2GQ0A

Crystal structure of the middle domain of htpg, the e. coli hsp90
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
256
structure length
256
Chain Sequence
AQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTSLLYIPSQAPWDMWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLNVSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDAEKYQTFWQQFGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein htpG
publication title Structural Analysis of E. coli hsp90 reveals dramatic nucleotide-dependent conformational rearrangements.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone, hydrolase
total genus 79
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.6.4.10: Non-chaperonin molecular chaperone ATPase.
pdb deposition date 2006-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2gq0A01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gq0A02
1Y4SA 2O1UA 2O1TA 3HJCA 5FWKA 1USUA 2CG9A 3PRYA 2O1WA 1HK7A 1Y4UA 2IOQA 2CGEA 1Y6ZA 2O1VA 2GQ0A 3Q6MA 3Q6NA 2IOPA 1USVA
chains in the Genus database with same CATH superfamily
4X8MA 1A04A 3P5SA 3G8YA 4MVJG 5B1IA 4LZOA 3HUUA 1PVOA 1JLSA 2PBLA 2AN1A 4BO4A 5TR9A 5BVHA 5C4IA 3GPCA 1LDEA 1XV5A 3D4IA 2YJ5A 3M82A 4P5DA 5IUKC 1IY9A 1WY7A 1W0JA 2IXBA 5HKKA 1KJZA 3C24A 2I1WA 4JROA 5FBZA 4A2QA 4BX8A 4UNRA 1CDEA 3TVDA 3A4MA 1QH1A 3KR0A 4USKA 4IDHA 1YZGA 1YV9A 1U5CA 2V4ZA 5B1YA 2F8TA 1Z4NA 1T9HA 1Z0SA 2XEXA 4MRAA 3IERA 2GZDA 3KP1A 4L9SA 4NG4A 5BRJA 3R9XA 4MWZA 1G9XA 2E4WA 2H4ZA 5JWHA 2PMDA 1QE5A 2ZQZA 2CCKA 4FEYA 4HAUA 3T7JA 4ALJA 1LI7A 2VCYA 5DBFA 2X6QA 1GO2A 4AY3A 1CULC 4WA8A 5BSGA 2CLEB 2I7VA 4FBLA 5FA5A 6NULA 1DV1A 3Q0EA 3QHPA 2WUEA 3BICA 1V0JA 3BMOB 3QEAZ 4IXDA 3GAFA 5LMUE 1Z6PA 1AQIA 2R85A 1D1SA 1US8B 2FMXA 4F6CA 2BFNA 1JKXA 3TF5A 1YL7A 3DV2A 3CVXA 1KEPA 1K7XB 2NM0A 2DQYA 4NZZA 1RYHA 3EW9A 4XJVA 1CQIB 1GFZA 1N3IA 2QVXX 3GRPA 3RFUA 1LK5A 1XCJA 4WXRA 4J0FA 2I8CA 2UYQA 1J7JA 3OLQA 4PFSA 3U4GA 2V6BA 3RTDA 3MGCA 3OIYA 3AO0B 3KU1A 4CKWA 3J7AC 1LSJA 1AKNA 1XRRA 3CSDA 4LZZA 4AS1A 1G4HA 1JWLA 4EI2A 2O1TA 2K7FA 3DE1X 2M1ZA 3O03A 4R40A 1QP8A 1NXXA 4MLZA 5EMNA 3E2PA 1Z4PX 1ZFNA 3B13B 1Y8QA 5FOSA 3KOXA 1KDTA 1NVBA 1KBZA 1OILA 3A1VA 4HGRA 5G40A 2AI3A 1G60A 1VLZA 3OD1A 4ENVA 3RIGA 5ELXA 5HILA 1OZHA 1ZHFA 1PE0A 4L8LA 1KEEA 4WV3A 4R9SA 2QZPA 1NW9B 1TYDE 2VS1A 8ADHA 5I9TA 1DAHA 1KFBB 5IAEA 3KJFA 1NXVA 1ZGZA 5C1IA 5DK6A 3WJAA 4P34A 5JEAC 2HA4A 2VXOA 5AVYA 3OZVA 4RZ3A 1ABEA 3KAJA 4HDQB 1GKYA 1T91A 1SQ6A 4DLVA 2QX4A 3L0PA 4MA5A 1TC1A 4JSRA 5A4AA 4MEJA 2RGCA 1EZ1A 1TTTA 3HG7A 1V9SA 2P5SA 1FFHA 1WDKA 2XYPA 1Y1LA 2YMPA 4S24A 2Q1SA 3KDAA 5HE8A 1EWVA 3ZLJA 2Z6QA 3BK2A 1LS1A 2FQQA 2OC9A 4US2R 2MSCB 1YZQA 4DF3A 4F0JA 3D5EA 1BX3A 3HC7A 1IEVA 1U99A 3LT1A 1EESA 2EQAA 3R7SA 4UUMA 3OFJA 1NMYA 3BE4A 1S2NA 1OYRA 4FKMA 4LRSB 4F85A 2G07A 5EQFA 1SCKA 1H0RA 4BIMA 2ZRQA 4BQEA 2GJ9A 4UARA 1CRZA 1ODJA 3HXMA 1FFXA 1AQLA 1GKIA 3PT9A 3V1NA 1NSTA 1D2AA 4HQRA 2GO7A 1S4EA 4LDJA 5DOZA 1G6Q1 4TXNA 3TSZA 4DCMA 3EH2A 1L9KA 1KARA 1WU7A 3B53X 3L7OA 2WB4A 2P9JA 5FDFA 3L05A 5TLSA 5IK2A 3EWAA 2ZUTA 1FQKA 4ZFNA 1VM6A 1BXKA 2VDQB 2YNMD 4Y30A 1PIWA 4AO6A 4RL4A 2QGNA 4N5LA 3KNZA 2VJAA 1JIIA 4M9QA 4EB6B 2QGFA 2Q6LA 2IGTA 4DYDA 4J0KA 2O8CA 4JI0E 1Z4OA 3MN1A 2QN7A 3Q6IA 4D4GA 3VFDA 3NZEA 4AMYA 1Y7TA 1PJ2A 4FX5A 4RADA 4MGZR 4WMLA 3WICA 2DFLA 4WADA 4D8TA 4DR7B 2FUG1 1U8XX 2PXXA 3D7LA 3A1UA 4O4HA 1XOIA 3CRMA 3UHMA 4YDSA 1RM0A 3B2NA 5ARBA 2OMKA 3N70A 1KVTA 3I42A 3AFMA 3L3BA 2IH4A 4RHFA 5DCLA 3BK7A 1ETHA 4KK3A 4KVAA 3K1JA 4KQFA 2WYHA 2ARKA 4QBTA 4OVKA 1MVLA 2CFCA 3V46A 2FRXA 2PUEA 1GQQA 4RLQA 1R7RA 1W49A 4LYHA 1XNJA 4AF7A 4YUYA 3V3TA 4AN4A 4OMUA 5D5HA 5KC8A 1TFRA 2FEPA 4JLWA 4AU1A 1NBWB 1DAIA 3VR0A 5CNMA 4GD3Q 4GOLD 2D2IA 1IZ0A 3NGMA 1UBLS 2R4UA 3SBOA 3BFVA 3BB1A 4BNNA 4H3VA 1SXQA 3O83A 2AK2A 4YC7A 1MTOA 1Z62A 1LQUA 5KTYA 1V5WA 1YQDA 1P7CA 3N76A 1ML3A 4MEBA 3AR8A 2V7QA 3KIPA 3Q6NA 2B2XA 5JEDA 1XE3A 3KYIB 1C7IA 4A0HA 4NNJA 2C37B 4N1AA 3WSTA 1GQSA 5FYQA 3F5DA 3RCBA 4YRSA 1ZJWA 5CB0A 1DADA 1WV1A 3UG7A 2QD5A 1W8DA 4F2GA 3C6QA 3EWIA 5LKRA 1JILA 3QW4B 1P0FA 2ZREA 1C1YA 3FOBA 3VDRA 1B8OA 4CLOA 1AHNA 1EU1A 1ZD9A 1L5SA 2VJMB 4HO1X 4YR7A 5HRUA 5KC9A 3P9IA 4ZT5A 2PWYA 3FPBA 4Q9HA 3TIXB 4D3FA 4EYSA 5A03A 4JI2I 2GK3A 5ULLA 2WNSA 1JIQA 4NS4A 5CB4F 2JHCA 3ANSA 3MAJA 2WOOA 3P2YA 1RMTA 1OJLA 4R51A 1JDZA 3TCNA 4QOHA 1E3PA 2WAYA 3C43A 3H42B 1CJKC 2CN1A 4PYIA 1U7TA 3F46A 2EGHA 2OAGA 5BR1A 2BZSA 2GK4A 1PFKA 3PWKA 4G5YA 1HDGO 4LTNA 3AK4A 4MWOA 3SWWA 1CQZA 3G6WA 3IQXA 4QE3A 5T4FA 4B73A 1XRLA 4DDKA 4HHEA 2Y1DA 2YC2C 4JH0A 4PZZA 5DWDA 4D0RA 5IAAA 3JQFA 5CVEA 4B0PA 5KYGA 1IBLB 3BSFA 2PBFA 5HW0A 4JYBA 4C07A 3W6PA 2UZ1A 5GZ6A 1C9KA 2H1SA 1ZJZA 4CF5A 5FHQA 2BFAA 4P4SB 4KPUA 2ZZNA 3A6ZA 2GDJA 