHA 3UPTA 4TZKA 3PLNA 1JDSA 4M22A 4BNIA 1ECGA 1OI7A 4BZPA 2AW5A 2Q62A 1ZW6A 2BRUA 5ALXA 1ZA1A 3R76A 4BNNA 4PHCA 4E5UA 3VH2A 3HBMA 5JJLA 2GA8A 2YTZA 3T3EA 5JAIA 1WSAA 1HR0E 4HQ0A 3R4CA 1G3UA 5AJTA 3ZXUB 4B48A 1YC5A 3MEQA 3T34A 1VL1A 5LB2A 3LX4A 1GPJA 2Z4SA 5DJ5A 1BRTA 3T38A 5JS8A 3A4VA 3I4CA 5CP8A 1PTJA 4GL2A 3ONWA 4JC8A 1ST2A 3PNVA 4JYAE 3ZIUA 2CZCA 2PPLA 2QNRA 4C4PA 2ZYIA 5ICSA 4LDAA 3ILSA 1ZN9A 2V7TA 1YS7A 3QVTA 4UW9A 5DEOA 1RWXA 2RE8A 1GZ6A 3LAWA 2PMEA 3SKYA 2WM2A 1QU2A 1X7XA 3CRQA 3FPCA 1JLLA 4REOA 5KU7A 2O8VA 2ZI7A 1G4AE 2G63A 2WWTA 3NMUF 3DBIA 5CJPA 4JQYA 3SICE 5IJWA 2OTCA 1KJIA 3KBBA 1X7WB 1FMFA 4RHCA 1TCAA 5JXHA 1QV9A 2V03A 3QGMA 4DIBA 1OC2A 1T6ZA 4TLAA 1KYXA 3OKFA 3ZQ6A 3EQ9A 1RWPA 4KPEC 3MWLA 1KMQA 3OQ6A 3QUTA 4FSHA 1O2DA 4YUYA 1PLJA 3KVVA 5FR1A 3ZDYB 2FYTA 2I3GA 2P11A 2WNIA 4ERNA 4E88A 3AEYA 4LBVA 4UTRA 2O8EB 1UFQA 2IPMA 2EJCA 4G85A 2XBMA 3HCAA 3K8YA 5ADUS 3MWJA 4KQGA 2G83A 2FQ1A 1ZXMA 4JI2B 1BEUB 3P9XA 2JCBA 4XJTA 1ZIYA 3ZKAA 3ZGZA 1GRQA 4W1QA 1R6UA 2V8OA 4RK5A 1EPUA 3PC3A 5EIFA 3MN1A 2GVZC 5AK5A 2DZDA 5CT9A 2E5LE 2JEBA 2VT3A 3BB3A 4DC0A 1P0CA 1EFVA 1VLHA 2PIDA 3AR3A 3UV6A 1SB9A 3AYXB 4J6EA 4GE0A 1ZXNA 1JR3D 221PA 1DKQA 2FWNA 2F3UA 1N9GA 3JR7A 4JUDX 4KRYA 4H18A 2HJGA 3MQ4A 2VT2A 2GBCA 1IXRC 2QE7A 1G2IA 4KQFA 4FEYA 3VTAA 3VYWA 1SCQA 3D6VA 1M6WA 4F45A 3WR5A 4BNLA 4POAA 2KWIA 4IHQA 5EVCA 1VYVA 1KYTA 5F76A 3STUA 3FTEA 4AZ3B 2A35A 2J48A 3HO8A 5I9NA 3C45A 5B7PA 3QNWA 4PQGA 2G1KA 3RS4A 2H1VA 2PX3A 2PYDA 2V65A 3ZBUA 3L02A 4C2TA 2V5VA 2XKBA 4BTVA 3ZD7A 1PKEA 1JAIA 1U5CA 4G41A 4HDNA 4EVRA 1BCSB 4QTUB 1CUGA 1KY3A 3KYCA 4RABA 4XDYA 4U8GA 4YLYA 3PX7A 1U3VA 4RTMA 3CLRC 4DR1I 4MW1A 3HJHA 4DV1I 1C7IA 1KMNA 1U2GC 3LS2A 3PT9A 5AI5A 4OATA 1KH3A 2PGXA 3EARA 1D2NA 4IY1A 4FBGA 1KFBB 2XITA 3O75A 4KX3A 4PG6A 1KMHA 4R8LA 1ZI8A 4LV8B 1RQ7A 5DSTA 3BAFA 2ACWA 1S2LA 4GLJA 4DR6E 1LBQA 2I0FA 4PN3A 1FB5A 1L7RA 3O3NB 3QKSB 1BFKA 2WYVA 3A26A 2G88A 4I4IA 5BW8A 2EJVA 4EABA 1TQ6A 2V6BA 1J0EA 1NRWA 4XQGA 2GJKA 3ZZ0A 2DEJA 3AY7A 4DIMA 1AKEA 2IKQA 1ML3A 1TO1E 1KJWA 3A1NA 1I3LA 1NBAA 4MIYA 4RM3A 4KNYA 5IFKA 4CZ2A 4YIKA 1H8EA 2XMSA 2H1HA 4FBLA 4YDHB 1EFHA 1NBMD 4E6EA 1DC7A 1KC1A 1T6NA 1MCZA 1V11A 4I1OA 3ERCA 3GT3A 1H1LB 2X8BA 3BIFA 2VCYA 2VUIB 3IQZA 2PZKA 4R8VA 1KZ9A 4ZT6A 1A5SB 4WIAA 3STXA 3WDMA 2XXAB 1L7MA 4P98A 2BD0A 5HTKA 4ETNA 1DCTA 4HAYA 1EEXB 1QORA 4XD2A 2C39A 1U9IC 2NU6B 2HKEA 2G77B 3K0HA 4Y9DA 3WDSA 3U3RA 4RU1A 2QMQA 1YRQA 2MSWA 5AW2A 4KH1A 3BBPA 4YN3A 5TS2A 4JEMA 4ENTA 5KNDH 2AOUA 2Y1GA 2JG3A 1XIVA 3SYNA 4B8WA 2VQEE 1J21A 2M6RA 4G0NA 2JKVA 2H65A 4X66E 2TMGA 2QDXA 3ASUA 5CYGA 4FGSA 3V7WA 1IHXA 2WJPA 2XTNA 1PFKA 5FO1A 4CYMA 1AOXA 3VR2A 2XE7A 1ADYA 3W77A 3FNQA 1Z18A 3HB4X 1G98A 5C0XC 3NGMA 4RZXA 1KAEA 4XVQA 3SE0A 3PX2A 5BV0A 5FV4A 1ZZEA 4WAUA 1NN5A 2ODNA 3H2IA 3ZWVA 4DJ5X 3RUEA 2HNKA 2OT3B 2IZ1A 4BJ6A 2QN9A 1NJGA 2FAXA 3JQ8B 3UXHA 3M6LA 1FYEA 2QR3A 4CUKA 4RE6A 5DN6A 2A2CA 2XTAA 3MVEA 4COKA 4I46A 4DXHA 3A70A 5G1OA 4NWIA 1W0JD 3IPXA 4PGAA 4EG8A 5JZVA 5JMOA 1N32B 4P0PB 1N2XA 2VUHB 3TRIA 2UAGA 5KQLA 4NE9A 4FDAA 4UZFA 3MT7A 1NHIA 1Z0GA 2J41A 3E3NA 2ZRBA 4CJXA 5CXUA 2EWVA 2DRIA 3F7OA 2WYHA 2YR0A 3KZNA 4GKVA 3RS8A 4MQYA 4D3DA 4P52A 1EAMA 3LK6A 3KNZA 4NG4A 3IQEA 4RX1A 4YNBA 3F4KA 4KOEC 4TROA 1R4NB 4OHOA 2YYZA 3N5CA 4I55A 4D0NA 1I24A 1PQYA 5CJ2A 1SHTX 2WU4A 3FNBA 5IVDA 1TJ5A 4FYWA 4TZTA 1KFJB 3HU1A 3B51X 1AN9A 1EVEA 4Q02A 4LE2A 3ROFA 2BF7A 3GHHA 3HB9A 4A9AA 3UH1A 1PT9A 1Z5BA 2H59A 3FHTA 1P1HA 3I73A 1F06A 4E2WA 3UHPA 1RAHA 3LD9A 1D6SA 4J0EA 3PXGA 2FZLA 1JN0A 1ZRSA 5JQWA 1SKUA 1RABA 1MPXA 5THQA 2CUTA 2GLUA 5EJFA 5REQB 2Q2WA 3D8SA 5ADVA 4BBJA 5GJCA 5LMNE 1TQ8A 5DU2A 4WN3A 3F2VA 4FW9A 3GXOA 3L6CA 2G9UA 3R9KA 2ZYGA 3SWWA 1NBOA 2PANA 1GFWA 2AL7A 2PWPA 4FKZA 3STHA 3WSVA 2VA8A 3UXYA 3AQ4A 1WD5A 2QW1A 3DBLB 3ESZA 3S1SA 4KR6A 3ML1A 4CLOA 4MQ4A 2J0QA 1DAGA 4P3KA 1RBMA 4ALIA 3DLBA 3ZCVA 1GKIA 1SZJG 1DELA 2VZ9A 3O4GA 1GCAA 3EGIA 3ST7A 3WZMA 4E7OA 3ZHVA 4Z53A 3DEIA 1ADFA 1QR2A 2C31A 2JI6A 2XNKA 4WECA 1D2RA 4Q5IA 2QJTA 4K9KA 1XSEA 1IHOA 2ISQA 2CFSA 5EKSA 1H66A 1KDOA 3THOA 5FR2A 1I6KA 5FUYA 4HUTA 4EDHA 1JH9A 3BQNB 3DV9A 4J3JA 3DL2A 3TRHA 2Q07A 4KQEA 1F6BA 3Q15C 1GAWA 1UK8A 2BC9A 4I5IA 3G2JA 1SD5A 3L7ZA 4PAOA 1GWNA 1UDCA 1XEWY 3BE4A 4GEGA 5D1HA 3EF1A 4AIRA 4IIVA 5BVHA 4NV1A 1CVRA 4M1EA 1MU5A 2PKEA 1KAMA 2VHXA 1JPJA 4BEVA 4PSCA 1IY8A 5CITA 1YI1A 2PHZA 1Z75A 1U6JA 4HWKA 4YONB 3U7IA 4DWVA 4F2PA 5KQMA 3T4EA 4ARIA 1FLVA 1I32A 4FR2A 4TQGA 1FTQA 3SEZA 1JBEA 4Y67A 4BUZA 1P62B 3QM1A 1XXHB 2W6OA 1VIYA 1UBOS 2B94A 3IV7A 1FC0A 1G1MA 1TYEB 4R9NA 