3K9QO 2FX2A 3AIIA 4NZYA 4FNAA 1XDSA 3DBLB 3JYHA 2UVQA 4HYQA 3VRHA 1MV8A 4D9NA 1HNXB 1P1CA 2BR3A 3JQ6A 1VI6A 2Q5OA 5JWOA 4MS3B 1P0IA 5TPZA 4AWAA 1PWEA 2IZ0A 2HRRA 4MHOA 4XVUA 4C7JA 2ZEJA 3PNLA 3U7QA 1AUQA 3HBMA 4L95C 3HB9A 5LYJA 3U44A 1U0SY 3T3MB 2BP7A 3HYSA 3HJCA 4DL9A 4DPLA 4HVCA 1VPWA 3VNUA 2I6FA 4LK2A 2JASA 5HG0A 4DUYB 3UBMA 3QE9Y 3RM3A 2VWPA 2CEAA 4FT2A 5DNDA 3CVWA 2QTCA 3TMAA 4V0QA 4RSMA 4H6WA 3TLMA 1O95A 2QTMA 4DR1E 4ARZB 3KEQA 4DPYA 1SIOA 1ECBA 4G5GA 4GPIB 3MNFA 2ZRCA 3L40A 5EN4A 3WYFA 2RAPA 3JR7A 3TI9A 4P4TA 3HRHA 2JJMA 2OCDA 1YA4A 4H7FA 2ZSBA 3W5UA 5SY4A 4UBMA 5HBRA 4OLAA 4O2AB 4HBGA 4LWOA 1BIFA 2CNWA 4MR8A 1P75A 3H0CA 2VJOA 3T9BA 1EKXA 3L6BA 5J2TB 1YQ9A 3SAJA 1U6JA 3SS9X 1USUA 4NYIQ 3UMCA 4CLHA 1N2ZA 3GDGA 3ZJUA 3T7TA 2WM9B 1KS2A 1PIEA 2X2PA 2Z2JA 3RRBA 2XYHA 3ZS8A 1JYFA 1CY6A 4E5MA 2C29D 1FW8A 2CL0X 3E0XA 5HKOA 3H5VA 3G0HA 3ICEA 4FB5A 5IZCC 2ZXFA 4W5QA 4I1UA 4V03A 3DZKA 3ESDA 1DJOA 1KP2A 3GGOA 1NZFA 1USIA 2JGKA 1LJLA 4RQAA 5JQGB 1TUBB 3QVGB 5H16A 3BRWA 2BD0A 3GC6A 5F78A 2ZIZA 3IMCA 4G1BA 4BNXA 1ORRA 4MK4A 4F8JA 1YGPA 5TVGA 1UZUA 4QDTA 2BM0A 4WK6A 2IEYA 1SC6A 4K40A 3ZWCA 2PH1A 5K01A 3L02A 4FYYA 4Z0HO 4C2AA 3RBAA 3PT5A 4L22A 4QBFA 4XFDA 5IH7A 3I6BA 3GFPA 3EA5A 1D7OA 3CLUD 2I67A 4P08A 1B8VA 3HMQA 4DVGA 4KYUA 2HWUA 5JPIA 4Q03A 2RHMA 2P30A 1FP1D 4N7RA 4CUZA 1VLLA 1S3GA 1RMYA 4LF8B 4U6QA 4QUJA 2XA9A 3N8KA 1OI4A 4I2NA 3LNUA 1FJGB 1S2OA 3G23A 3UJBA 2QWXA 1LVHA 2XOKD 3A4NA 4FK8A 3JWEA 5G0SA 2JBHA 4LTDA 2PU5A 3EXEA 1Z0VA 5KJFA 2JAUA 1V71A 3JZAA 3I0ZA 5IHPA 1X1TA 3D6TB 4KWTA 4B0OA 3DT9A 1KKHA 2PIAA 1A3CA 2QTHA 4TQ9A 4TTQA 4YP0A 5FTNA 4QREA 3ZGOA 2DAPA 3BORA 3TNFA 1WTAA 5EJ4A 3S81A 4ICIA 1FSZA 3B3JA 3EH1A 3JAKB 1XMOE 2X9NA 3F98A 3L92A 4MV0A 4JT9A 2AV6A 2QSYA 3WRYA 4QFDA 3KCQA 5DASA 3ED1A 1ODLA 4XIIA 4CMCA 4UVIA 2H8GA 2XHZA 3VZDA 5HDQA 3WQQA 2BW0A 1C1HA 1AQ6A 3CXUA 2JEZA 2VTEA 3SS7X 5CVTA 1TZJA 4WL0A 1YHZA 4GX0A 4YMSA 1YFKA 4BHTA 1E2BA 4LWPA 4Z7YA 5I7RA 3S1SA 4OX9Y 4UE2A 2AR7A 2GM9A 1AB6A 1F17A 1PGPA 1X3LA 2R8YA 3EDRA 4Q4LA 5AJXA 4OBWA 2ZT5A 1XVIA 1NVMB 2H29A 2ZVDA 3T1YB 3PGXA 1ZI9A 2F8LA 3DLCA 3N2LA 1IEWA 1H0SA 4P3YA 4YK7A 1PHRA 1QOPB 4EH1A 2R96A 1DQNA 1ATZA 1AN0A 2PL3A 4L16A 3S5JA 3OJFA 1OKKD 1UKCA 1W29A 3N59A 1D09A 2UZAA 1CS4C 4E21A 4FJ0A 4ND8B 3LL4A 4JBLA 3KD2A 3RKUA 2NZ2A 1UDOA 1TMGE 2X9LA 2OYSA 3C8DA 3D02A 4YFYA 5KTOA 1HQKA 3HSSA 1FYEA 3NTUA 4HNVA 4ZOLB 1Z0UA 2W43A 2Z1NA 3ABIA 3DEHA 3JWJA 2G80A 3G59A 2L69A 3LHFA 3M1YA 3RVDA 1Q17A 1Q74A 2M6KA 2JFNA 3W6ZA 3H87A 1KSHA 2JI9A 2EARA 2ZITA 3PGJA 5JTTA 1VIAA 2G0AA 4CBVA 3TH5A 2R1TB 1WPGA 2C8LA 5L3ZA 4EUNA 4GRIA 1TB4A 1R10A 1JI3A 3RS2A 5EKUA 1YJAA 3RUHA 4ER5A 5I4IA 1I32A 1UBSB 1VCMA 2V6JA 1CZUA 3HKEA 3IQDB 4PX2A 5EWMA 6GPBA 1KOFA 2CNKA 3H99A 4BAUA 5JCPA 5KQRA 3FIJA 1Z63A 4IZKA 1ZGAA 2GNOA 5INTA 3M49A 3X2EA 4BKQA 4G0NA 5F51A 1TRKA 3FBGA 5KQSA 1UL1X 3UMYA 4M36A 2BMDA 3KQLA 2C9OA 4QTXA 1N77A 1TYEB 2VEDA 3JVDA 4GE0A 8ATCA 3G1UA 3HXKA 5TQ2A 1XN1A 1ISMA 1HO3A 5CBPA 1LVGA 4N41A 3ZYCA 5EWLB 1WLYA 5BRNA 1R12A 1N2CA 1T4MA 5AR1A 4DMGA 4FWTA 3CMMA 1YS4A 4RA6A 2G63A 2WOJA 1PJCA 1C1DB 3LDGA 1NAIA 5K3BA 2O8FB 3I04M 4FFOA 4FDLA 3DL7A 5DYGA 1RYNA 4ZYWA 6AT1A 4LCBA 1RHQA 3N8DA 5HE9A 3TLGA 1TW3A 2W4IA 1Z73A 3BDVA 4M1SA 2CNBA 2I4RA 3CB2A 3UUWA 1CY0A 2Y6VA 1ICEA 2CVHA 1HTBA 2LD4A 3SQDA 3VAZA 1JSLA 1IN4A 3FKSA 1XHLA 4B2PA 4BYGA 4HZUA 1X74A 2GASA 1SBIA 2XY4A 2ZJ4A 3M1IA 3ZW8A 4TQAA 4ETWA 2Y92A 3EAQA 5IC4A 1TA0A 4W6QA 1HDOA 5BMOA 2PNZA 5ALWA 3GLHB 1XKXA 4FDAA 4ER0A 3V7NA 2OPHA 4X7MA 3ZCQA 3IMKA 1RM4A 3W6UA 2ZTSA 3SMVA 1L1QA 5KNCD 2R8BA 1UMBB 4K9RA 3O2JA 3OO0A 3P9SA 1Z6YA 2HXYA 2FWAA 3QE3A 2H59A 5H59A 2SBTA 4LI3X 4YV1A 3AOEA 4IFDC 3OOEA 4ZEOA 1X87A 2CDAA 4JB2A 1IIRA 1IZYA 2LW7A 3STYA 4AO8A 1OB2A 1Z6TA 4UTPA 2V2VA 4H1TA 2FUEA 4E2XA 4D81A 4EG8A 4G65A 4MKZA 4UMDA 2QT0A 5FPSA 5BQXA 4YMWA 1Q3KA 2XGMA 2Q4BA 2A1TR 1ONBA 1V1MB 4B82A 2ZSJA 4IVNA 4HXEB 1LRLA 1X7ZA 2QXYA 3F96A 5EIFA 4YQFA 1GM5A 4HNRA 5L6MB 1NFFA 1Y4SA 4BIIA 3BT7A 1XMVA 3WLRA 2IS4A 4HRXA 3JS5A 3HCRA 4DA4A 3KX2A 4KXXA 1U0LA 2PUTA 4MKRA 1CC1S 4UXHA 4E88A 2GCOA 3LO5A 5LQCA 1JFTA 3I28A 1GXSB 3DPUA 4X20A 4MULA 3MXTA 1ZD2P 1Z0AA 3DL4A 4PYQA 3BA1A 3X3HA 3ZI4A 3SXJA 4BGVA 3Q9NA 2R84A 3QJ5A 4YPVA 1ST2A 3HEMA 2XTAA 2P1RA 4H6VA 3AW9A 1X92A 4IIVA 2YUTA 3UGTA 2WP8A 2R3SA 3EWSA 4XYEA 3VKWA 1GGFA 4EFMA 1EE1A 2J33A 4PLYA 1XNRI 2OCLA 4UTVA 2KPOA 1Z8NA 2VJCA 1QGDA 1U90A 3ZN2A 1V4BA 3CLSD 5TMPA 4OHYA 3WNBA 1M34B 1R0RE 1TK2A 1VYHA 2PTGA 3FIUA 4BA2A 3OM1A 5EXXA 3FUVA 3ZD7A 3HMKA 2YHBA 1RLUA 3GCGA 1BXRB 4AQYE 4Y18A 5TQVA 1ZUD1 3Q41A 1C7JA 4FW4A 1O6ZA 1PJ3A 4OBBA 2V2QA 2GAJA 4R1NA 5FT9A 5CFOA 3EEOA 2EV9A 1XHKA 3ML1A 2N0SA 2CCGA 4FCCA 1ZGHA 2B9VA 1JB9A 4HNUA 3UMFA 3PLRA 4YDHB 2QN1A 4YRAA 2FMTA 1T4CA 4BVFA 