1D6MA 1LUAA 4CMEC 3IBSA 3PV0A 1N6PA 5CYPA 1W76A 3T9EA 4AZWA 4LTMA 3GVCA 4WEQA 5GGXA 3RRMA 4K0KI 1BE1A 1DEHA 1US8B 2HA6A 3IAS6 4KXQA 1YJCA 2EBFX 4Q9IA 3KS9A 4N3CA 5GV8A 2UUBI 2CXQA 1WDLA 1RD4A 3BF7A 3NIGB 5I3CA 1LNQA 4ESEA 1QK4A 4JBNA 4O8CA 5M3BA 4X5OA 2XGGA 3UWKA 1D6NA 1QYRA 4QFBA 3ZBPA 4EA7A 2N1BA 2B5VA 2OHXA 2OFPA 1L1FA 5D3ZA 4YEDA 3OZCA 1QK5A 2ZDQA 3BRWD 3OCYA 4B3MB 3D54D 1KYZA 2RIPA 2Y77A 4P4GA 5JS2A 3D0QA 3P8ZA 1YQGA 5LBUA 2FPIA 2FKNA 4H1HA 2Z5CA 2R7AA 4LRTB 2R6CA 1JQ3A 3P3CA 1TCCA 1UJCA 2VDWB 3BREA 5DI3B 2P68A 1DFHA 1LLCA 2IVZA 1E3LA 3DHEA 1NU8A 3FCEA 4CN8A 1X7ZA 2JRCA 2H8GA 4TXMA 3VVMA 1ZX1A 2IDZA 4NZ9A 4ENVA 4MUBA 1PL7A 3H87A 2L17A 4MGEA 2GS8A 1BVUA 1CEQA 2J9GA 4R5MA 3JVUA 5TVGA 4EKDA 3L06A 5DDIP 3RJZA 4DYVA 5EHNA 2NGRA 3GXBA 4MAMA 3IOCA 1MZVA 4XPIB 3A0UA 2BEVB 2G1PA 1FRNA 1DO0A 1H42A 4PONA 1P1KA 3MAJA 3WWDA 3TRJA 3LTOA 1UOPA 2WMDA 3PT5A 4PVCA 2NSHA 3LHIA 3RVSA 2NVWA 3H9UA 3O38A 4MOWA 3D5QA 5FPYA 3DDOA 5K6AC 1XGKA 1C9JA 1LV7A 3C2QA 1F60A 4OI0A 5BUQA 1KI3A 4HFRA 4Q4AA 1RHRA 2J7PD 3C3PA 2P27A 3O1JC 4NE2A 1OVGA 4LCBA 2Z2JA 3HP7A 4QULA 4GMDA 2RGGA 4U00A 1GJRA 3WLOA 4ARSA 4OO3A 3BOSA 1M2WA 3PL1A 3HP4A 4HH0A 3SOPA 3USES 4BV8A 3UYKA 2G28A 3ZV5A 4DR3B 2Y1OA 1K66A 5LP6B 1Q22A 5C0XF 4R1OA 3S2IA 3RVMA 1IRXA 1X14A 4YUAA 3WU6A 4D3FA 1EWQA 2Q27A 1LLUA 1ZWLA 3RVQA 2XVYA 1MRZA 1JDBC 2FJ0A 3EQ7A 5HILA 4LRQA 3RFFA 2AXPA 4R8MA 4HDQB 5FBKA 1GZVA 5TGTA 4LF9B 2BRUC 1N2JA 3N58A 1LK0A 3RWBA 5BNFA 1YR1A 2Q5JA 1ND5A 4JI5I 2XUDA 1K6MA 1SUCA 5ALKA 3S8MA 2K2WA 1YRAA 4KLNA 4YP5A 5LM3A 3SLKA 2YYYA 1Z45A 4QDTA 3SE7A 3I04M 1E6EA 2C38A 4EHBA 2X36A 2D1QA 4HNUA 3N1UA 4QBFA 5T3YA 3M6WA 4PLYA 5CVUA 1XCOA 1WXWA 2VQDA 2VHUA 3RBZA 3V7NA 2IOFK 3VYSB 3WADA 4EFLA 4YAJA 1DRWA 3HKEA 4BFYA 2OFFA 2GO3A 2FWRA 1A9OA 5T4FA 5KMGA 1M8JA 3EDCA 2EVWX 2IF2A 1YB4A 2MU1A 2OHOA 3BL8A 3K20A 1PSWA 5FBVB 5KNBH 1UP4A 1EUZA 1TZBA 4B7AA 4CR8A 1Z0KA 4R5HA 3FWNA 3BERA 4MHOA 1V7CA 2FH5B 5J1TB 2Y9PB 3IT3A 3OIFA 4C0XA 5CD9A 5ITZA 4DPWA 3L6RA 3I01M 1SQ6A 5ALEA 4G4GA 2WJIA 1VSUA 1GYRA 1U9YA 1BXZA 3DGFC 3CW8X 2GHQA 2ZUDA 2C1EA 4G8CA 2B2CA 4OA8A 4X41A 3R8XA 2P5UA 2QTCA 1E5VA 4FE4A 4Y0AA 1K6IA 3ZVKA 2XZDA 1PGOA 4EEKA 5IXSA 1XVLA 2AFRA 3JQGA 4YLEA 1NQVA 4FFWA 5K3SA 4DPLA 1LC0A 2KX7A 2CL7X 5JI2E 2GEFA 4IG9A 2C5EA 1M6VA 2YXDA 3R0IA 3UB2A 1F0NA 1NWHA 2J59A 2QUBA 2R8XA 4HGPA 4MNTA 1WSDA 4FW4A 3DV2A 5K0LA 2I2XB 3FF1A 2P9HA 3EGCA 4AUMA 1GL3A 1WTCA 3LIPA 4RV5A 4CTKA 5JQGA 1Z0AA 3Q0TA 5C1DA 1SUSA 3L7AA 2EJBA 3NWOA 1JAZA 2GBGA 2J3IA 5E3JA 2AOWA 3ONNA 3W6OA 4DV3B 3SQXA 5IS2A 4NXNE 5IXJA 2CCGA 3AUSA 4UD2A 4DU7A 1JHOA 3NNSA 4HCJA 4NV3A 5FTWA 1SCAA 4K6CA 5LCXA 5BV7A 2HHHB 1KAHA 5HF9A 1EVYA 2J0EA 1FSZA 4DZRA 1S89A 1MFPA 5HHTA 1T43A 2V74B 3HDVA 3Q8XB 5G3ZA 2YXPX 1DG1G 3UWDA 4JLBA 4Q82A 5AQEA 4CM5A 1Q77A 3FR7A 2IHNA 5JMTA 4JJIA 2BBWA 3ZBQA 1MJGM 3W2FA 3C3JA 2X40A 2JA2A 4E09A 3GCXA 4GKKI 2EATA 5HIKA 4EG4A 2I99A 4DXAA 1EFKA 3L84A 1TTHA 1QFXA 2HRRA 2OGZA 3GNQA 4A82A 3MERA 2ZAYA 5AKZA 5DLQC 3TCKA 4EA8A 4EGFA 3GPBA 1ULSA 4OMUA 4QFDA 4C7MA 3R6GA 2FX2A 9LDBA 4C01A 2X8AA 2FR0A 3FD8A 4UM8B 3CIOA 4D8YA 1KGDA 1KI2A 2XSZA 3Q6IA 5A7HA 1N36B 1JHPA 2XGOA 4B3CA 4KXXA 4P81A 3TR0A 3ZUPA 2IX3A 3T1HB 1BA3A 3ZJVA 3Q41A 4V0NA 5ALUA 4I08A 2P0AA 4BS9A 3ZDXB 4JZYA 3CSUA 3E2IA 3GEHA 4LBYA 4WCFB 5EZ6B 1SKQA 4HRVA 1P8JA 3IHTA 4O2AA 5C80A 4PLGA 1RKUA 2DC1A 4XX0A 2RBGA 3OSZA 3MMPA 3U40A 3PXBA 1GL9B 1N2CB 3O3OB 2WD9A 5GPBA 4Z3DA 4MVJA 4J76A 5TMPA 2WWHA 4MGIR 2AZXA 1NKVA 2LIPA 1JYSA 2OLKA 3JQEA 2C37B 2I1VB 3KXLA 4B3SB 5I51A 1C41A 5LPNA 1FSFA 1Q92A 4RWZA 1DOZA 1O77A 3OD1A 3JSXA 3BD6A 2CJWA 4J4HA 3C41J 4JIMA 2DR2A 1UMDA 4RPGA 1SQ0A 3EZFA 3OP4A 4K9SA 3QUBA 4AIDA 4FONA 3O8CA 3KTFA 1KBOA 1XEFA 5AK3A 5KCMA 3VR6A 1V6SA 4IFIA 1JYEA 2V7PA 3GFGA 1JPUA 2HK3A 5AKKA 1CETA 3C4JA 1GCGA 1S2MA 5KEIA 2DH5A 5EE0A 4BCDA 4FZ5A 5H0IA 1DKUA 4X85A 1EGAA 2VYVA 1MQ9A 4JV5B 4HATA 1H2WA 1F7VA 4B4VA 2Y1DA 1Z8HA 3MJDA 1PZEA 2QTBA 4S2UA 1EINA 3FVVA 3LA8A 5H3CA 4YXWA 3AY0A 5DM60 3EJ6A 4L4XA 1T6XA 2ZJ6A 3A6FA 4N49A 3FMPB 5C1BA 1PJBA 1D9ZA 5K6TA 5AVZA 2HBQA 5K4AA 1PZXA 4RMGA 4X64B 1YRLA 1T36A 2Y71A 1DJLA 4F2HA 3ZLBA 5KYWB 5CBPB 2DHDA 1B8VA 1WZIA 2HZBA 3L8MA 3MWEA 4S12A 1WZCA 3LYLA 2ZSJA 2C2XA 3PE4A 4QPZA 4KRFA 1GTRA 1YS9A 1HOTA 2OXFA 2GN1A 2GX6A 5LNK6 1P33A 4TRJA 2ZJYA 3T9AA 3NBFA 3CVYA 2XEXA 3GOHA 1IJEA 5ECYA 3LM8A 3V4SA 3T1YE 4UKDA 1BIFA 1DIAA 2AZTA 3B1WA 5AK0A 4Q1VA 1YMVA 1K4KA 3BJMA 5B4VA 4I9UA 1KVQA 2DPXA 2CZ9A 3VNAA 1C9DB 3L05A 1A9PA 2MSNA 4MGYR 5BNTA 2XNHA 1BMQA 4LJ8A 2QP3A 3SHOA 3F6YA 4FW3A 3D6UA 3SQLA 2PGIA 3OG9A 4M1YA 