4QOIA 3L4JA 3SSOA 2FZ4A 1H2AS 2ZJYA 3HBJA 4MW7A 2IOHA 2WB2A 1B93A 2ODNA 4XOIA 4WLNA 2PQ0A 3TR5A 2OZLB 4FGJA 4ALKA 1NG1A 1ADJA 2D2FA 2G0TA 3DP7A 4QELA 3PS1A 1E6EA 3NATA 2VYNA 2XDYA 4OQDA 3RNOA 1QFXA 1UJ5A 3CCFA 4I1VA 5DVZA 1RWOA 1YUNA 3HH8A 3FNIA 1X94A 4KNVA 3HXOA 1R37A 3DTVA 2Y3IA 3VZPA 5GONF 2E4UA 2X5NA 2OBYA 1LPSA 2DPHA 4B3MI 4G5XA 4MDYA 1NAHA 3ES9A 5C0XC 4GQAA 5EQJB 5C35A 1N32E 4XJTA 4LOIA 2QDXA 3VR4D 4PAQA 4NBLA 1T5OA 5TE9A 4GEGA 1UH5A 1STOA 3A9VA 4KXVA 5BVHB 3QBEA 5IM4F 4EUHA 1D8AA 4N6GA 1RWVA 3I23A 1ENPA 4KLCA 4ZANA 3TEMA 5JZOA 1H4SA 2NGRA 5I3CA 2NT4A 3C87A 3PUHA 2BH2A 4B4KA 5BSVA 3MB5A 1UJBA 2ZBGA 2A9RA 4B6JA 1MGOA 4MW6A 5K4AA 1YXMA 1Y1PA 3L7ZA 1SCBA 1QH1B 3NJRA 4QOEA 4QQ8A 2OYCA 3GIWA 4ARBA 2A5GA 2WYOA 1XO1A 1Z83A 5FFMA 3UXMA 2PKXA 1P1JA 1YIDA 2X8LA 4JOQA 1V1RB 3HYNA 4AMGA 4TKVA 4ZCTA 3BX1A 4HD8A 5FQNA 1J0XO 2DP4E 3DCJA 1JXQA 4WHMA 1UOQA 5FNVF 3CSSA 4B6OA 3WG9A 4IS2A 3UW1A 4HACB 3DE3X 3EIUA 2IH5A 1ZCJA 4Z7JA 1PDOA 2QD4A 4FHCA 5KTTA 5FLXQ 4KXUA 4YJHA 4G0WA 3QUQA 3V4FA 2OKCA 3K3PA 4OJYA 1VHQA 1CK4A 3CW2A 3WFZA 4EJMA 5AUOB 5JNRA 4EG6A 3HKMA 3E9NA 2PUFA 3CGGA 1E0DA 3PKJA 3TD6A 4IIYA 1NYQA 4P1ZA 4GPZA 4DV3I 4HBZA 4RJKA 2G76A 1I5EA 1JVNA 2Q3JA 3STWA 2IX3A 4Q37A 1EJBA 1THMA 1RXCA 2PX4A 4ISCA 4WT7A 1NLYA 4IFDB 4D9CA 1T25A 3W3AH 4ZZ0A 2FMFA 5BVGA 4DMFA 1N0IA 3MXOA 4ESEA 1L1EA 1QO9A 3SEZA 4BCBA 3GRAA 2JEOA 1YU9A 5EAIA 2O8FA 3X1XA 2HRCA 5GWXA 3WGUA 3BCRA 1YI0A 3H84A 4RWZA 1XSEA 2QRPA 1XZQA 2RIRA 2BEKA 3INRA 2BJWA 2C58A 2I3DA 1Z0TA 4IR7A 4JUIA 2W00A 2WJJA 1NW5A 1Q14A 1O87A 5EHNA 5H4HA 1F5SA 5GMEA 1L4BA 2FW0A 1PX2A 3C70A 3NRBA 3EXFA 4RENA 1E32A 2POQX 3B1YA 1RWQA 4RFVA 1Q12A 1EJ2A 4S04A 1LK7A 2VHYA 4I50F 3T7IA 4D8WA 3W2HA 3GFRA 1B43A 3FRJA 2XKKA 2YUIA 1E9AA 3FVTA 4M1MA 1FSPA 4BLRA 3UW3A 4DXHA 1K7SN 4NBSA 3GF4A 1MJHA 1BCRA 2A0KA 5E38A 721PA 2BE9A 4U3BA 2XA1A 2BFCA 3ANYB 2IIBA 4HGPA 1DQPA 3R23A 1G9SA 1QIHA 3JAMQ 5BT9A 2PPLA 3CT6A 3UANA 3ZDQA 1MAAA 4AW9A 2VQEI 1WOYA 2B4RO 2XKBA 1Z0EA 3BTUA 1FNMA 2CLHB 2WE8A 1F0KA 1FQOA 2PKQO 4JLJA 4C88A 2HJHA 2HSDA 3UC9A 4P0QB 4P4GA 3RC1A 3BHMA 1C9NA 4CTKA 5CDUA 3WGZA 4BB6A 1PEYA 5D01A 1SBHA 3WL5A 4M9UA 3PNVA 4YN3A 2LKDA 3KQPA 3R5JA 4WLEA 1KFEB 3WLTA 4LSMA 1RAIA 1Q3TA 2RK6A 2V8OA 4PM4A 5JD4A 1LH0A 5C34B 4DV6E 4G0XA 4TWBA 4X92A 4YCSA 3VVLA 1BNCA 2C7GA 2Q62A 1J24A 2AX3A 2VHEA 2PYDA 1ZD4A 1PGNA 4IXNA 3SS8A 3RYCA 1NBOA 4K6KA 3RSQA 2DLCX 1OREA 5EJ8A 1TCVA 4MVJD 4GKKI 3OJ0A 3RRJA 2VNKA 2O8NA 3ZOZA 3ZU3A 4E11A 3M6FA 3Q3HA 3HCNA 2IHJA 3L1UA 1MG0A 5E9JA 1CRPA 3HBAA 3OMWA 4EKGA 4QATA 3OWOA 1D6JA 1TK9A 5C1DA 4L5AA 2NZVG 2EWWA 2G5TA 4TL7A 1DPGA 4DCJA 4N9QA 2O8CB 5L6LB 5C0XB 4INOA 1QS0A 2ZUBA 2G71A 4MYDA 4KWIA 1Q19A 4TXJA 5D3KA 1GZDA 1RNLA 1RYMA 1Z56C 3GAMA 3O8LA 4DREA 4EVSA 4J16A 4XVHA 4Y6RA 1C4KA 1MV5A 3Q3GE 3OFKA 4O4HB 2A14A 1QLJA 5GONA 1H8HA 3OFNA 4KAFA 2FMKA 2PSSA 2WIKA 3UT0A 1U2DC 1T9ZA 2RH4A 1EUZA 4YGXB 3NWOA 3CLTC 4DPMA 3TNLA 1KYTA 4AN1A 1GAJA 2GCIA 1X7XB 3F6YA 3PR2B 3QI2A 4OQFA 4MYRA 1Z13A 2B1QA 3AEUA 1K4KA 1I10A 2X58A 4C3OB 2NZ8A 2GCGA 3AEZA 5IM4A 4HQNA 2OQ2A 1TYAE 3ER6A 1ULUA 1PL6A 4Y1GA 1RVV1 2VQDA 4MO2A 4PC1A 4YDQA 3HVRA 3Q7RA 1BWQA 3SSNA 2QN9A 2VDVE 5BNFA 4DR2E 1JEQA 5ITZA 2NU6A 1R4ZA 2WA1A 2P4EA 3FHJA 3ZCUA 3IP7A 4MP8A 1DBPA 5FUBA 1H4VB 1CQWA 5DLPA 3D6VA 5FWXB 4JQSA 4E7OA 1WUYA 2AW3A 4O63O 3T1HI 1RWMA 3C3KA 3AERB 2Z9DA 3O47A 2W11A 4Z49A 1N1MA 1OA1A 2FPLA 3ROEA 4QXQA 1Z6QA 2QQ5A 1A4XA 3OF2A 3AUAA 4NCIA 3VU9A 3H75A 5FWYA 4CMBA 5HZHA 1CY4A 1OVGA 2W9XA 2BL4A 1F9EA 1GL7A 1GQOA 3ZZNA 3TRHA 3HDTA 1CB0A 1T1JA 4RTJA 5B58C 3CVUA 1NV8A 1ISIA 1SUWA 3LNCA 3P9CA 3D5TA 1KEKA 3IBTA 3NHYA 4NEHB 2DRIA 2CVQA 4YR9A 5GPBA 3KUKA 5JASA 4Q16A 1VIMA 4TUYF 1KH3A 1UOOA 5TF4A 4UM9B 3UK0A 4JC5A 5JCOC 4C5AA 2DQ4A 2VQ3A 1ORTA 4ARSA 2I7XA 4Q6BA 4BVGA 4QQKA 3JARA 4QYWA 1J99A 4HH0A 5AOCA 4YP9A 2VPPA 4TSFA 3WZ2A 4QKQA 3AVYA 4OKIA 4BN0A 4Z2YA 2F43A 4DVJA 4A27A 4UOZA 3VA7A 2RBEA 3NPMA 4BPRA 4WK4B 4G1MB 2Q29A 4N12A 4UULA 4KO4S 5CK5A 3W2GA 4ENQA 1E2DA 3Q8MA 2NYVA 3ZW7A 2E48A 3Q12A 4G5HA 4PY2A 3G2PA 5A62A 1WX1A 4C2UA 1EG2A 3WADA 4JI4E 4NZMA 1OCEA 4FZ5A 1JXAA 2A5LA 1KO7A 1M2WA 2IUFA 2RARA 2FW7A 1COWA 2Q27A 3OUZA 5I8WA 4KXYA 2V5AA 1ZCAA 2J85A 3ADPA 3I2YX 2O8EB 2UZ1B 5K3OA 1LLDA 2C95A 3FDFA 3RHSA 1ZDMA 1I4OA 4M6WA 4URZR 2PSEA 4IDGA 4W9NC 4KPUB 3GJSA 1A50B 1MZVA 1OMOA 2ZRBA 4J1SA 5E4FA 3UOWA 2XZDA 4JNCA 9GPBA 2G1PA 1BMDA 4WCVA 1LLFA 2A2ZA 3FZNA 1GLGA 1FRQA 5BN5A 2HMYB 3BJZA 3E23A 3OQOA 3D7NA 3QFHA 1T8RA 1VJRA 3AR4A 4DCTA 3BXOA 1GPNA 4G97A 3MK31 3U44B 4WWHA 5JXWA 2NN3C 4QAJA 1TCCA 4FN5A 2ZYSA 3K0BA 3EUEA 1FU7A 4E46A 3H86A 2JGLA 4DT1A 1I80A 4U7FA 3U3RA 3MGBA 2ODPA 7REQA 3IUYA 2FUCA 4JI5I 2JI4A 1JNXX 2N9UA 2DUUA 2Q07A 2V7EA 3J81k 4AKEA 1I33A 3TXXA 2WMOB 1AQJA 1QQ7A 1V1JA 