1XCGB 3GLHB 1EZ1A 3GLKA 3VI4B 3FTFA 5IU6A 2PD6A 3B2QA 2MYTA 3BG5A 2YIMA 4FWBA 1XHKA 4RTPA 3H99A 3QQPA 1QQ7A 4FSDA 3RC7A 2HU8A 2B6HA 3CXRA 3P19A 3RYIB 1QU3A 4GXRA 3QT8A 4JJAA 3K2IA 1KPIA 5AT1A 3UQYS 1YB7A 3ZWXA 4LKOA 4XRGA 1WG8A 5BT8A 1E5LA 3VZPA 2OV1A 1YKFA 3DE0X 4J0DA 4A8JB 1JFRA 1A8QA 4UOEA 1SCIA 2VAWA 3A6PC 2DLDA 4JI1B 2JIDA 1L4YA 1DJQA 1MABB 1CUEA 2JCSA 2NTYC 2VP6A 5LU8A 1ZHHA 4GI1A 4M88A 7AT1A 2WKPA 3VYTB 2DQSA 2XVAA 2PZJA 5LDDC 4FMDB 2PS9A 3O74A 4L22A 2ZPTX 2WTMA 3BXEA 4IUBS 4WLVA 1VCHA 1JRLA 4GOXA 4CCWA 1VYHA 2RI6A 4QPJC 1LPSA 4E33A 3G49A 1J6UA 3DVQX 1ZD1A 3R6WA 4M54A 4PAMA 2ZK7A 3GR6A 3FI0A 2WP0A 4Q47A 2ZBQA 1G21E 3LX8A 1GU1A 1HE3A 3A9WA 1VXRA 1GV1A 4CV3A 5C8DA 4DRZA 4RMNA 3QKIA 5T41A 3QVGB 4DAOA 1RRVA 1W29A 4C7JA 1IXKA 3OURA 3MIIA 4ZZ3A 1BVYF 4LOIA 3EYWA 1DTWB 4CQMD 1QE0A 2JCXA 2WJHA 3HXQA 3ZNPA 3R09A 2PUCA 2GCGA 3PUVA 4Z7OB 1K98A 2AX3A 3L7YA 3KPWA 5IKMA 3D1VA 1BS2A 3LQ1A 2ZT7A 2HOQA 1BWSA 2I6UA 3G5TA 4XASA 5DNDA 5MN5A 1EFCA 1TKBA 2PKQO 2PMFA 2QSJA 4WQMA 1C0PA 4TTPA 2CLHB 2EG9A 1TM2A 1C3EA 5AUQA 3RU3A 3WK4A 1QH8A 1Z36A 1M74A 4FFNA 1XZNA 3BMNA 1H5NA 3ITDA 2JH8A 4Z9AA 2W2TA 3ZH2A 2C7OA 1VKJA 3COVA 1K27A 2FWJA 3RS3A 4BX3A 2P5YA 1T5OA 3TK1A 4X65I 1JKMA 3F3YA 2OCXA 2QPOA 2WHPA 3A9SA 3TEMA 2I4OA 1QP0A 4OAQA 1PGQA 3OJLA 1NNI1 2VFAA 3KDSE 3KYDA 3RU7A 1XKQA 4ZVVA 1ZESA 1HDGO 2PO7A 2QXTA 2A92A 2BFBA 3WV5A 1W8IA 4XVRA 3WVNA 4KZPA 1V5GA 3BM5A 4R3NA 5B12A 1UK9A 3I5UA 4WERA 4DUGD 5C7LO 2PU7A 2Q1SA 5DW0A 5CEEA 4RTRA 2W6QA 3QHQA 2IYEA 4HXFB 1NDHA 4ISBA 1LBEA 5C0XE 3WHLA 3PNQA 4RBNA 1PAUA 4HXGA 5IH7A 3K2QA 4ZVTA 1PUIA 4PAWA 1SVIA 2NQ2C 1EXDA 3KL4A 4IX1A 2H2FA 3SC2B 1ZI6A 3AO0B 1YDFA 4A5SA 4MVCA 3IUBA 3TQTA 4BMPB 3JAMA 3N6XA 4QOEA 1PNVA 1BROA 2AMFA 4D57A 1QIIA 2W8BB 2Z5GA 4ZAVA 1ILEA 1EWVA 1YS2X 2I8AA 3I9LA 3ZVRA 4D2IA 4EB3A 4NYIR 1ZAYA 3ZIAA 3ZU2A 2ZULA 3AFHA 1MRNA 4MW5A 4O4IA 3EIHA 1ZUNB 3JW8A 4YV7A 3TR6A 4GX5A 2NZXA 3CNOA 1TKAA 2AWOA 2J5BA 5K0CA 4DLNA 1PP4A 2P6UA 3IP7A 4HWPA 3Q9NA 1LRKA 3G6WA 3UMCA 1ECCA 4ZYUA 2ZT5A 3STVA 4G9GA 2J33A 5DROA 2SKEA 4NBQA 4US0R 1XLWA 1A8SA 3U7RA 2QW0X 4UNRA 5C7IO 2O0JA 4EW3A 1NP6A 1OI2A 4D6XA 2HK9A 1AO3A 4J0JA 1H8HD 3REQB 3QEMA 2F1RA 2Z5EA 4ZEWA 5JADA 5F4BA 5LD2B 4ABTA 2CNWA 3VXKA 4Y6QA 2JATA 1AGYA 3TLAA 2AUMA 2AE1A 1USWA 1QJCA 3ZR4B 4MTLA 5ALFA 2AE8A 2IEIA 4EB0A 1EB8A 3COZA 1MV5A 1KR5A 4JI3B 1DUIA 2HA3A 3C8HA 3TDMA 3D2BA 4EA6A 2BGWA 3UHFA 3OJXA 1CRPA 1ZQ9A 1BVHA 3PEYA 3UJNA 4P5PA 1E5TA 2BUBA 4RA6A 1HNXE 1CBUA 4E5VA 5SICE 1C7JA 4G97A 2CFRA 2IEDA 2NU8B 2RHDA 3B1XA 1FDIA 5FA6A 1U8UA 2WIJA 1N4DA 1V8BA 1M2NA 4KGXA 3ZGNA 3BWVA 1E4EB 3TNLA 4CLEA 3IP9A 3W3AA 1HXHA 1BDHA 1D4OA 2NUPB 2C0QA 3DYBA 3B9RA 2E4ZA 3C85A 1XNGA 2OBLA 3P2KA 4NMHA 3C1AA 2IRWA 3HA7A 4Y8VA 4U2EA 4QD3A 1ZH2A 3WHPA 1Z2PX 5B3JA 1II9A 1QYVA 1NPYA 2YHAA 2A5YB 1WO8A 3NONA 1OY1A 2PL3A 3QLUA 4IMPA 4MA5A 5CK5A 5I01A 4M4SA 4KE7A 4NZZA 521PA 2DHCA 1BCRB 2IPAB 3N3BC 5A71A 4TTVA 3HLKA 1SUDA 4V24A 3CA8A 1T4GA 4Q15A 4DU8A 2PEYA 4U2FA 3TR5A 4BGUA 4XYMA 1Q17A 1UWLA 1A9QA 3AHIA 2CVEA 1QNLA 1KI1A 3NUQA 1G5TA 3PYEA 2XA1A 1OZGA 3MQ2A 2I55A 4B6FA 4MW0A 1OF1A 1UFRA 2ZYVX 4I6EA 3TSZA 1J1UA 3R3JA 2GZHA 3QOFA 1O54A 5I4IA 2P3OA 2YV1A 1KDTA 4FW7A 4IWNA 4YBRA 4QYTA 4JI8E 2B5WA 4CLRA 2H06A 4LF5B 1ZMRA 3DVAB 3LP5A 4FUTA 4JQOA 4LK3A 3JYLA 3OU7A 5TQJA 4DR3I 1EFUA 2LD4A 4DNOA 1FJ2A 3LTEA 3TD6A 1U4OA 3IQWA 4RJLA 2NQTA 4DPKA 2C7BA 4LYHA 4YQZA 1BKSB 5BRNA 2O7QA 4D02A 3RRNA 4FGWA 2OP0A 3DTVA 5FIUA 2PUWA 2BR2B 1EM8B 1M54A 5JSZB 2V1UA 2VPWA 1EEHA 1J25A 3LCVB 1KI4A 2PCLA 1U7PA 1EVKA 4EMTA 2ZBGA 2WTXA 2VHVA 3Q7PA 4KJXA 3AJDA 5I3ZA 2G82A 3FMVA 1Q5PA 2DHRA 1XEWX 3UB4A 4AP6A 3TGLA 3THXA 2WV9A 3N7AA 4G2TA 4QQKA 4TXLA 1F2VA 3HJGA 3AW8A 3ENQA 1V2HE 2BZSA 3ZHYA 3E81A 2E1RA 4ZVLA 4CEIA 4G0VA 2HA2A 4MUIA 3H7IA 4I4NA 3OQBA 4EHDA 1Y1RA 5EMNA 1BSVA 1U3DA 3V8NA 3I5XA 2WZBA 2P6MA 5FI3A 4IDBA 3WB0A 2IPNA 3P94A 5DXJA 4ZKEA 1DARA 1XNQE 4CM9D 2GBLC 4MQ5A 1TE2A 1X70A 4WEOA 1JBQA 2RGDA 3CB4A 3DVRX 4IDHA 1RQRA 5CBKA 3WDKA 1X42A 1AV7A 1M1UA 3EXEB 3I76A 5EXXA 1W4CA 1S2OA 4M46A 5SV2A 1U7TA 3P27A 2OECA 4OO1D 2FP4B 2GNPA 4GP9A 3SXPA 2A1TS 1OFHA 3EXIB 5F98A 2FPRA 4BNXA 3QQ5A 1E1RA 3TPZA 1M2VA 2Y76A 1JJVA 4BIIA 4EDFA 3VX3A 2NPIA 1BXRA 4RQBA 4CM7A 5KPJA 1U31A 1CUVA 1ND6A 3GEMA 4LXUA 4PTZA 1WUUA 5GY7A 2QX8A 1SOWA 5J3JA 3K16A 4LYGA 4DWOA 4FDMA 5KZMB 1TB4A 1BHO1 2FPUA 1LI4A 4DA6A 2JIZA 2ZTMA 3HV2A 3CZAA 2VQSA 4FLFA 4ESVA 1QG0A 4B6GA 4LNHA 5FOUA 3M3PA 1YMUA 3PDCA 3ZVNA 1TK2A 1F3OA 4ZAWA 3Q0EA 4EH1A 1OLUA 2PNFA 4IIUA 4ROTA 3OKPA 4URLA 2WUEA 2VP0A 2QR5A 2A67A 3TGWA 1SCDA 3VDQA 2QRLA 2WT9A 2I7DA 1PDVA 1PL0A 1QCCA 2NUAA 2X14A 5L7WA 3CLRD 1OBOA 1RIIA 1DCKA 1P0IA 1R5OA 1U0OC 2XMGA 3DFFA 5CM8B 4NH4A 5DW3A 3CRZA 2Z9BA 3E9RA 4BECA 3O2SB 2HDWA 4O6VA 4MUAA 3LKDA 1P6XA 4H7IA 5JALA 3LOPA 5C3UA 1QGUB 3KTDA 4FS3A 2CDRA 3LL4A 4U3BA 3EZXA 3WJ7A 1O0BA 4CL2A 1RZRD 1B93A 5JARA 4YYEA 2GA9A 4JI0B 3I9OA 2M2IA 3IKVA 1GTVA 5BO5A 4BQEA 4R1SA 4XLZA 3IKMB 4M7WA 4YDRA 4KQ6A 1SUEA 5LWQA 3M7IA 5CD1A 1SG0A 4GX0A 3ZI7A 1QRRA 1N36I 4XE5A 4HVLA 1PR1A 2F59A 3MJCA 3DD6A 1S3GA 1PEKE 4R2IA 4I0WB 4ZMBA 3K70B 5LZ4A 1RXUA 3BGOS 4J1SA 2AQ8A 1A9ZA 1EP3B 3WNDA 3C6XA 5BOSB 3AFIA 3AZQA 3R20A 5EIHA 1MB4A 3IVAA 2ZUUA 4X0EA 5GONA 5IAEA 1AX9A 4IHJA 4B87A 3PWTA 1EBUA 3BC1A 1GGJA 4LFAI 1KFKB 1HT1E 2XMDA 4G4SP 2ZBFA 3KDAA 4AECA 3ZDCA 2XV1A 1PLLA 3PF8A 3FOWA 2DLCX 4B3SI 3DVLA 2O59A 1FSPA 1XEXB 2JLVA 1RXEA 5ICGA 3KRNA 1VHDA 4KI0A 2QROA 2IUYA 1FP1D 4HI0E 4KQKA 2VVTA 3EA4A 2C4VA 2HSDA 2VHQA 3EEOA 3VDNB 3K32A 3EZ7A 3IHWA 3R9WA 3AOEA 2P69A 5GOZA 1H3FA 4GD3Q 4OHKA 5EZ5A 3JQRA 5C0XD 1EX6A 2VP4A 3H5OA 4N3GA 1AGRA 2AMJA 2RONA 3A6DA 4H3VA 4JUBA 5FWAA 1CTQA 3ZIDA 5DLPA 4WD3A 2CK3A 2R44A 3EMBA 2X7IA 1JE1A 4B6EA 4ARZB 4YAGA 4DV7B 4J6FA 2EP7A 2DB3A 2WJGA 3ILYA 4YJGB 1KZ7B 1N2BA 4AI6A 1UBRS 3EVAA 1NI4A 1HWYA 3BRCA 4YP7A 4IILA 3X1DA 3X2EA 3H9EO 4WW0A 1MZPA 3KKNA 5CNIA 5C8YA 1VOTA 2PN1A 1Q6YA 4MRRA 5FF9A 2PL1A 2QRQA 3OFNA 3O8QA 1REQB 3VHQA 3ZS8A 4GWGA 1GFZA 4ZXPA 2Z5FA 4WGGA 4HRYA 3KQMA 3SAJA 3J80C 1Y5LA 5HQTA 5LA6B 4Z9FA 2PR2A 1G3RA 4JI6B 4FFDA 5E6UA 2PUDA 1L4FA 5JG7A 5HZHA 1FLDA 2V7QD 3KALA 3TNJA 5DYWA 3N0RA 3FYUB 4G1FA 1GL6A 1G3MA 3JV7A 4RXUA 4ZCPA 3MJVA 5SYMA 5C4IA 1FI4A 3N39C 4GR5A 5E38A 5EQDA 5JQGF 3MFYA 3CEMA 3VU9B 4B2YA 4NCJA 4Q0MA 4HFMA 1NW3A 3V6MA 5JRDS 2H8KA 3AF2A 2HJWA 2XGSA 4V0SA 4TTRA 2PLNA 2Q6KA 4IDAA 2DECA 3WYDA 4ATNA 4BVFA 2GASA 2GNOA 3NYQA 5AMXA 1SVKA 1W1UA 5HOEA 3L8GA 1XP5A 3HKBA 4ND7A 4OHPA 1VLQA 2FMHA 1NVXQ 3IUPA 3Q5DA 4FD3A 4JT2A 5DBHX 2BBTA 1OASA 1L7VC 2W2LD 1G7TA 3DAYA 3QHAA 1GADO 1H2EA 3QPCA 4AJ4A 2HAEA 1VG0B 4Z8XA 2BZ1A 4PRZA 4DR5E 5EXPA 4P6VF 5AJHA 5H81A 3D2CA 5ITVA 1P0PA 2W22A 1WU8A 3LQ4A 5AJUA 2YJZA 3IAXA 1MV8A 3DLTA 3KJHA 4FOPA 3SNKA 4EKGA 2WA2A 3P9ZA 2Q1WA 4MVJP 4D43A 5EMHA 2I2FA 4KFSA 3W5JA 3CRRA 5L7TA 3K1AA 3P9CA 2YFKA 5DCYA 2C4HA 3LT4A 2EZ4A 2AT1A 2Z2ZA 3ZDAA 2YJNA 2YJ3A 2Z6UA 4JI1I 3NBZC 2RGBA 4N82A 1TUEA 2AQKA 3D7KA 2J6IA 4LY6A 4C1BA 1KEUA 3FVQA 2BKVA 4PGMA 3CZRA 5LDHA 3PQ3A 1IULA 4DUYE 1EBFA 1Q21A 1TCVA 1RJGA 2CLSA 3IR5A 4WY2A 2EFGA 4KQ2A 3VZCA 4O2AF 4DRXB 4V3CA 4E5PA 3W8DA 1NE7A 1PZMA 5AHKA 1CT9A 4QG7A 4V38A 3ZNOA 4XVCA 4A5OA 4JI4I 2D2EA 2XUZA 2GN8A 3EG9B 4N65A 4ZYWA 4H6WA 3RS0A 4YY3I 3ZHSA 1YAJA 1Z68A 2G4LA 3O4JA 4MS3B 4MVJF 4RIGA 3P96A 2HLHA 3J81A 3UGKA 1W36C 3QKRB 2YQ5A 3QLVA 1E2KA 1ZITA 2OAGA 2IX9A 4DLSA 3W2GA 1FVFA 4Z9XA 1D04A 4JLOA 2Q8PA 4QA9A 5DTJA 3WLIA 5C7YA 4KFCA 4MVXA 3SEFA 5JEDA 2FK7A 2X9VA 3IR7A 2HSWA 1CX9B 2ZCVA 4F06A 1XLTC 4XCXA 2RK3A 2CCKA 3IE1A 5FFFA 1XCPA 4CVNA 3TG2A 5FA5A 2IZ0A 3PLRA 1XBTA 4O4JA 2A57A 4AKTA 1R16A 1HQKA 5EHIA 4ZARA 4HJRA 4PC1A 2ICAA 5H5JA 1A71A 1GZ7A 5UKDA 2ZJZA 1HR0I 3NC4A 5EYPA 5I8PA 1ECLA 4H17A 3IODA 2PO2B 3LFTA 3K0SA 5TMBA 3OM0A 1NXTA 1HE8B 1NOKA 2Y66A 3FGNA 3S81A 2KHZA 5HZMA 2A59A 1JEYB 1MLDA 2I1LA 1HDRA 2PV0A 2H7XA 3EGXB 3GJTA 3QBJA 5AKYA 5TEVA 4JYAI 2R5FA 1HM5A 1V9SA 1GUBA 5L6MB 1RM4A 1N33E 2G0AA 3DHNA 2B7CA 1UADA 1EFRD 2AC4A 2ZDGA 3HDGA 5INTA 2ET6A 1E18A 1QIMA 3BULA 3OZGA 5IK2D 2P9EA 2WWVD 4B5LA 1QDEA 1ZXBA 4QFMA 2DFDA 5CTJA 5HK8A 1XVTA 4EO4A 1UBLS 4CLRB 2O19A 1U0JA 2E49A 2OXTA 3VSAA 1GTL1 4EHLA 3A4MA 2XDYA 1SXJA 2HIAA 2QYTA 2VJMA 1TZCA 2ZEJA 1EFPB 4WFJA 1OWOA 2BISA 5F2OA 4DC9A 4FSXA 5JC1A 2OV3A 2A0KA 1N1DA 1XXEA 3FTQA 3F3MA 4LDZA 4E5SA 3AEQB 4DG9A 3KQQA 5GJBA 1JT9A 4M1KA 5IG2A 3VKGA 1W87A 2O06A 3SMVA 3X1MA 1UBMS 4A8HA 1JLHA 2B34A 4H1UA 4UTPA 4PYIA 4A2CA 4JLJA 4HF7A 3VZRA 4EGJA 3BWDD 5G02A 2PVPA 5U9CA 4R1MA 4DCMA 3EC2A 1GEEA 2VLIA 1MB3A 4O0LA 1FUUA 2WE7A 4WK2B 2DSTA 1L5GB 3V5NA 2WZCA 4L9AA 1R6TA 3LVFO 1C4XA 2R7LA 2J5QA 4ZPXA 2A1UB 1G63A 4MR8A 1EBBA 3IDOA 4Z54A 4MQFA 3TRDA 5B3JC 2UYOA 3V1LA 2O2GA 3BRQA 1JFFB 3OOHA 1EXNA 1SBTA 4NU6A 1IZ7A 2HQ1A 1GUAA 2Z95A 3FCXA 2MR5A 5TGZA 1JAHA 3L2OB 2E5LI 2GF2A 2GFQA 3I0ZA 2GPBA 5IZCA 2ZUCA 4BMZA 4REQA 1O6GA 4INPA 3QT5A 4EF6A 2CXUA 4UBMA 3HMQA 2ECKA 3B5EA 4A03A 1PNTA 4X92A 2YJ6A 3E22B 1ZH0A 3K9CA 5KYUA 1JE0A 5JNSA 2VWPA 3SJZA 5IJ9B 4S3MA 4L6IA 4PS0A 5I47A 1XZQA 1M2OB 1R66A 2VBIA 4I81A 2OD7A 2X22A 1XO1A 4WHMA 1ZR2A 3NVKI 4HNHA 4LGCA 5K36C 3R7WB 5JYBA 4HZUA 2F64A 3Q8WA 4JI3I 5F9FA 3A27A 1QS0B 5F1OA 2C4WA 2DQKA 