2ZRKA 4ENPA 1LDNA 2C04A 4EMDA 3GT7A 1YR9A 3ZWYA 5AW6A 2ZCJA 3VU1A 3FNEA 1E1CA 2HIGA 2I6QA 1EK6A 1FTWA 2OHFA 3HY4A 4AROA 5EIEA 1NN5A 2FG5A 2Q2WA 3TJMA 4AAYA 3M4XA 3G49A 1G42A 3LVQE 4GDMA 5DGTA 1HT2E 5C8XA 1LF5A 3WBFA 2NUBA 4P3XA 4Q4AB 1RC8A 3DDCA 4KK4A 1GOTA 3HJFA 3JVVA 3S40A 1SXJE 3D81A 5BSUA 5FLXC 2GR9A 1W96A 1IY8A 3NDRA 5IXYA 1G8JA 1ZCBA 3ZXIA 4CF6A 1YVEI 1MNAA 4BLOA 3JZMA 3MF4A 3U1TA 2HFSA 4DQUA 4UUNA 5JXGA 4FBGA 4N0QA 2I80A 1PSZA 4HWTA 3PENA 5ALXA 3R8FA 4FQ5A 4CR8A 1FOEB 1ZZEA 3R0ZA 4LCJA 3VR3A 5CR9A 1YFZA 3GLIE 2X8BA 5JRDS 1WS6A 1CF2O 2IW3A 2G70A 2AJDA 5I3ZA 3VR2A 4E3ZA 4NARA 4JC0A 5AOVA 1OIXA 4WUDA 1ZC3A 4DR5I 2E82A 4DSNA 2HHHE 3GW8A 3OZTA 6Q21A 4Q1BA 3K85A 1P31A 2LZ0A 2VP2A 1U4OA 4H6XA 2QAIA 4QNNA 4H59A 4X84A 4Z3KA 3L8EA 4EAAA 3G9TA 5ES4B 1NFRA 4GL2A 1PJBA 5L3SA 1BYIA 4CNBA 4XUGB 3MCZA 1WE2A 4KLAA 1WL8A 1LUAA 1NULA 3AYXB 3KSZO 3ZHVA 2IELA 2O59A 4NDNE 4DLBA 2FE1A 3HFSA 4PSUA 5KMGB 3VVCA 4KQ1A 1JI0A 1Y89A 1JGTA 4EA7A 4GLLA 5EJ9A 1AGXA 2PDAA 1KXJA 3IHWA 4WZZA 3RVMA 3F67A 3KQNA 1H9CA 3ISVA 5DNUA 1HR0I 1EDDA 3UPDA 4CGYA 1MRZA 3GMDA 2E3JA 1J2EA 2JCXA 2I78A 1K0FA 2GRUA 2OD9A 3AZPA 4IGKA 4YP7A 3JAMC 3LDAA 1EUCA 4B8YA 3AUKA 3Q88A 4LV6A 1EDOA 1L7EA 2PBRA 1N8KA 3AR6A 3EXEB 4PNEA 2VPIA 4GRAA 3ENQA 4Q9LA 4DLNA 1P1RA 3Q40A 5ICFA 2QZZA 2WYWA 2Y1KA 5LMNI 4OXKA 4TUYA 3DWFA 1RRVA 4UFPA 4IRUB 3L0YA 1L6RA 2C92A 2ONCA 4XEUA 3LT0A 1YDGA 2HSJA 2FA9A 4IWXA 2NTVA 3NIGB 5IFKA 2YR0A 3OPVA 4BGUA 5CB4B 1R5OA 4RCVA 4KQ2A 2IIQA 3PNKA 4PZLA 4YROA 4KX3A 3MWLA 2GPJA 4UJ5A 3VX4A 3GH3A 2IP1A 4W7IA 2HJWA 1Q1AA 2J31A 2OZVA 2Q9CA 3LBFA 3LQKA 3M4ZA 2IDJA 4R83A 1T10A 2IHYA 2QPOA 3QUBA 2BGJA 1T9GS 2PFKA 1CYEA 1PDVA 3T3GA 3KLOA 5A9SA 1TE2A 3THOA 4J0HA 1E63A 2PNMA 1EWRA 1WXIA 1NUTA 1OX6A 1QRAA 3GVHA 3K1AB 1T4BA 4YJKA 1JR3D 3EEBA 4PZDA 2FG7C 2QU8A 4IL5A 3RV4A 3T9EA 5C7IO 2ADOA 3NHAA 4QT4A 1U5AA 5TS3A 2GZ3A 3CN7A 1J1UA 3K7EA 4NS1A 5CVCA 3WDSA 1P0CA 2ZBKB 2EOAA 1BFUA 1XD2A 3K0AA 4IZJA 2GD0A 2C3OA 2H6EA 4Y9SA 2OEPA 3FJYA 3BJEA 1GRNA 3IPRA 3ENZA 4QVGA 1MB2A 3U40A 4E5UA 1NV9A 3GP5A 1XNRB 2AFIB 1L5RA 2QAGA 4EPVA 1I2AA 3I72A 4Y98A 2HQSA 1Q84A 4LJSA 4F46A 5HK8A 1L8QA 3RUCA 3HI6A 3ICVA 3L7YA 3NAZA 1GGNA 1F8FA 5KREA 1KJ8A 4H17A 1ZZGA 2WE7A 2BC9A 1R8YA 4PYRA 4QUBA 4DIOA 4IUDS 2J87A 4QPPA 3OQ1A 4ENUA 3ZJ4A 4OHWA 3WAGA 1RBZA 3M6MD 4BFCA 4WOCA 4Z9FA 4EX6A 2MSNA 4XXHA 5ITWA 3CIOA 1GAQA 3DD6A 1Y1RA 1YA8A 2NYRA 4E0BA 1B00A 7REQB 1R6TA 2G09A 4OX9I 1NRJB 2G67A 2YS7A 3HJNA 3HKEB 1NQWA 4ZVKA 1HKUA 2J08A 2JARA 2HQ1A 5EWMB 1GFSA 1NJSA 3WNVA 2V7TA 3MWKA 2NSYA 4IZKB 3QZUA 4P53A 1DT3A 1E5LA 4EI7A 2CHQA 4XIYA 2BI7A 2C5BA 3RYIA 2VPWA 4HAOA 4ZAZA 3HCCA 1O5IA 3K53A 5GADl 2LV8A 5TQ2B 2YHUA 4JELA 4UHDA 4YAJA 4D9MA 4I6EA 1WA5A 5CBPB 5FH9A 5HQJA 4B3MB 2ZM6I 3K94A 3SJCA 3ISTA 1YQGA 2OTCA 3KDPA 4EHJA 1SBCA 3GFOA 1T5TA 2W4QA 4RGBA 3I2FA 4JVLA 2PE5A 2JIPA 2OCPA 3WL7A 1H9AA 5CIYA 1EUQA 5LQUA 5IAOA 1Z16A 3ZM7A 3TLGB 3B7GA 2ZFUA 2P1ZA 2VSYA 2X7IA 1JU4A 1ZA2A 2CDNA 2FK7A 1ZVQA 3KUXA 3KZCA 1FNSA 4JJGA 2OB1A 4HZUB 5F7XA 2AEMA 3EZYA 3QOWA 4F45A 1L7NA 3GGJA 4WEOA 4RY2A 1LC0A 2CDCA 3V8RA 2PNZB 1DCKA 3E3LA 3JQEA 2Z5BA 3CH5A 3RC9A 4X90A 2MWMA 3G2HA 2H65A 3I62A 3CX3A 3T5PA 3D1LA 1F6BA 2L0XA 2Q49A 3PJEA 3ZHTA 5ADUS 4R2IA 2QLTA 1I30A 1FFDA 5JJCA 4Q66C 3UXEA 2Q28A 3PUJA 1O9BA 4N3NA 4R4JA 2H08A 3RBXA 4BUZA 5EL9A 4EJFA 5HKAA 4WZ6A 2PGAA 4DC1A 4TRRA 4Y7CA 3RU3A 4RVHA 1P2DA 1OAOA 2XF2A 1EAMA 4BGIA 2XJ4A 3GRUA 4XIGS 1TF5A 4YRTA 5A7HA 4EUSA 1HTWA 1ZOSA 2NLOA 5JNWA 3A6FA 3BWCA 3AILA 2V9CA 3DGFC 1Q0SA 1X7ZB 1CZLA 3PYFA 1I01A 2VHUA 1NYLA 4DV3B 2Y0PA 3BTSA 3WWZA 5DRRA 1ECFA 1SHLA 5A7FA 1W0JD 4IJKA 4PBTA 1Q6YA 4ZK6A 5HKKD 5C32A 1G3IA 3CTPA 3L0BA 4XR4A 2WNRA 4YO8A 5KQPA 4JWTA 1QG4A 3LGSA 2QRGA 3SSMA 2WJ4A 1Z0ZA 3QT7A 3OJCA 4K6CA 3D8RA 2D4AA 2XD4A 5KAPA 5JEEA 5SYNA 4BUJA 3SNHA 1N0HA 5M7EA 4EGAA 1PI3A 2D1YA 3RVKA 5BSEA 2O0HA 3VPGA 1L7QA 4FCTA 2WP8B 5JZVA 3KUDA 1QHGA 1QKJA 5F64A 1ZKMA 1B23P 2IVFA 4D8UA 3I2HA 3OT4A 1TZKA 5LDGA 1QYIA 1RYEA 1Y3DE 4MINA 1GP2A 4HLUC 5E1OA 3GGPA 3M3DA 3T5TA 5IWAI 2V98A 3PUVA 4BA2B 3QNMA 4LYAA 4O1MA 1INLA 5F1YA 1WXXA 2WI8A 1R6MA 4X66E 1JEAA 1JQLB 3NBXX 3AMVA 1VGQA 4LZJA 5CDSA 1ODCA 6ABPA 3DW3X 1IRIA 1D0SA 1P72A 3N5CA 3UOGA 4JS0A 1KIJA 1THZA 4NPCA 1J5PA 3WGQA 1PJSA 4OP3A 1E3WA 1U80A 2H1LA 1PNVA 1TUIA 2Z3WA 4BX2A 2PZAA 1T4CB 1XXLA 2B8NA 3GT0A 3RFCA 3TPFA 3D8UA 3E81A 4ETMA 1NNEA 4GI3A 4BNHA 2VQEB 2V6MA 4EJSA 1Y1TA 4YV2A 3CGWA 4KQCA 5IF3A 1SC1A 3MSXA 2C39A 1JBQA 2ZJAA 3JD4A 4TRNA 3CEAA 2XUQA 2ZJBA 1P61B 5I7UA 5H68A 2W90A 1JPVA 3C97A 6YASA 2J5RA 3V7FA 4AJJA 1ZY2A 2C94A 5FJIA 3RS3A 1V2HE 2W22A 2XUPA 4M1EA 2ZE8A 3UHAA 1WUKS 1ZK4A 3FHOA 3I6ZA 2G04A 4K8RB 4YRCA 1BFKA 1K9SA 2E85A 3P9QA 2O2XA 3FPHA 2BGGA 3GZNA 3P1JA 2YOGA 1ISRA 5JYEA 2PVCA 