3NBAA 1VE9A 4AJ9A 1OX6A 2AG1A 2CKMA 1CYDA 1YS6A 1U2ZA 2QG6A 2OCDA 2RDMA 3GU3A 3SZGA 3UMFA 5KAPA 1PKXA 1L5MA 1W5TA 3U1YA 3H6GA 4E46A 4GBGA 1XU7A 3OU6A 4QECA 1QPZA 4JOCA 2DERA 2VSFA 4NJEA 1V16B 1WPXA 5I5GA 1N1MA 1U3FA 3GQBA 3KT3A 3MJTA 3OLXA 2X0FA 4PNEA 2WAXA 1N0WA 1SHKA 3MGKA 3VVLA 4L3OA 1MVOA 1GQ2A 1WCIA 1PVDA 2PKWA 1LVUA 1F9EA 1FJGE 2ZJ1A 3EPKA 3U4IA 5BVGA 1ZNQO 3C6MA 5KYYB 2P9ZA 5B37A 1JL3A 2VPXA 1YQQA 4R69A 1IUPA 3TIIA 3KD3A 3H5NA 2V9CA 3K94A 2JAPA 4QFCA 1QC5B 4KSYA 1DRUA 2B4QA 4X1YB 5DM4A 4AP9A 2HC9A 2WKQA 3A6HA 1XAGA 3PDJA 4KL8S 3GL9A 1Q0QA 2IK8A 1ZUHA 4OO1B 1UAGA 2QAGC 1OMOA 5IWCA 4W5TA 3OI7A 5AYVA 3DOJA 4MCIA 1OLXA 1P8AA 2IXGA 3U3DA 2QUAA 4TLMB 4BU1A 4P9NA 4Y30A 2L82A 1VLZA 3FGZA 4CR6A 1F9AA 2AD1A 4LF5I 1EHCA 1D5WA 3G8BA 5HBRA 4GWKA 3W9SA 3U0BA 3KSDO 1Q50A 2DFKB 3RSFA 5IKXA 1KJ8A 1E3DA 3B53X 4R1TA 3U9SA 2VQEI 3E2MA 3NXSA 3GP8A 3T95A 1D8TA 2JHAA 4X66I 4QTTB 4R1FA 4ZOLA 5ALZA 3VH4A 5WRFA 2C9BA 2CXTA 5EMKA 4D25A 2XVZA 2EX4A 5BN5A 3UBTA 1E64A 3OJEA 2Q5CA 3NC1C 4FHGA 5JATA 1UBTS 3KUCA 4MH0R 4JYMA 3DW3X 1E99A 1JSZA 1O0SA 3DAHA 5ADHA 5C81A 4XIYA 1A8PA 2HRDA 3BXHA 2JVKA 1K3FA 2M9MA 4EUHA 1AJEA 1HRDA 1BS1A 3HFRA 1B16A 4NDZA 1MAHA 4QGSA 1ATIA 2B83A 1O6BA 2H7CA 5JI3E 2JW5A 3BSSA 1P1RA 1P1CA 3RC1A 3IUMA 4TWIA 4C7KA 3HJBA 2BV3A 3HB7A 2VJYA 4INOA 2O8CB 4O4IF 1CIPA 2WOJA 5ECGC 1IEQA 4Q00A 3T61A 1A98A 3IQGX 4ZCRA 4DV4E 1A9SA 1CK4A 3F0TA 2JGEA 4NEHB 4DDVA 4DN6A 1OSNA 4EI2A 2ZFUA 1CS0A 3GA7A 4LV5B 1MOSA 3RC2A 1V4VA 2ZBRA 3T06B 3W4IA 3W5AA 3U56A 2W6ZA 3BTUA 3K0AB 1UBFA 1F51E 1RPZA 5EJ2A 3K1JA 4O3FA 1H9CA 1I2CA 2ACEA 1U5BA 1CVLA 2NZ2A 1HRKA 3NKFA 4U0JA 1ZUWA 4UOZA 1SVMA 3L92A 4B85A 4XIGS 4YWHA 3SQMA 1F2TB 3O3MB 3MJHA 2X6QA 3FH0A 3G2PA 3T52A 1Y4DE 1T1SA 2RH9B 4CMIA 3G5AA 4IUCS 3EWSA 1Q7RA 4U3JA 1LW6E 3R0VA 5FPPA 4P31A 3T3DA 1QG2A 3Q85A 4F1WA 1I3OA 2WKSA 2PPVA 3VO8A 4YPOA 1DWPA 1KL7A 5LMNI 5FRDA 4PG8A 4YQEA 4A7PA 4KCGA 4YT4A 2RHJA 1AMUA 4MV0A 1FFYA 5G40A 4GVLA 2A14A 2I1QA 1GHTA 5EJ9A 4OLBA 3ISVA 3OX3A 1XTZA 2FQQA 5BSRA 3HO1A 3HS3A 1N9ZA 2E2WA 3GGOA 2E7ZA 4HDRA 1TM1E 3DBOB 1J49A 3CUUA 1CLEA 3V55A 2JFVA 4AO8A 5BR4A 3DKPA 5AVWA 4GMKA 1H4VB 2JAWA 1I14A 4PGHA 4KYUA 3TZLA 4M1MA 1QE3A 2FPKA 3BT7A 3OTGA 4FN4A 4R2KA 3SHQA 2WMYA 3WMEA 2ZYWX 4LF4E 5FOQA 4BX2A 4JQZA 3V5RA 4WE3A 3R7NA 4RORA 4CKEA 3AOEC 1DRJA 2FA9A 3BYZA 3KELA 1Q7TA 2FW8A 4LCEA 4II7A 4MPTA 4EUEA 4BB9A 4EUFA 3OMXA 5A4IS 3BK2A 5JJ5A 1AS2A 4DF3A 4ZV4A 1YJAA 4BJ1A 5LQNA 3PGVA 5JXJA 4DSZA 1Q7EA 2VF8A 3OZVA 4FR5A 2VR1A 3RLIA 3UHJA 1TEXA 5IARA 5B7QA 4MQEA 1X8XA 4NSNA 5DN6D 3BBLA 1T0UA 3VNQA 3FNHA 3TBHA 1RLOA 2ZYUX 4DLPA 1G6HA 1NVGA 3LFUA 3PGJA 4JI0I 3L8EA 4E2XA 4OQYA 4L7VA 2FUEA 2VDVE 1KVUA 4NTZA 4RIHA 4DYHA 1A3CA 2V59A 1J2EA 4C7OA 2ZETA 2Y67A 4ROSA 1RZVA 1B63A 4U7WA 4UM5A 4KG7A 4NONA 5HBGA 4K05A 3DMDA 3T4UA 4ZGBA 2ORED 3O9MA 3P45A 1MNQA 2Z1NA 1QANA 2Q6IA 5K36F 2F1OA 1J00A 1XV5A 4MS4B 2PSDA 1S2IA 5CURA 1M8PA 1NBHA 2PH7A 1RRCA 4L08A 2VWQA 5EE5B 1E3WA 3R7LA 3URKA 4OYYA 1XHLA 2KM1A 2QWXA 2RK4A 4Y1EA 3VO1A 4DQVA 2ZTVA 4UCWA 2D3WA 3K3PA 2LUOA 3Q7RA 4AG5A 1OH8A 3FZQA 4DLXA 3AVWA 1U0TA 2O2HA 2CNKA 1N6RA 4IZHA 1KEVA 4P3PA 4D3ZA 1A4RA 4LJ6A 3V34A 6REQB 2ZSIA 2C03A 3KZOA 5E95A 1U65A 3S29A 3F1KA 3SIWA 5AK4A 4X44A 3M6VA 5D5QA 3NIBA 1JW9B 2HDOA 1XYGA 4MVJE 1XTJA 1E2QA 3PUWA 4OOEA 4WN9B 1OFUA 1UBSB 1UKVY 2XGMA 5EXEA 3CR7A 2P2ZA 4C04A 4GQBA 1DJMA 4MA0A 1L8XA 1R7RA 5EUBA 1II0A 1WM1A 1ORIA 2FPOA 3ZE7A 3IVGA 5GMDA 2WQZA 4QPPA 4FQ8A 5EE3A 3V4ZA 4NULA 2WFLB 2P2SA 1GTG1 1G4HA 1EUCA 1ZOLA 2A33A 2BGRA 1QUEA 3U44B 3VNUA 1X8LA 5G0UA 1P7WA 3ZPXA 2FPGB 2RHTA 5AESA 1JA0A 1HTBA 1Z5WA 1PT6A 3ZK7A 3THYB 1CE8B 2QTHA 2OZKA 3PENA 4IDDA 4TPKA 3V33A 4G0MA 2XRFA 2QTNA 5G4KB 2IPXA 1YTUA 4R71A 1U11A 3PUHA 2XADA 2FR8C 3L7BA 4M9RA 3K9NA 3N70A 2WI8A 2X9GA 4BO7A 1AVTA 3HCFA 3Q5EA 1G18A 3O26A 4QHSA 4E7PA 1UKYA 4INJA 3JS5A 4MQMA 4Y2XA 3MBOA 2YNMA 4PLTA 3NDBB 1NW4A 2P4UA 3HNPA 4MRSA 3BCRA 2ZVJA 4GR9A 2J6CA 3R6TA 1IBSA 3RHTA 4BFZA 3HM2A 1QO0A 3L07A 2XQGA 4HUQB 3QLVC 1KIFA 4WJZA 5CNMA 4BO4A 4CL3A 1H85A 3VPHA 4BATA 4CGZA 2BMJA 3HKDA 3PC2A 1G6Q1 4CI9A 3W5DA 1E2UA 4BQSA 3PEUA 1BE6A 5EWMA 2I80A 4B2IA 2Y99A 4EY5A 4FDLA 1E2DA 4MLPA 2CJXA 3NB0A 2H4JA 5CXQA 1KE2A 1WVMA 3ZTWA 3TW8A 2YH2A 4IS3A 1N5MA 5EY5B 1E6WA 1KPHA 2ZSAA 1QX4A 1C3XA 1W2WB 3F5QA 3MD9A 1SXIA 5SY9A 3WHIA 4OXKA 4QGGA 5C5CA 1VKOA 1B7GO 1II8A 1YJ8A 5HIIA 3VAAA 1JEQA 1QGAA 4RH0A 2ORIA 3DPSA 1C0KA 3F78A 5JNTA 2APJA 2AOVA 1RWNA 3AP2A 3OQIA 4BDTA 3ZYCA 4CMKA 4D4GA 1E4VA 4OXQA 3TDKA 3ZOKA 2GYYA 1FX1A 2AZ4A 4TT3A 3ZK9A 4C4TA 2ILTA 1ZM7A 3G2HA 3QA3E 