3G2OA 1ISHA 1W1UA 1ZG3A 2WVGA 3R3UA 4CIYA 3RSCA 1EWQA 4ABYA 3QU5A 2RG1A 4I5EA 5F5NA 4GKKB 3COJA 3DL2A 5HHTA 2XUDA 3ER9A 3R24A 1U7HA 3P19A 1C9EA 3VNQA 1Z4MA 2EP5A 2WG0A 1ORWA 1UCFA 1XMXA 3N0XA 3RVBA 4EFKA 1HOTA 2DHCA 4P31A 1GTL1 3CXRA 1DOAA 4XAQA 1JHQA 3Q15C 2OI2A 1HM5A 4ZGWA 1NXQA 2JGIA 3L7ZB 3IPAA 4JSTA 2ORWA 2HRQA 5ITSA 5JYDA 1QDEA 2IH2A 1BG6A 1U3VA 4QUKA 4WXMA 3W5SA 2ODEA 3S27A 1BVUA 1YKSA 2CC2A 1ZK3A 3A4YA 1Z08A 4TKVB 5K03A 2E4XA 1OTXA 1Z0FA 1JEOA 1X7WA 2O2JA 4RC9A 4X93A 5FO1A 3SKYA 1R0ZA 1AX9A 2CD9A 3EXAA 2UZ3A 1Q11A 4CIWA 4N7BA 2W5UA 1JKMA 1NJ2A 2G4CA 2FY8A 3KE8A 1W4LA 2YWBA 3MAGA 3KETA 1E2GA 1WXFA 3AM3A 2M6RA 1U0HC 1VJGA 2FWJA 3BMNA 1TLLA 4GSKA 4IAOA 2GK7A 3LU1A 3IDOA 3RFVA 2VBGA 4DBZA 1DAEA 3FYTA 3T7AA 1SQSA 4FS8A 1GT6A 1UZMA 5IK2D 4K88A 4TRJA 1PVVA 4GZ3A 1XXEA 1DAGA 2UZ0A 1YZ3A 2ZI9A 3WL8A 1L3BA 5CD9A 4MR7A 1XZBA 2GXUA 3LDUA 4CCYB 2C5GA 1CY7A 2YWFA 1IHUA 3T1HB 3S2EA 3Q8XB 3PR3A 4WA7A 1TNDA 1NRWA 3QLTA 5BN1A 4AMZA 5K9ZA 5C0XD 1LW6E 1CVIA 2FFJA 1U3WA 3CPSA 1J5EE 2PHZA 1XXHA 3WLLA 1NQTA 4KR7A 2ZWVA 1FLNA 4J2HA 4UREA 1ZAKA 3TPCA 1RJDA 2C2BA 2GPTA 4NHEA 2VC2B 1FUYB 1YRBA 4QDUA 4L4SA 3LYAA 4IHJA 4RFSB 5JG7A 2VHWA 2ZW9A 3O31A 2XYGA 5DW0A 4TQUS 2OB2A 2YXPX 2GFHA 3CVYA 4DDMA 4MQ6A 2D7JA 3IOMA 1QIDA 1YR2A 2QTVA 4Y2XA 1MVOA 5KVAA 3N2NA 4HMPA 4Q9NA 5CLIA 4YIKA 1UMDA 2I6UA 4NCKA 3THYB 1B3BA 2ASVA 2F3UA 4MQBA 1JHRA 5EEHA 3TLJA 4BOYA 1RRFA 1BDBA 4JU8A 4OB8A 2O05A 1J8YF 3EOZA 1BCRB 1IHOA 2YMQA 1SUSA 3NYQA 2F1KA 4J07A 1YOBA 4LV8B 4PG7A 5F7OA 4HDAA 3L18A 4ND4A 3CH4B 1PS9A 2C2OA 1ZN8A 1KMMA 1RR9A 4CIBA 4NATA 4RV4A 3CX7A 1XDWA 2RAUA 3HDGA 2V5UA 3AF2A 8OHMA 4ON9A 1KDRA 2X13A 4ML3A 4FN4A 1W7AA 2RB5A 5LDHA 2V7QD 3PDIA 1FXWA 1UP6A 1M1YE 2HZ7A 3DNFA 4K9LA 4XEHA 2PCJA 3EGVA 2PRIA 3L0OA 4YI3A 5CNJA 5JFGA 5AVWA 2IXDA 4L9WA 3CO0S 3I6QA 4QDXA 3FHLA 4AYWA 2RHTA 5M2QA 3SQWA 5DX8A 4BXOB 4KXMA 4AY6A 4BV8A 1GPJA 5BWCA 2AZMA 5AW0A 1EZ4A 4O4IF 4LI0A 3WMRA 2DBYA 4X61A 5AJVB 1A9XB 4Z8YA 4D99A 5JYBA 3HEBA 4HH3C 3HZHA 1Z5AA 1YUBA 3DD1A 5HM8A 4UM9D 1EWYA 5ED0A 1JDSA 4FE4A 1PFGA 2A6PA 3RKSA 3H0KA 2B3DA 3KWFA 1TU0A 5JNTA 4BB0A 3EMKA 5AT1A 2HJVA 2QNIA 4C3VA 1G7RA 2GX6A 4GKAA 1A8SA 2P2ZA 5G0UA 1KZGB 1I9GA 1FK8A 1NBHA 1Q0LA 3U31A 3IH5A 4XD2A 4EATA 1BU5A 1FMJA 1R16A 2FSVA 1GQRA 1E61A 5DHSA 1Y9ZA 4JI5B 1QS0B 5E6SA 3WWOA 1DO2A 2P9FA 3K8OE 3M0EA 4YYEA 2V97A 1BEUB 2IBMA 2O2IA 3TE7A 2F9FA 1FRFS 3B7PA 1TD9A 2FCRA 5GONB 3F1LA 3VDMA 3WNZA 4EW1A 4IJ6A 4D26A 3THYA 3LHDA 4L0CA 1FLDA 2XVXA 2E0IA 3F6SA 3VPCA 1AZWA 1GR0A 5B64A 4FQ7A 3AETA 4HN9A 5KDOA 2PGIA 5KYYA 3PXGA 3S2YA 5U1PA 3NIFB 2QJFA 3NDIA 2OZPA 4UNSA 3ADDA 1PGJA 2AFVA 2O0JA 1D1PA 4MPJA 2PLWA 4KUGA 4QX6A 5K0EA 5T6BA 1L3IA 4BNJA 3MS4A 4M9ZA 2C84A 4MS4A 5TPZD 3IOCA 3NHRA 3R6LA 5AM5A 3SM3A 3SHWA 1P9LA 1F2UA 2Z8ZA 4EENA 2AVDA 1SD5A 2POCA 1MF7A 1ZEJA 2GHQA 1O9HA 2V7VA 4U8HA 1HMPA 2H1CA 2JKYA 2UU9I 1LZLA 1RLOA 2PUAA 4Q00A 1U1CA 4MKIA 1HUQA 3TZHA 5CU7A 2AMYA 4LFCI 1A8QA 5FNVB 1JIVA 4UU0A 2IUYA 3EDCA 5FWYB 1Z5NA 4DR5B 3CNHA 3HV2A 2EJUA 2G83A 3A58B 3WE7A 2X7XA 4H0FA 4ZVNA 4DIUA 4E31A 3IXQA 5CGQB 1FF9A 2YZMA 1LJUA 1O7JA 4TZKA 3AG5A 5FLEX 2ZT7A 4NCAA 2AKEA 3A6EA 4V0LA 5DRYA 5EFZA 3UK6A 1NZ0A 2F1OA 2RB4A 1S7CA 1U04A 4C9BA 4PIMA 2PS1A 2CNWD 2Y2UA 4KO8A 4K6MA 4G37A 1CUSA 1TQ6A 4DIDA 1NW3A 3B5IA 4MV9A 2ZCVA 3UG6A 1ECCA 1FVXA 4JZYA 1GNRA 3RG2A 1Q1QA 3JARB 5IVDA 1YVUA 5JSKA 3VC7A 4HXYA 4JI8E 2F43B 4KQWA 2NSHA 1HR0B 3CLTD 4GU5A 4GEKA 4WN3A 1Y6ZA 3H3XA 3IA2A 4OH1A 3ZWVA 4EHFA 5SICE 5EINA 1L5OA 3BB3A 1AXEA 4HAWA 4ZO8A 1OU4A 3N8GA 1L1FA 3RTCA 3T99A 5CDGA 1OZAA 5FI3A 1SQ0A 1FP7A 1SXIA 2IY7A 2PGNA 3UXHA 5IT4A 4IZIA 2WHPB 3GJ3A 1WP9A 1XA4A 5LMNB 4WUVA 4IXMA 4XPIB 3BRWD 3RAGA 4P82A 1TT7A 4C4OA 2C9DA 1AZSC 4MDTA 3HR4A 3K9BA 4I50B 1GL9B 1MXHA 4MPRA 1RWWA 1UC5B 1EZZA 4Q12A 1ESMA 4RZQA 2FN9A 1HLDA 1QHYA 3U7IA 1SOAA 4YCJA 4D4MA 4UDXX 1U65A 2O1WA 1F6DA 2DG2A 1J23A 2XQGA 3ZHQA 3AHHA 4C7MA 4C4SA 4FYJA 1Z06A 1N9GA 3C1TA 4IH9A 2JEAB 4LRWA 1NP3A 4PC2A 4TM8A 4UM8B 5DK4A 3VR5A 4RF2A 1E5XA 2FDRA 4MUMA 1NE7A 5BOSA 3P9ZA 4CRWB 3DLBA 4K6HA 3LLMA 2DT5A 3QF4A 5IPFA 5U9CA 4DMKA 3DHVA 1GR1A 2VOEA 3CURA 3NOOA 4DT1B 4DYVA 2D0IA 3N28A 2YXNA 3B6KA 1Z18A 5CJPA 3GARA 5L4LA 2IZ5A 4URXR 1S6YA 1LWNA 1PGQA 3ONDA 3QXHA 3INNA 1XVTA 2ZR9A 2PMBA 3O26A 3ESYA 1YH3A 2FH5B 3KKKA 4DJ5X 1C7ZA 1M2NA 1UFOA 3L8DA 4O4IA 3DAFA 1S4QA 3EXHA 4LOHA 4OZEA 4LJKA 2F1DA 3ZZ0A 4TWAA 4AI6A 1BJKA 4BJHB 4HKTA 2AX4A 4Y2TA 2VHZA 5T57A 4UQLA 2VHJA 5J4HA 3U81A 1KTIA 4CL8A 3LYLA 2J5BA 3CH6A 1XTBA 4C2BA 3PWTA 3BZBA 5CEEA 5IABA 2AOWA 2F1RA 4MHTA 1I51A 3MGGA 4W82A 1SIUA 2SKCA 4XOUA 4DUZE 3ZXUB 1Y7LA 2ZIXA 1N6NA 3QTTA 3JYQA 3R9KA 2I7DA 3U0VA 1C80A 1SA0A 3ND6A 5HZKA 2QA5A 3IO3A 1HXHA 5DX0A 4UU1A 4W7HA 2AN5A 1PR6A 4D41A 2A9PA 1DWPA 4OX9B 