3NR2A 3ZY3A 2ASEA 1OLSB 1ENZA 4IYJA 1YZQA 4JXJA 5FBRB 2JLWA 1C0LA 3X1XA 4H3KB 2J0SA 3VNVA 4R1QA 4HNTA 1A7KA 2WUFA 4MHTA 1QONA 1VJDA 3D7NA 4EX7A 5AW6A 2AN9A 4MI1A 2OCAA 5HKOA 4GX2A 1HDOA 3CFYA 3NQ41 3RRFA 3TLEA 2DGDA 2ZUSA 2VBGA 4K6GA 2EFDB 1SXJC 4KHPB 5DHTA 4JFAA 3AHHA 4DZTA 1YBVA 4MI3A 3RFTA 1ABFA 4R1NA 2CDBA 2JE6A 2ERXA 1FFCA 2O1XA 5GONF 4DSAA 3KLMX 4IHJF 1R5BA 1XRJA 3PHCA 1A5AB 2FX3A 1OLOA 2A8YA 3KOUA 1MA3A 3AXTA 4NEGA 3SXUA 1YZFA 4TXNA 3JRNA 5C4MA 3OPVA 1T9AA 5LJIA 4QYIA 1LDYA 1QYIA 2UYYA 5TSDA 2JFPA 3I32A 2A2ZA 2VJDA 2LCQA 4WY8A 4ZO6A 2CDNA 4PLVA 3KSRA 3TTVA 3WL3A 5MFPA 4G23A 5DGIA 2YC2C 1SWWA 2GOYA 4J7XA 4UULA 4MUNA 3RB8A 1UJNA 1PI3A 1SC4A 1ECPA 2KLHA 4NXNI 2OK7A 2X3UA 2PSEA 2X9LA 5IZCC 1C1HA 1X19A 2Q2QA 1TGVA 3VO9A 4IO0A 4XYEA 3J80Q 4C4OA 1WSWA 2LDBA 2OPBA 2QL9A 3UCFA 3UK7A 4PF1A 4JC5A 4RACA 3OIUA 4YIHA 1UL1X 2FSHA 2GJAA 2I4LA 1W1WA 3QT6A 1A97A 2IYQA 2OZVA 1OJLA 2XI4A 2IHJA 1QZUA 2UUAB 4JQCA 5EIEA 2WKRA 1VIDA 1HKUA 2ONCA 2VNHA 2REQA 4HLDA 2NZUG 2GRJA 5EFOA 3UJ9A 5C8YF 2B36A 5LOVB 3U7FB 2JGAA 4RQUA 2YJTD 2H2GA 3W79A 3AU9A 1E20A 4D8VA 1IJKA 3TQFA 3ZJ5A 2O7VA 5J1SB 4CDGA 3FWYA 3P5SA 1UDSA 2N1MA 1JU4A 3QMMA 2G0NA 1EUYA 3WLQA 2XD9A 3AIMA 4E3WA 1LA2A 2GILA 1RXIA 3CNQS 3KV3O 4LXIA 1O0CA 4BMVA 4ZV7A 1D2EA 1TJ3A 1U02A 2WOOA 4C88A 4D9FA 2C88A 2UVPA 1IM5A 3ELBA 1UBJS 3BGIA 4BQNA 4XIJA 5IAGA 2I6GA 2PAFA 1AT1A 3OE4A 1XMOB 5JJKA 3MBIA 1FTGA 4FFMA 4K86A 2UV8A 1W2HA 4FCTA 1J0CA 3ZV4A 2H5LA 1QHSA 4P4SB 1EFDN 5J47A 1Z63A 4Q03A 5DHAA 2X7XA 2RARA 1A0OA 1UODA 5AW1A 4QBKA 4P7BA 4FW5A 4DA0A 3X1KA 2G9NA 1GG9A 3T7TA 3U31A 1GM5A 4XD7D 2IS1A 2IU4A 1YE5A 9MHTA 2IUEA 1UMCA 3WYAA 2BJHA 5B30A 2IYSA 5IC5A 4KQWA 1DXOA 4WBSA 5DOZA 5F7JA 1I7SB 4FCVA 4IZJA 1XNRE 1L2TA 2NIPA 3JWGA 3FETA 4N12A 4RZUA 3RTBA 4EVIA 1DBVO 1TQ4A 3WLFA 4BLVA 1NYRA 1WHTA 4FFRA 4LJ7A 5FNVA 5HS6A 4OFWA 4GEKA 4EF4A 5AUPB 5HFAA 2XXJA 3M8KA 3RTCA 2PA0A 5EZYB 1B41A 4L9SA 1UOOA 4KOAA 1I7NA 5EHQA 1QIHA 5DCUA 4BNHA 5KSPA 1S8FA 4I1SA 4C3ZA 2CT8A 5FWKA 4PRKA 1MC1A 3OUZA 3DXYA 4PLWA 5LQKA 2MSCB 4HQFA 1UK7A 4Q05A 1HDEA 2IYFA 4YCLA 4LF8B 1I6WA 2KI5A 4HX9A 4FYIA 3OBBA 2QTTA 5AOBA 2IH4A 1NW5A 1M8FA 4OU4A 3D2AA 2JB9A 5BR1A 2OUKA 3HYCA 3BEOA 1H0HA 3SP1A 3LPSA 2P5SA 3H97A 4FOLA 1TO6A 3NKLA 4FTWA 1DHRA 2AFHB 1CV2A 1VL5A 2CHUA 3K5IA 3SZ3A 3AWDA 1LBHA 4RDCA 4F7WA 1T2UA 4DNXA 2Z09A 3P3EA 3CIFA 3HA2A 1W46A 4PAGA 4ENPA 3PCRB 1IBLE 4TV8B 4EMUA 4YDQA 4DQ0A 1WABA 3OEYA 1GZHB 1M1ZA 3S27A 4AG6A 1YA6A 5DRQA 4AXXA 3EUAA 1TM3E 1RHQA 1ZBQA 1LBIA 3KE9A 3MBKA 7REQB 3ILXA 3KPYA 3DXZA 4FYMA 3UGQA 5CHYA 3LT0A 3M49A 2GKSA 2B7LA 3CVUA 2PDAA 5TQVA 5F9HA 4WXEA 2GBPA 3R0QA 1Q3HA 2AEEA 4DGSA 4Y9RA 2MSKA 1UQTA 3AESB 5CG1A 5JSHA 5K6RA 5L6LB 2HFSA 1EU1A 1SH7A 2I71A 1VXOA 2Y1CA 3IKLA 1GRNA 4MQLA 3TE7A 4MR7B 2ONKA 3UMVA 4WCDA 1T8UA 4RPJA 1VG8A 1ZL0A 5FFNA 1J39A 2D5LA 2H18A 1CS4C 3BWEA 1N3LA 4UUAA 5ESXA 1PS8A 1TT5B 2XPCA 4MVJD 2BEWB 5HIJA 3MRXA 4G9BA 4PHTA 1U63A 2QRMA 2ID9A 3VKVA 3RFCA 3AHJA 2D7DA 1P1BA 1UBKS 5A06A 1SR8A 4LJRA 1NLZA 3QFRA 5U4XA 1E0SA 1QG6A 3LWNA 4JEIA 1QH1B 2NUTA 1P2TA 3KB6A 4W8GA 2GCIA 2N0SA 3ASYA 4YMWA 4YT8A 2FUG6 3DYIA 1ZR4A 4MS1A 3USCS 1CQPA 1I94E 3SLRA 4OK6A 5IKEA 3VR6D 4RYLA 1J2JA 1RFLA 4IDPA 3L0ZA 1E32A 2P35A 4U6QA 2PXCA 3PK0A 3QU2A 5B2EA 2IEGA 3BKWA 1X1QA 4G8BA 3KU1A 4JKIA 4M0MA 1X39A 2LXNA 3I4LA 1O5TA 2AIRA 2AMLA 3PF9A 4LK2A 3H83A 5LYYA 2F1JA 4ES6A 2PVSA 1O9GA 4GQUA 2QN2A 2F3SA 3UCXA 4G5XA 3AG6A 1NR5A 4QDUA 4U7TB 4OTZA 4ENQA 2CDAA 2CWDA 2SCUB 1NVUQ 2EGGA 2G1AA 2SHKA 2ZRAA 3L7DA 3BJZA 2Z2YA 4QDOA 4BO6A 4W5WA 4LWOA 5CJJA 4YMLA 3MRSA 3OTHA 5KTRA 3KPVA 3TJMA 4LE1A 4ER3A 1G4UR 1VA4A 2QDKA 4NDNE 4XTJA 4LJ5A 5JV5A 3BA1A 1RI1A 3AV0B 4X7RA 3DOUA 1Z39A 3TX6A 2DKOA 2O3JA 3UK6A 4B6JA 3RC8A 3N2GA 4EP1A 1RW4A 1N8NA 2AEJA 2IYLD 2Z08A 4TN1A 1E0AA 4DIDA 3IB3A 1COWA 4PANA 1XZDA 2HHLA 3NANA 3LU1A 3WMGA 2OQ2A 2ZANA 4OSOA 4R01A 1SVUA 1TMOA 3BN3A 3Q8LA 1EUDB 1P7ZA 1T1RA 2ZVQX 3M4NA 3ROPA 1F8FA 1Y4UA 1M7GA 4JYZA 2RKOA 3T7DA 1ZISA 1HEYA 4S2EA 1VDZA 2PSJA 1B8NA 4PNPA 3AETA 4DA4A 1L7AA 2XVMA 1WUYA 3GLUA 3NAMA 3V3KA 1YHNA 2NVUA 1UBCA 4EIWA 3HE3A 4RCVA 4W99A 4QQNA 4IZKA 4O2LA 2HB6A 4DQUA 1RC8A 3O47A 1Y9AA 1Q57A 2FWAA 4G1EB 3GZTB 1IVYA 4FYYA 1W6RA 3LY5A 1BD4A 1Z35A 5CDSA 1NN1A 1YL6A 1ZNYA 2GWRA 2XHEA 2ZAIA 3EDQA 1JP7A 3A1DA 3GCWA 4Y2PA 3WIUA 3CKLA 4YRTA 1GTMA 1P80A 4BY9E 4WBNB 4G1CA 3ZX4A 1LSSA 1PYDA 3B8EA 3OEEA 4IJKA 3UV7A 5HRUA 3T8YA 1IQ0A 4C7XA 4EMSA 4OK3A 4QTXA 2CE7A 2OCKA 4MITA 3VFDA 5IFLA 3HZRA 4A8PA 1NLUA 4TS1A 4TMFA 1Z08A 3U2QA 2C2YA 3RTAA 3UWPA 1N6NA 2XBUA 1MO2A 2HMSA 3HSSA 1QG4A 