3INGA 1GPUA 5BN3A 2QTAA 4ARVA 3OG9A 4QQFA 3WK9A 3LV8A 4Z7QB 2AZDA 4EEKA 1MOPA 1CLEA 2G25A 2C2KA 4TYQA 3IBYA 4JD5A 1NONA 3Q5DA 3ZHRA 1QBKC 1Z4KA 4DKXA 3NDBB 3V9AA 4BE9A 3G5LA 4FMDF 5IASA 1II0A 2I1QA 1OBOA 3RC3A 2CLFB 5E8JA 5C5EA 2FJ0A 4MUIA 4AF8A 5FBVB 1LLCA 1YRQA 1N5KA 4V0RA 5H1YA 2XODA 4M98A 5DXJA 2ZM6B 3EZ9A 4Q39A 3R7WA 4PW0A 3P8ZA 4TTAA 3VDNB 2GHIA 1G8PA 2L82A 5C51B 3RS7A 4X3OA 5G3YA 1Z5CA 3QKSB 4Q02A 3TLAA 5JSUA 4F5WA 5LQMA 1KRHA 4QEKA 5REQB 2A2DA 4CTNA 4BA1B 3HWRA 2OPBA 4YLEA 3UICA 4B40A 1WXDA 3QXCA 3PHJA 4D97A 5FLYA 4B3TI 2X4LA 3IEXA 2OHJA 3MRXA 4G3XA 3KUUA 3O9VA 3LBIA 5HBGA 4C30A 3RVLA 4YJ3A 2AG1A 3MQ4A 3PKIA 4K9DA 4JB3A 3JCZA 4B84A 1EUCB 2Q1XA 2HSEA 1FUIA 1EE2A 3JZFA 1KI6A 3P0EA 2MCFA 4TLAA 1ADYA 4J1QA 2C3MA 2DF8A 4LDQA 3URMA 1RCUA 1ESDA 5AKLA 5EWJA 2UUBI 3LPLA 4TUYB 3KQSA 2Y0EA 2YX1A 5EA2A 5FB3A 4JI7I 2XADA 3U4AA 1L7RA 5KTRA 3KVOA 1M1ZA 3OVMA 1Q57A 2WT4A 3GK3A 4PE5B 5JEAE 2XDQA 4ZOQI 1DZIA 3JRXA 3VQTA 1YB6A 3NALA 1X9HA 1GGVA 4HFJA 1KKUA 3OLCX 1QFMA 4I4TF 4PC7A 5IKOA 4Y9RA 1QV6A 5ALZA 2FZWA 3LUFA 1SVMA 2PV0A 2J3IA 3HLYA 3H5TA 2FPWA 3VH2A 3JQAA 2FR0A 1K9VF 1PK8A 1N6PA 1Z7GA 2A7XA 3ASUA 3OZ7A 4G67A 4RJIA 5AK3A 1EM8A 5IUJC 5BNTA 3TW0A 1AGPA 3LBYA 4OHFA 5CXXA 1WV0A 4RIEA 4BO1A 2QRUA 1MQ8B 4BKPA 3JQ8A 1DTWA 2R6ZA 3I58A 4I0WB 3FKSD 4IBOA 2IOFK 4S12A 2DTEA 1AQUA 1DKOA 1OYPA 2RONA 2WTXA 2ZYHA 3C45A 4LZAA 2R6GA 3I34X 3ME5A 5E3IA 3D3QA 4O2LA 2IPMA 1E9VA 4L9RA 4G25A 3ADCA 1BHO1 1DKNA 3A9CA 4UBNA 3TLEA 2COEA 3W8DA 4DUYE 2W6OA 1GPWB 1LFDB 3U3KA 5E9QA 2G82A 4YP1A 4YAEA 2D2XA 2P0AA 2QAGB 1GZ4A 1PNRA 2Y2VA 5K45A 4WKNA 1QORA 3ZZMA 4MARA 2H2AA 2QXUA 4J1TA 4ZU1X 5IWAB 1AKWA 4ZAGA 2HK7A 4EBBA 4AK9A 3K6JA 1KOLA 1U7ZA 1U2GC 4YQZA 1UPAA 4BEWA 2GFIA 2NAPA 1UFKA 1NMZA 4HDNB 4BMDA 5KU7A 2JLUA 1G7TA 3FCXA 1CJUC 2PR7A 5AIBA 5FAKA 4Y2YA 1O94C 3IESA 4IX1A 4LQDA 4YH1A 1XX6A 3D0KA 1BDIA 1OOEA 5DSTA 3BWEA 2X3UA 2HNBA 2VDOB 5J59A 1CQJB 3L4BA 3TIGA 3B3FA 3DQZA 1JQJC 3JW8A 3QE2A 4MUAA 4FYKA 4RIHA 1CIVA 1UJMA 4MW2A 3A9TA 4YRRA 1L4KA 1R66A 3K8ZA 4DXAA 2J3DA 3RYIB 3MCAA 4ZVIA 2JFOA 1IUOA 2WJAA 2QUIA 2XNCA 3BMQA 2OXFA 2VRWA 3ONFA 1OLSA 4KODA 4OJTA 4FGKA 4TXLA 4CQMA 3PEYA 4BP8A 4ZAXA 4D9EA 3V7UA 3KU4A 3RVQA 2L42A 1QTQA 1RPJA 4RYDA 1VPTA 3L4EA 5B4UA 3HGTA 4ZQFA 2KI5A 2D2VA 2IPLA 3GVIA 5JBQA 2UVDA 2XZTA 2VTKA 3RANA 3U3MA 4IDDA 1L4EA 1X1BA 2VPQA 3NR2A 3RU7A 3UMJA 4UEOA 3CB4A 1CT9A 1D6MA 3B1XA 5T64A 5MFPA 4AY4A 1XJCA 4R31A 1V26A 3SEAA 4CE6A 1XQ6A 3V4OA 4JI6E 3OM8A 5ESRA 3DLHA 1Y4UA 1A27A 1G20A 1X80A 2D1FA 2R751 1T8UA 1W4RA 2MOKA 3LUAA 4KTVE 2JH3A 1T43A 3EBPA 2A30A 2WP8J 1Z15A 3N58A 4R9NA 1S8NA 4F3TA 1XCLA 1QZRA 1DZ3A 4RU1A 3JSXA 3LHKA 3WLQA 5HCNA 4UM7A 2G40A 1B7GO 2G06A 2IWRA 3S2UA 3CG0A 3LC0A 3T9CA 3UKJA 3K0CC 3NOXA 1GV1A 1J09A 4C4RA 3E61A 3GFGA 3OZXA 4MRSA 2CXQA 5FBKA 4BTLA 1Q92A 3VZSA 5HWSA 3WHKA 1VE9A 3GUYA 1HNNA 1F3OA 1IBCA 3HL0A 3AEKA 4JN6B 2PFGA 4C7BA 1BDHA 4AUMA 1WEKA 4CV1A 1VKRA 4RCYA 1UFQA 3BGWA 1ZOOA 1YB4A 1CUJA 5GVRA 1BW9A 1VL5A 2KMLA 4PX5A 4RGYA 5DM70 2D1QA 1DJPA 2RGDA 2YV2A 4LF9I 2BA1G 3WAKA 2O7RA 4BFZA 1WKBA 1VGRA 1GL3A 2H11A 2X8AA 3B1VA 3C7CB 3G9QA 2ONZA 2PY6A 1I6KA 1YASA 4FOPA 3OJLA 4FVTA 3ND8A 1NTRA 1PTKA 1R0BA 1FU8A 1ORVA 2P9HA 3CYFA 1VHLA 2F1JA 5KQMA 2GO1A 2WTNA 3ANXA 1V8ZA 1P42A 3G8CA 1Z68A 2XA2A 3R5HA 4M87A 4URHA 4Y1FA 3IKTA 3HBNA 3DULA 1N5IA 5ALNA 3RASA 3IEIA 4IIDA 2Z8XA 1YQEA 3BFJA 1B0ZA 5DJ5A 4FHDA 3F78A 5FKJA 2X6RA 3SFZA 1IDN1 5JSZA 3K6SA 3H7AA 4UMFA 3ZV6A 3QUSA 2F4NA 2AFHE 1A69A 4X71A 1G63A 5LMUI 3T1YE 2PKCA 2NACA 4F6RA 1NU8A 2CZ9A 2P68A 3SU8A 1QZUA 3GP3A 1G2OA 4Z4FA 2Z6AA 2JCYA 2V59A 3H11A 5IJ0B 5THQA 3L9WA 3VBEA 2CVFA 3U19A 2A9KA 5T67A 1KZ9A 3P3CA 3WI7A 2KBEA 4XWTA 2EFCB 3PFCA 3ZVRA 1MAWA 3ZXSA 3TQOA 1GRRA 1CBUA 3WOVA 2FEMA 3ZK9A 1S8OA 3UT5A 3G5AA 3ZD6A 5AO9A 5CFNA 1M5UA 2Z3VA 3DEFA 5K8UA 3QWBA 1VE1A 4RNCA 1QFZA 4L6AA 3BEOA 2C2MA 4ZZ2A 2OCXA 4EJSB 2G9UA 1TM3E 1Q7CA 4YBRA 1G0OA 4RH1A 1R0LA 2C39B 1XQXA 1XYGA 2WIGA 3B85A 3I5AA 2BR5A 4BLPA 5CW1A 2C5HA 4EY3A 2C5FA 1L5YA 2PJDA 2EKDA 3CTMA 3FLMA 2O06A 5ELMA 4I9NA 2WU3A 2PUHA 2FZLA 2HIHA 2GYYA 1TPZA 4ESVA 2BZ0A 2IYTA 4AS2A 5EC8A 4B81A 5F1OA 5GINE 5FL7D 1Q22A 4U2FA 4KR3A 4B76A 5EYPA 1TYBE 2I1LA 3HB0A 1DX9A 2HU7A 2IU3A 1DXQA 4RS4A 1XPUA 2QM7A 4CMJA 4LE0A 4NBUA 4NMHA 5KSOA 1IQRA 2ZRNA 1JSZA 1RLJA 2WSBA 4F71A 5C7YA 3R7LA 1CD5A 5J5VA 4B4UA 1M8FA 2RDMA 2GUWA 3N53A 3ZCSA 5A4MS 5DHQA 2PA0A 5EJ6A 1PNTA 3I5UA 4UXJA 4OA5A 5CGZA 4UT4A 1K5DA 4PHFA 3ODGA 5P21A 3KXDA 3L7JA 1P2UA 1CETA 1DUVG 5DB4A 1EUDB 2A0WA 4YDRA 1BOOA 3UMBA 4DLRA 3KOMA 5BV2P 3MWJA 1R0YA 2DBRA 4WXYB 2QRKA 4NV0A 5JO9A 3DAHA 5HS6A 3KQHA 2JHGA 1A95A 2FNAA 2PS0A 3O92A 5DDIP 3STHA 2XWJI 1FYVA 1B2RA 1J4AA 2NYUA 2TS1A 2WJHA 4II7A 2D6FA 4BJ6A 2HHAA 4GNKA 4DSTA 2XZPA 3F5FA 