1U3GA 1T1IA 2AG0A 1W52X 3CZ5A 5K0EA 1U1DA 1UJMA 3O31A 3J7AM 2QX4A 3RS2A 3ZG6A 1P7CA 5B1YA 4DHWA 2ZJFA 2XYRA 3SDZA 3SU8A 2GTPA 5FBWB 5AVTA 3ICOA 1IQRA 1W1IA 3LF2A 4ED4A 4NNPA 4Y0NA 4KK4A 4BYGA 2JD1A 3BMCA 4FFPA 5E6RB 4FHDA 2JHPA 3B6JA 3V8BA 3TPFA 2BM8A 2EARA 2XCLA 3KR2A 4QJBA 5IAKA 2GUWA 3BMOA 3GLFA 2V55B 1ZH4A 2C58A 4CCYA 4TV9F 4F86A 1XA3A 1ZNXA 3LBIA 4ALLA 4UAUA 4L51A 1JFTA 2XMRA 2HWWA 3M82A 3QLTA 2ODPA 4MO2A 4B6RA 3ILHA 1AGNA 4ISCA 3EASA 2ZM6E 1WUHS 2AD5A 4EJSA 2B8NA 4DCGA 4OGFA 4JR2A 4LHYA 2PD3A 1EVZA 5DE3A 3GGJA 4ZRNA 1K7EB 1L4NA 4NH0A 1DCFA 2ZPUA 2ZUVA 1VKRA 4L5YA 4G37A 2B37A 4UNNA 3BPSA 4BA2B 3LDHA 4ZCIA 3ZDRA 1AKRA 1TADA 1QYWA 2QT0A 4CHTA 5HJEA 4YDSA 4IM7A 3TF5A 1OWMA 4QRDA 1JSRA 1HNXI 3QSGA 1QHHA 3SM9A 1DKPA 1PT7A 3OJ0A 3OCXA 2YOHA 4MRAA 2WQ7A 1SBYA 2C59A 4HGRA 2CNOA 2QD2A 5IEJA 5FBQB 2HBZA 1U9CA 4OQLA 1G2OA 4BRZA 3A9CA 4BNDB 3KQPA 3I04A 3B78A 4M86A 4URYR 2D74A 3ZEAA 4E2FA 4F4UA 2JFGA 1DEXA 4ASUD 3HXPA 1UXIA 4X8OA 4EI8A 3IIKA 3MMXA 2HLPA 1BX3A 3H4IA 2WWWA 2CNDA 2ZLBA 4NY1A 4OAPA 4CWAA 3ZC3A 1G5IA 1ZW1A 1V1MA 1K5HA 3OZTA 3LT1A 2UZAA 3PNMA 3L9XA 4HAUA 1DAEA 1P61B 3TLCA 3B36A 1W36D 3IVCA 2FEAA 2VJQA 3CE9A 4UREA 3PTAA 2VRCA 3EW7A 3NNNA 3D3WB 4BO9A 3FNFA 2J07A 2OC4A 3KTAA 3NJ8A 4IXWA 2W2KB 1UKZA 1WD7A 2D3TA 3I01A 2YZGA 3QE3A 5LIPA 3GCZA 1KNXA 2WG1A 3SJBA 4M0EA 3TI9A 4DXDA 3E9MA 2ROQA 3U6KA 2HQOA 3IIIA 4CNQA 3ZIAD 1YH8A 3ACCA 1XDZA 5DTRA 1WL8A 4JI8I 5JC8A 4QRHA 3MRVA 5DRRA 1YQXA 3KQSA 1YO6A 1VL2A 4WGFA 4BMSA 2UUCE 1TX4B 4DBLC 5CA1B 3ZE6A 3UWMA 3U4QB 1JWLA 2B69A 4HDSB 2FK8A 1D2HA 4YRCA 1L5NA 3ZV3A 2UZIR 4DNPA 5JR3A 5IKOA 4LZZA 3O4RA 1WX1A 2W6IA 3DLPX 4OU5A 4UFNA 1CULC 2CNWD 3IRVA 3OKCA 3RW9A 1N5DA 4DMMA 3ABZA 1PJ8A 1AZTA 5DHQA 1YB6A 4BQFA 1X7WA 2I03A 3NYRA 4JLUA 3GPDG 3TM5A 1QLHA 2FXIA 4FXOA 5I9LA 2BKXA 3NRCA 1IB6A 1DZIA 3G0GA 2P0EA 3GZJA 3DFUA 5TC4A 3VYRB 3LXUX 3PFKA 1T3LA 4KLCA 4KN8A 3MCZA 1NVVQ 1JKJA 4OSEA 2P4SA 4F04A 4KPUB 4GW3A 4LXXA 1SURA 3EAGA 4EHNA 5JS7A 1N9KA 2PQ2A 3P0HA 4M7OA 4N01A 3WLNA 1MJGA 1QBKC 1RJ9B 1WB4A 2R85A 1XKXA 3C8MA 3OPYI 4OHBA 3QEAZ 4LPKA 3D0OA 2Y3IA 3W3AD 2OC9A 4JL6A 4IMJB 3ZDEA 2A4KA 1P3DA 2I3ZA 4XLTA 1WE2A 3V4LA 3JWEA 1LNZA 4B31A 3QI7A 3RHZA 4C0AC 4LCGA 5KWVA 4Y1FA 4KWIA 4C3OB 1UP7A 3AT1A 3ETJA 3ZCTA 5IVPA 3NNDA 2PO0B 3DJFA 3DTYA 1HNZB 8ADHA 4CEHB 1JG6A 4QHYA 5A4DA 1YD7A 3GEIA 1CR2A 2XE4A 3FZYA 2J3QA 1IPHA 4MTCA 4QOFA 1FTSA 2I7XA 4R8KA 3TMAA 5G3YA 4PNHA 1KU6A 3JYQA 3TDNA 4H60A 4K9MA 3HZOA 5C4GB 3V2UA 1HT0A 4ZEVA 2E87A 3B8HA 1PYOA 1PJ2A 1PWHA 3CV3A 5DIZA 4GPZA 4E1AA 3T1NA 2O2DA 4WOPA 1BCSA 2XZLA 1Y4SA 1GG8A 1JHUA 2WMNB 4Y2VA 5B55A 2GXQA 1H9AA 2X5NA 3C8ZA 3T12A 1CJVC 5K36D 4CKWB 4MMXB 4GLOA 1MNAA 4DARA 4YAKA 1ZCFA 2LJPA 3LOQA 2EYUA 3OT1B 3ED1A 3KT0A 4B34A 2V6JA 1LKZA 2H4XA 4IDCA 3LUGA 3FJOA 1A76A 2GHIA 5DNWA 4Y18A 2I4RA 1T34A 1LTQA 1K6EA 1BEEA 4RAQA 4YR9A 1T9DA 3NDIA 4HAWA 1Y6QA 1BD3A 1NOIA 2H2AA 4F5EA 2F8LA 1GRCA 1YONA 2J5KA 1SIUA 3C3XA 1JEAA 2WPDA 5IMSA 1XAIA 2CLLB 1C7QA 2X2OA 5DHRA 5E1BA 1Z7EA 4K9NA 1N6KA 3O1HB 3QKUA 5K8LA 2ZJ3A 2LKCA 3ASZA 3LO5A 4I9HA 4PZDA 3KFVA 1I4LD 3TOSA 4B6SA 4NXMB 4KQVA 1JZQA 1AGPA 4LNAA 3ZXSA 3AUKA 1DAFA 4MW2A 3E8MA 2QI9C 2UXCE 1H1LA 1LU9A 1NR7A 3BHJA 3GOQA 2O48X 4WFQA 1NGSA 1NX9A 3OEHD 4Z4CA 1SXJE 2XXAA 4MARA 3MHTA 2XTJA 4M0LA 4BFTA 1HDCA 5BYJA 1XZMA 2PX6A 1YJ5A 1OZFA 5DBGA 2NZ8A 2E5WA 5HX7A 2ACVA 1QB7A 1RYDA 2NU6A 4H3SA 1OIXA 3KOMA 1WBDA 3PYFA 3C7DB 2OCGA 3GLTA 3O4FA 3P71T 3KJZA 5L53A 1NP7A 2J3EA 5J4YA 3MTGA 2AG6A 4R81A 5DBFA 3ICEA 4F3TA 1AQIA 3B48A 3DB1A 3C48A 3O9ZA 1N77A 1E9RA 3CCFA 1KJYA 2XWBF 4ZPJA 2JGRA 4U7HA 2LKDA 4Y98A 5K3BA 1AU9A 5IBRA 4QM7A 2ECQA 2FN4A 3ADOA 4OHRA 3SKVA 4DPTA 2FWMX 3QXSA 4IHAA 3R0ZA 3L7OA 5JMPA 1WS6A 4MB6A 3JQ8A 3ANYB 3G7UA 2VSQA 3OE1A 5IPFA 2DBRA 5E4JA 1ZIDA 2M32A 4O8ZA 3BTVA 5E7IA 5ECWA 4DB4A 1IMJA 5LZ8A 1QHFA 2IELA 3LJKA 1IAQA 3FAKA 3CUYA 4ER7A 1KPGA 5JFTA 4UJ5A 1NDUA 2IHBA 3WNZA 4W7SA 2OFWA 3SM3A 1IY1A 3HDHA 4K40A 1R4NA 2XAAA 2IHTA 3QPWA 3QV2A 1H4QA 5JW6A 2YINC 4IRXA 3QIVA 4Y2HA 1NV9A 3CURA 1JH8A 1Z5PA 4LF6E 2YWRA 1WF3A 3FMOB 3L0SA 3PUJA 3OPMA 2JD0A 3GWGA 2FLWA 3Q2IA 3QZUA 3ITKA 2CXOA 2AOTA 1ZCZA 4AY2A 1HE1C 1SA0A 4QO7A 5KPDA 3VR5A 3F7TA 2V3CC 4JUFA 3G88A 5DWVA 3ADPA 1LQTA 4L0MA 2GPTA 4PTYA 4GU5A 5F1PA 3RR2A 3SR0A 4DUZB 2PJUA 2V5UA 3HWX1 4W1PA 1C0IA 3WFIA 3R7FA 4MPPA 3THWB 3Q8MA 4O4HA 2LVBA 3RASA 5REQA 5HGXA 1T3HA 3FYDA 3QF4B 1ZL2A 3PXUA 2O20A 2QVLA 1B1CA 2VPZA 4TL8A 3X2SA 2M6LA 3OO1A 1XZBA 2EFCB 121PA 5T4BA 1P2BA 4ZOBA 1C0EA 3JXEA 4MWGA 3SBXA 4N0MA 4CBVA 2OM6A 3AGPA 5T6MA 1C2TA 1QVZA 3H3XA 4JVSB 1CJUC 3DBLA 3GEGA 2QP9X 4UBNA 8OHMA 1LJLA 5LQUA 3U26A 1IJBA 4V1CB 3GVXA 1CUDA 3SC4A 1EWYA 2PX4A 3JARA 5FL7A 2OORA 1M6NA 1LH0A 2ALJA 4UHJA 4DR5I 4F71A 4GYWA 5HFNA 2WAYA 3ID6C 6YASA 4XCVA 1TYDE 2A0FA 3PKJA 4H7JA 4I9NA 3C6BA 4ZVSA 1YFKA 3ROZA 2EW8A 5A5FA 3FPGA 1J42A 1F14A 1GNLA 2R62A 5IYZA 1E2HA 4FYXA 4B84A 2IOPA 1IBMB 2A1TR 3EFOA 1KEKA 4DQXA 1XHEA 3KYIB 4DT1B 2B92A 4JCOA 4R9VA 1Z62A 1STOA 1NR1A 1NOJA 3EIEA 3NV9A 3GLGA 4UHFA 1ATZA 4B2PA 2HREA 4A1OA 4B81A 2QN7A 1MG0A 5BV1A 1FDVA 3B7WA 4Q16A 3ZWQA 2QM7A 1WZNA 3K0FB 2CK3D 4HTFB 4NYMQ 4RHEA 2I4TA 3FPBA 3VPFA 4A23A 1E4OA 2I76A 4IGEA 2MINB 4KQHA 1GLNA 5DXFA 1SU7A 4Q34A 2O2SA 3DG9A 4R68A 4ECAA 1XNJA 1P42A 1NF2A 1PUXA 3JD3A 2HH9A 2KMLA 3IQIX 3PHLA 1M33A 1ID8A 4RZHA 3QTLA 2R6HA 2BDUA 3DDNA 3PC6A 5D3MB 3OFND 3PDIA 4GMFA 2H3EA 1KS2A 3GP5A 1J56A 1TPYA 4GFDA 1JG7A 1SUFA 1NAHA 1US8A 3PD7A 4RPIA 1BKYA 3FBTA 1T8PA 4DW8A 1FLNA 2O5RA 1YB5A 2XMBA 3CLHA 4IKOA 2QUJA 4TLCA 1DGQA 1DAHA 1SXPA 1E3PA 2C9YA 2XYPA 4NPHA 4MIOA 1P2GA 1Z88A 2OSVA 1EI1A 3B6KA 1BGWA 1S2GA 5TS3A 3RE1A 4YMHA 2VNAA 1ISGA 4D9MA 1C2YA 4XLLA 1WUIS 2XUFA 2HU2A 5HDBB 3K8ZA 1G3IA 1DBWA 1SELA 1ZA2A 2YHBA 3OF2A 4TS3A 2ABWA 3RK1A 1DG3A 5BV2P 4CLXA 3FZGA 3U3XA 5LDGA 2VDWA 1Z6ZA 5DI3A 4CMAA 4RHTA 4HGNA 3MSCA 1IIBA 1XX6A 4G2NA 1QWOA 4UNIA 3BXGA 4HK4A 1N33I 3IFSA 1TFRA 1XQYA 1FMJA 3AMVA 3C5WP 5IW8A 4EJSC 1AUOA 1SG6A 3PE6A 4K2AA 2PY6A 2V4MA 4Z8YA 4B7ZA 1JWAB 1TF5A 5AOVA 3GMDA 4EQZA 5KQPA 3EMDA 3TTUA 2YS6A 3R6LA 2EG5A 1TU4A 3CVVA 1QLWA 2I54A 2QI9F 3BWYA 2SKCA 3MYRA 2Q3HA 1RXVA 2H1WA 4DBZA 1XCLA 3BIOA 3LQQA 1RP1A 4XPIA 1UC4B 2BGJA 1S4EA 2BEVA 2VYQA 1LF0A 3BEDA 4F7DA 1I5EA 2YV3A 4OA5A 2NOAA 2Q9BA 4DV5B 1KZ4A 2H11A 2NU9B 5B2FA 3KB2A 1NASA 4QC2A 1TF2A 3EVCA 1RRMA 4ZVUA 3UAGA 1SU6A 3V9AA 5BR8B 2QV7A 2R2AA 5BURA 1OKKA 4H7EA 3P32A 4PZCA 3W2EA 4RVHA 2BGLA 3C5CA 5AJWA 621PA 2JK1A 2ZAOA 2Q3EA 4YJ2F 3KSUA 1WXHA 5EIBC 4YHHB 2JA1A 4U9UA 4YK7A 5LB4A 2A0WA 2IP2A 2WP8B 1C8KA 2IBTA 1KO8A 1DPGA 2BFDB 4UUQA 1W36B 1ADGA 3CH4B 721PA 3UGTA 5LP6A 2PS3A 2BEUA 2ZJ2A 2O54A 2JIMA 2RHOA 2H9AA 1Y5YA 2X41A 1PEDA 4QASA 2CYCA 1IWPB 3QYFA 4OMDA 3QSYA 4IEIA 5FULA 2HHAA 2H1CA 1IOWA 1XQVA 4RXTA 4TN5A 4AY5A 2HHJA 3GUZA 4D0RA 3DBHB 1D6TA 2PRZA 4RFSA 4ANFA 3RS7A 5FBHA 3TMYA 3LECA 4HEA6 1Y3HA 1I9CA 3BXPA 3NBUA 4EL5A 2JFHA 1RRGA 3AFOA 1CEYA 5H83A 3CINA 2P2YA 3SJCA 3T7EA 3AR8A 2I4MA 4A6XA 1XWWA 2ONZA 2J9FB 4MMYB 1MO4A 4BKOA 2A5GA 5HPYB 3AVYA 3DW1X 4XUEA 3ZUGA 3ZQUA 4RH1A 2CNNA 2R96A 1DWUA 1Y6JA 2MYNA 3COYA 3R5TA 4G84A 3ZE2B 4EFDA 2FUG1 1RHMA 3LG2A 4P7KA 4D9JA 4OKIA 3RYCA 3TLZA 4L3WA 3H05A 4EPWA 2XD4A 4O25A 5JANA 5KTKA 3R2JA 2QUZA 2PXHA 2VDMB 1FP7A 1Z5OA 2QL7A 2QMYA 3AGQA 3QE9Y 2ZB3A 3D4PA 4A0HA 4N5MA 1UF9A 4J9VA 3B9QA 2DUWA 4WZAE 4I8DA 4LN1A 2QLMA 1I4DD 4RO0A 5JBQA 1HZZA 1TEHA 4GC9A 2CB0A 3V4VB 1O95A 1GGMA 2WM3A 2PQ6A 4P5DA 4H4CA 2OAQ1 4KE9A 4MYRA 2JLZA 3CBQA 1SXJD 4DV2B 2VRNA 5A3RA 1N7HA 1DBRA 3GRPA 5DGDA 2P9BA 1G20B 2QRKA 4RV9A 5K05A 1N0VC 4IIJB 1RQLA 5ARCA 5BY2A 1JQLB 1X92A 1CUIA 3ADKA 1KZYC 4EELA 1NJ6A 1QKJA 1N6LA 4H7PA 4PM4A 1PR9A 1YCFA 1X1TA 4GP7A 2EFYA 2TSYB 4F8JA 2IT1A 4ZJZA 3HVKA 3C3WA 2YDYA 3RJ5A 1T10A 2F4NA 2E37A 2HR1A 2FJPA 4GE3A 3R3ZA 4GOLD 5FLYA 3VYVA 2DTXA 3E84A 1JMYA 2A9OA 5CDFA 4E4RA 4B74A 3B70A 1ZQ1A 1CQXA 1IK4A 4IHKA 4TS4A 1RM5A 4YRNA 3GJSA 2X5XA 1W93A 4BNVA 5BSMA 3U0VA 1FE8A 4QLBA 4N41A 2CB9A 1KDYA 3KQYA 4RL4A 2ESRA 2R1ZA 2XOKD 4X9XA 1A1VA 4QRIA 4CIXA 4M6WB 3A1VA 3PL5A 3WQRA 1HFEL 3TLXA 2GAOA 3U5ZB 1E3HA 3PR1A 1NP3A 4F6LA 5E2AA 4OLAA 2AYZA 5E2IA 5EKTA 1L9KA 1YI8A 4FOSA 4HX5A 4QUGA 3WOVA 2DETA 3SZRA 3DUFB 1FWKA 4Z0HO 1IL0A 5K36B 3TS1A 1SCUB 3UOWA 2P7HA 1BN7A 4Z9BA 3TOXA 4ARBA 2XCTB 2FMTA 1POXA 5KTPA 3REGA 1YACA 3E8XA 4A6DA 3DL4A 5EE9A 1AXRA 4H9GA 2YDXA 2A5LA 2QRVB 4YO7A 3VV2A 1FFEA 3G0IA 3SKXA 2QKYA 1O3YA 1TM7E 1BMTA 1L4KA 2V8BA 4WCFA 4XEHA 2CFTA 2H5JA 4CKXA 2W48A 4M8NE 5IM4A 5AVKA 4E2ZA 3CY6A 1SUIA 1WLSA 2EW2A 4R7GA 3N53A 4RKEA 5K3EA 1I2MA 1NI3A 2BR4A 3COWA 3I34X 4UOQA 1GNPA 5HCNA 4YRPA 3SFVA 3BIWA 3V80A 1N2CA 4WACA 4DSNA 2WAMA 4Y2YA 2ZUTA 5DNXA 2DJ5A 2GESA 1WKBA 3L6UA 4A6PA 1DAKA 1NBMA 2VO1A 3DOFA 3CF6R 4JP8A 5JH7B 3C0KA 2C37A 4C2UA 2PNJA 1M10A 1P6UA 1T6BY 1XCBA 3GVPA 4IJWA 5K7SA 5BPFA 4FIDA 2XQKA 5JCPA 1H3EA 1D03A 1GIAA 4Q4CA 2IZOA 4HC4A 5C35A 2B9VA 3LBNA 5LJLA 5DLYA 1XMQB 1XZAA 2Q5QA 3GAMA 3FOEC 2PRYA 3F5DA 2BM0A 2QAGB 4RD1A 1UDXA 3DZHA 2X0KA 1RYZA 2OO5A 4RQTA 2NNWB 2ZDHA 3UW3A 2YW9A 3H11B 4OYLA 5LLTA 4KC0A 4EPRA 3UW1A 5C52B 1NLFA 4J8PA 4KJZA 3VI3B 1F7UA 4Q19A 1DIBA 1IXSB 4UZSA 3H2GA 1VBKA 1UQUA 4M89A 2G08A 4NL4H 2VQFB 4LXQA