4R16A 2XTJA 2Z5GA 5CIQA 5I01A 2YKGA 3RU2A 3OLVA 2RI1A 1E0KA 3VU9B 4XJXA 2WLSA 2J7PA 5THXA 3DQQA 1OB5A 2CHEA 1KMNA 3T3OA 3BMNB 3HJTA 3B2EA 1HLFA 2VNJA 1GEGA 4JI0I 2BUCA 3F7TA 2Z5LA 3N7AA 5D2CA 2EHDA 3SNKA 4BJ1A 5T41A 3P4UA 3U13A 2DLDA 1JHUA 2RKWA 3H9JA 3Q1LA 4OJQA 2C61A 2PNFA 3QENA 2QM0A 1OBHA 4KSCA 5GTDA 5FI0B 4H0NA 2UU9B 3AONB 1AKMA 4OY3A 3PS2A 1I6LA 1N6KA 1MIHA 1NXWA 1P4JA 4LFCB 4BFVA 2PRZA 3QF7A 2H4YA 3COVA 1J00A 2Q1UA 2QQEA 4RPHA 2ZSUA 1XXHB 4TMWA 1UC4B 4P81A 4U2KA 4O5AA 1Y6GA 4RE6A 1GG9A 1H8HD 4H16A 5CP8A 4LXTA 4TWRA 1N1DA 1P5ZB 4G1FA 1UPFA 3TSWA 2Q99A 1I2CA 1R64A 1ZR4A 3RVJA 3IRUA 2XMRA 4LRYA 1JT2A 2WYIA 2BDEA 2PANA 4HDMA 4LF6E 2HK6A 4JKYA 2GVNA 3ETJA 3OEWA 4L72A 4LOJA 3V8PA 1O6GA 1QHFA 3IILA 3VO1A 4KMMA 5IU6A 3PYDA 3OHSX 1HF3A 4ONEA 1JMKC 1BAPA 1PKEA 4W6ZA 4BNDB 2JLCA 4E4TA 4M0FA 2P6MA 3IURA 5K51A 1M34E 1MG7A 1KI9A 4X65E 4PGFA 5F77A 2X0EA 2E18A 3G9ZA 3M3HA 2EFGA 4NYJR 3W2FA 2WHEA 3HVHA 1ZH8A 2HA0A 3EB9A 4X44A 3M81A 3OETA 1LSSA 1RJ9A 2IYLD 1J42A 1RBYA 3IVMA 4MZDA 3W34A 3F6CA 3HHEA 4ZAYA 2XE7A 2IE8A 4ECEA 1XWWA 2ATVA 3A4VA 3G0IA 5T5QA 2C77A 4G4GA 4LSGA 5K36E 1EM6A 3R4CA 5GJCA 1EB8A 1LQTA 1VYTA 3A8TA 4FOSA 5HJ5A 3BEDA 2G36A 4F4JA 1O58A 1OLXA 3H6HA 5K8JB 2C54A 5I7OA 3ZVKA 3ECAA 4GXNA 1JDVA 5HIMA 4MLDA 2OXCA 3ORYA 4PWZA 3VNRA 1CY1A 2EKLA 2I6SA 4CM9A 3DXXA 1U8CB 3IGFA 2PL9A 3LSTA 3NMUF 3WA6A 3PDWA 5JU6A 5DTRA 3HDYA 2Q21A 2RGXA 4L74A 2JAHA 1Z8HA 4FYWA 1AUOA 4ZJUA 5HFNA 1ID1A 4D3YA 1J8QA 2UUOA 3TQRA 4DIEA 3KOOA 5KYWB 2QUBA 4CU5A 2DFNA 1ZM2A 4DSZA 1RRKA 1FPMA 2VOJA 2AGVA 2DBVO 4DE5A 2WFZA 1MLDA 3LLSA 1EFLA 4KQ9A 4L5YA 4F92B 4XWGA 5IHXA 1P6UA 1Y9DA 4L0DA 4KITB 4CQLA 1H42A 2NSLA 4G63A 5IXSA 1LNZA 2NOAA 2Q5QA 2O0LA 4ZMBA 4JSYA 3EDQA 3L82B 2GD2A 3G1TA 1RYFA 4TN1A 3TAUA 2CKDA 2WU8A 1PS8A 1R27A 3FFBA 1IYZA 3KJIA 2P0YA 5CVJA 2II6A 1NX6A 2QVLA 4KHPI 2C96A 3AETB 3UNXA 4PIVA 4EKYA 5KYYB 2FOLA 2XOXA 2GAAA 3ENVA 5U4XA 4AKGA 1MDBA 2PLFA 1FTQA 4OATA 1A76A 1YQQA 3NEJA 4KC0A 1T26A 3OF5A 4YRIA 2WTAA 4J75A 2QSZA 4KN6A 1TK3A 1ZD8A 5LMCA 3ETNA 3DLTA 1EI1A 2C2GA 2YV1A 1Z0KA 3KALA 3VYUB 5KYNA 3FLAA 1VA5A 1XPOA 2FN3A 4WCFC 5KBYA 1Z17A 1I14A 1DO8A 1HQDA 1N2BA 1MU5A 3ZHZA 3MRTA 4PCVA 3UMMA 1ODKA 1V3VA 3X0DA 1YHYA 2FWPA 5HSGA 1VG8A 2D5LA 1N6OA 1Q0QA 3IMFA 5TMEA 5CEFA 4Z0PA 1C9YA 3RT7A 1Y6JA 3QXGA 2FRDA 3QTBA 5HS4A 1J33A 2B5WA 2WUGA 1BO6A 5A6SA 4KPEC 3MGAA 1LD3A 1UKBA 1Z2DA 4IFDE 2SKDA 3DXYA 3Q1KA 3QUTA 4GDFA 4W5TA 1P7ZA 2W93A 3G2IA 4LJ8A 4FD3A 5AJUA 2J5XA 2NO7A 4IF6A 1YCDA 4ENWA 1WVIA 5LP6A 2Z98A 3TPZA 4LISA 1CIJA 3ND7A 4G85A 2F55A 1CUEA 2CMGA 3BXGA 4L8VA 4M3NA 1Q20A 4B35A 5BPFA 4TSKA 5BSKA 2H0QA 3DMRA 4FKZA 1UDCA 3ROFA 3LQ4A 4JXJA 4WN9A 4PQEA 3TN7A 1E94E 1TCUA 4QGBA 2GZ2A 4R3NA 1F4LA 2C4VA 2X7HA 2PQ6A 2PQ2A 1P4SA 3JU3A 1DB3A 2O3QA 3CIFA 1OU0A 3V4VB 5TS2A 4BV9A 4XGIA 3Q10A 1EQAA 3LG2A 4B3TB 1HFJA 2VDRB 1AVTA 1CHNA 3NP9A 5G02A 2AHRA 2R6AA 3H04A 3H3FA 1MO5A 2X3FA 1EE9A 2VCEA 4OCZA 4A0FA 4BO7A 3FR8A 5LD2C 2H1FA 3VR3D 1WBBA 2JHAA 4H1WA 5C5CA 4S0XA 3GBVA 5K8LA 5HGXA 3LPNA 1XL0A 1FUEA 2R5WA 3ZD8A 1WDTA 2ODTX 4U3JA 2OK7A 3GJQA 4J0DA 3VR2D 3CR3C 4LOLA 3G3EA 2UUBB 1V5IA 2ETVA 3N2ZB 4AECA 4JI7B 2KS6A 4A92A 4B6QA 2Z5CA 4MV8A 3MRSA 3GJ5A 4H2DA 4LTMA 2NVBA 3IDQA 3SC2B 1UXHA 4PYJA 3JQPA 4ZJZA 5L4SA 3E1KA 1FXSA 1YAJA 1PW7A 4HL6A 3WYCA 4ADSG 3HU3A 5KWSA 1ESEA 2RGEA 3OZCA 2RAVA 2ZUWA 4JBYA 3B6EA 1L7MA 4F38A 3UPTA 1ZD5A 1E8NA 3DHYA 2WF6A 4TMVA 7MHTA 4ZRMA 4OQNA 3WLMA 5AM1A 5BOSB 3RNLA 2G8LA 2XYVA 3MGKA 5CLLA 3ZVNA 2JJ2A 3QW2A 1N3BA 1WUIS 3L1VA 2HF9A 5JLAA 2BRUC 2JFPA 2GKOA 2ODWA 1CRWG 2G5GX 2PWPA 3OSUA 5TGDA 1Z75A 1K2VN 3A6HA 3NKLA 2NU7A 1G17A 2W6MA 3KVYA 1Z2CA 3RV3A 5A5VA 5AH0A 4LQCA 4UE6A 3QFRA 4DQLA 1YR6A 1XMOI 2LWIA 4O4IB 5ARCA 3OLWA 4AJOA 3CKMA 2G72A 4U1RA 2PMFA 2LBPA 5C0XE 1TXGA 3ZDYB 3U62A 4FFDA 1AA6A 2A84A 3R20A 4O0LA 4OYHA 4RY9A 3WO1A 3WWDA 1N57A 3LX5A 5DM60 3QWHA 2DE0X 3AEQB 4IGFA 2E6KA 3NC1C 4XGKA 5KSPA 1OH7A 1NJ8A 2FPMA 4KB5A 1WTCA 3QVLA 2SICE 5BW8A 1RI5A 1H0HA 4CF7A 3JVUA 7ADHA 1EFPB 1P4GA 1ZW6A 3FYUC 2A9VA 4DWJA 1JHXA 1XIVA 1UEXC 2Q5IA 1AE1A 4Q0MA 4AKHA 3U39A 2IV7A 5D84A 2FP3A 4BC0A 1QCCA 1XRJA 1L7PA 1M74A 5JZBA 3L8GA 5KX5F 2QBYB 3B3AA 3TCXB 4YMUA 1EI9A 3B6ZA 3HB7A 1HKHA 2PS9A 2EZ8A 1MA3A 2BI8A 2YWGA 4MICA 4HYTA 5BN3B 4AG5A 4I19A 4ZU6X 2J9ZB 4V0NA 4YMVA 1LDMA 2WINI 3ESRA 3OOWA 1NVWQ 2FX5A 3O21A 1CE8B 3GVCA 5BNIA 4F3YA 5B5SA 5BMVA 3HCWA 3QV1A 2GZMA 3QU2A 1YDFA 1JHVA 4M8KA 4IZJD 2FPSA 1NR5A 1VB5A 1Y3FE 5JSYA 4BEJA 3AU9A 3SEQA 4N54A 2H2HA 5I7FA 1ZIYA 1P9RA 3R7WB 4RIGA 4PLGA 4ENRA 1E9SA 2UKDA 4GPD1 4WZBB 4A8PA 5BQOA 1XEAA 5IYZF 2WVHA 5KSZA 1BH2A 3DTNA 2QTGA 2IUTA 2AKAB 1GFWA 3DMTA 3MTDA 4JFAA 4AJKA 3FH0A 4R6WA 4AS3A 4C0LA 1SOWA 3AM5A 3QUCA 3STUA 2PNJA 2JFXA 4KJXA 3RARA 3HP4A 3FLEA 1DIOB 1BN7A 1SURA 2QR5A 3E53A 1MRNA 4LX0A 4LF4E 1EBUA 1RP1A 4P6VF 1V7PC 4Q01A 4M7OA 3VKVA 1BC5A 3FSJX 3NDPA 4AJIA 4PRXA 5A2GA 5JYCA 1MX3A 1QCYA 1TT5A 2FX3A 5H81A 5JANA 4JEUA 3QFFA 1SGWA 1E3HA 1H2YA 1USWA 3QVVA 4OJMX 4B85A 3INTA 4CTJA 1K8XB 2OE2A 3OURA 1KI6B 3VOBA 2ZJFA 4Z9AA 4MGYR 4W1SA 3OWHA 3ZKWB 1YIAA 1NBIA 3DMHA 3MMXA 1GPMA 1RXWA 1F2DA 3SQMA 5DRQA 1N0UA 4E5DA 3FTEA 1TM1E 5LA6A 2HUNA 3K9WA 3ZD9A 2OM6A 3KRTA 1Z82A 3LT5A 4PVDA 1IY0A 1OWLA 4G1EB 3D4OA 3S2SA 1QYWA 3QSGA 4B43A 2ZUSA 4QTYA 3ZS9A 3W4KA 1M1NB 3PC6A 4YAKA 4EMSA 2BFOA 3THSA 4HYMA 1X3SA 1NE2A 3J81Q 2H18A 1IZ8A 2AMJA 3A1NA 4QHSA 4TGLA 1XAHA 3RS8A 4LF9B 3AM1A 5CDYA 2WABA 4B2IA 4TYYA 4J49A 1LC3A 4YALA 1QHNA 4QARA 4EKEA 1EM8B 2IY9A 4ZHSA 1AK9A 5AI8A 3QBJA 4J3JA 1SZDA 4F7WA 3UVEA 3F74A 3R5FA 4OSPA 1QVRA 4DMMA 2GBCA 3IQFA 3RK1A 1PTJA 4M54A 2XUZA 5AI6A 4G4JA 2CG9A 1TTQB 1OC4A 2Z4TA 4FYMA 4KFSA 3S7ZA 4CT5A 4Z51A 1DCTA 4CIAA 4JK3A 2BONA 2CYCA 5CVVA 3SZ3A 4UBJA 2GM4A 4YAWA 5WRFA 1S1MA 5LMUB 2Z43A 2NV0A 3RLIA 2GEKA 5H70A 1XTTA 1Z4LA 3BDAA 2OBLA 1ZN2A 3PG5A 4IZ6A 2EQ5A 5JS2A 1UZNA 2NQ8A 3K2IA 4MJXA 4MI9A 8LDHA 3LLUA 1U8ZA 2DFKB 3DUFB 1T2NA 2BN4A 3AFIA 2YIDA 4PLTA 4BRSA 3P0IA 2LUOA 1E3TA 3VJRA 1PQUA 3H17A 1MC4A 3P2JA 3ORSA 1F38A 3VO8A 1RS0A 3OTHA 1Q0RA 3H65A 1EX9A 1FDSA 1HQYE 3VJMA 3VTAA 2PUBA 2QVBA 1CUGA 3SZMA 3KG2A 4EL5A 5MN6A 5DTMA 2Y0CA 4G01B 1UJ2A 2O2EA 5JY1A 1QV7A 3H4IA 2NUAB 1TVCA 4N18A 4BQFA 3OSZA 1BMFD 2HMTA 3QVJA 5JJBA 5A5DA 4EYGA 4CL2A 4ZK2A 1V7ZA 4AQYI 1XELA 3BMQB 4DTCA 4EY5A 2JS7A 4GQUA 2L17A 4YYZA 1KHTA 1OLSB 1EXMA 2XWPA 3UAWA 3MWEB 4FFPA 4CQMB 1KK1A 3BSWA 4NNOA 5IP5A 1RKQA 1ADCA 3LECA 4BCCA 5KNBH 3EXIA 3NHKA 4ZI2A 2KE5A 3HKBA 3P45A 4L5CA 5GP1A 4BLUA 5JQGF 5FBHA 5KX5A 2NU9A 2VPZA 3ZHSA 1I4TD 2QOEA 3M6WA 4K9PA 5C5IA 2GYWA 3AP2A 2EEPA 3IAM6 5ES3A 4N48A 5DCUA 1RKBA 4YXWD 2IHNA 4ZPJA 3QEKA 4DKJA 2ZUFA 4KWCA 3SDZA 1XZPA 1NF3A 4NESA 1S0UA 1VIYA 3FMPB 3KJNA 5DM2A 2QUHA 4FMDB 4CKZA 2JGMA 4Q19A 2CMDA 2WFLA 5CT8A 1YT5A 2RCYA 4ZOCA 1G1AA 1N32I 4QTUB 3EQ9A 3UT6A 3ZQUA 1ZCFA 1VGVA 4U2BA 4NAUA 4UTZA 1D0VA 5TF0A 3Q7EA 3JALA 1NF8A 4OXRA 2WHRA 5A3SA 4J94A 4MVCA 1O94D 5FWKA 2ECFA 3AEKB 3ED5A 1TDJA 4X60A 1F1BA 1F14A 4I1PA 1QFJA 3EVTA 3ZUGA 4C14A 2VNSA 1BVYF 3KLBA 3JQGA 4E22A 5AESA 5HQ3A 13PKA 5AKYA 3PQCA 1SUEA 4BX9A 2BDUA 2MINA 3GG2A 1V5FA 4JLBA 5TEVA 2D5BA 1KP3A 3DAOA 4PPNA 5CVDA 5HF8A 3UWSA 3PIIA 2WVAA 4JI0B 2F3TA 3RS0A 4J3DA 1VKZA 2F3QA 5BSRA 3K1TA 3B82A 2XMBA 2WC1A 4LRTB 4Z1MA 4W1RA 3QKTA 5DI3B 4B3XA 5A9RA 5AJZA 3I5MA 3IEUA 2XUAA 4LJ6A 1Y4AE 3CZCA 3G2JA 3GZJA 2PAAA 1KETA 2NYAA 5H3CA 1V48A 2YMMA 4L57A 4EB3A 5JSZB 4QHTA 4Y1EA 6REQB 3K6SB 1ECJA 1GUBA 1VISA 1Z7WA 1T0BA 1VJTA 3SYRA 4N0EA 2P75A 2YDYA 3PK0A 3FJOA 3W8FA 1TVEA 1WWKA 5B7NA 3PBKA 3O0TA 1T5IA 3DE0X 4MYHA 3KJEA 2GO3A 3Q85A 3IAHA 4I8XA 4F56A 2Q3DA 1EP1B 1GRQA 1FX0B 1TYCA 2QAJA 4X1KA 3LPCA 3I09A 5B57C 4OXQA 1IBKI 3C16C 4D9BA 4DHWA 3BE5A 1LPMA 1N33E 5IT5A 1TIBA 2IP4A 2VVTA 2YL2A 1XNRE 2OZEA 3O3CA 2AFIE 4ND6A 3WMWA 4P7BA 3AJDA 1TA9A 3WL6A 2MTBA 3PUIA 2QYTA 4Z2AA 3V1UA 3D64A 1VPDA 1WCV1 5CJ2A 5KJEA 5KHOC 2N3ZA 4NBKA 4D92A 4RS3A 2CXRA 3PFHA 4KDFA 4KKVA 3ZHBA 2HUPA 4A2CA 1WMAA 4N5MA 2CHGA 3L04A 3LDFA 4LJLA 5EP1A 4CDMA 1RC1A 3EBOA 5ER9A 5DHFA 3GZ4A 3U3OA 3I1FA 5HOEA 2XWQA 4D6PA 2XNHA 1OASA 3HY6A 3WLHA 2HPVA 4CUKA 5JDIA 1JPJA 4EDHA 3V5RA 1JBKA 1ZD3A 2BVNA 3CNNA 3CU5A 4TTJA 4X6XA 5HX7A 1T2FA 5IDWA 1WCXA 3OBIA 1EVEA 2PSFA 1LPAB 3KB8A 4HRVA 3S1AA 4X95A 4XFKA 4NULA 1OLOA 2Y76A 2OCKA 1NLZA 4LY3A 4TTSA 2RGYA 2OFPA 4F5ZA 1Q7TA 1U8TA 2VXBA 1U0EA 3BD9A 3OE4A 1WHSA 2QV7A 5EYPB 5BUSA 3EPJA 1UT8A 2QNBA 1OIWA 4MW0A 3G5MA 1CUXA 3VISA 1E7WA 3IEPA 2P90A 3GEDA 3QG5A 2CJWB 2AJTA 3GEIA 4BO8A 2BGIA 3HKDB 5TARA 3PICA 2VZ0A 1UEIA 3EC2A 3I30X 4L1KA 1ZIXA 3T54A 5F2NA 1VXOA 1GTRA 4BO9A 4JMPA 4ESHA 1PZFA 2HEGA 4RVDA 3VVBA 1GCOA 2AN4A 4B9AA 5IULC 1K7FB 1D1TA 2NN6F 1MH1A 2O48X 2ZSAA 4PC6A 1SHUX 2UV8A 3PJFA 4YS6A 5C0OE 3UAYA 2QP3A 3U6BA 1VCHA 2E4ZA 1H4TA 2I62A 1APBA 4NENA 3SR3A 5SZHB 1RM5A 4DV6I 4U63A 3PF8A 1XVVA 2IW1A 3C5CA 5TEWA 3FCAA 3EVBA 3UFXB 1KKMA 5EGNA 4W9MC 3BXPA 3OIGA 3R2JA 1C7EA 3K4PA 3SK0A 3ROGA 4X64E 4BDSA 3VNAA 4I4IA 2A58A 3KPYA 5FCDA 3X1YA 2GXAA 4KHPB 1A8PA 3HV0A 2ZIWB 4DM3A 1XZNA 2IHZA 1ZINA 2C1XA 3LZ6A 1JAHA 1NMXA 1XMIA 3O8DA 5ICCA 5K6AA 5FI1B 2JLYA 1MGPA 3OX1A 4DDHA 3FM9A 1YACA 1Y5RA 3R6DA 4LZPA 4FFBA 4UTGA 3FMFA 4QBKA 3UAOA 3D7RA 2BA1D 2M32A 1KR5A 4QQRA 3J81C 2AD5A 4GPTA 4FLMA 4TS3A 1NJGA 4NRDA 4GSYA 4YMLA 5JJIA 1UWKA 3CE6A 2ZJ6A 3E9CA 3COZA 5JNUA 3SJBA 4RHCA 3F3KA 3RUDA 4ND1A 1VBKA 4U7TB 5GJVC 3H6GA 3ROMA 2ZE6A 4EG7A 4F86A 4DV3E 4ZEWA 2ZBQA 2A0YA 2H1VA 3V8BA 4A10A 5LZ9A 4IUYA 4HC4A 5ESWA 4HMQA 3EG9B 4BQIA 4E2WA 1SXJA 3M7IA 1SY7A 4K9MA 2VT3A 3ZEAA 2HK3A 4BB5A 2COUA 1QKIA 4LVUA 4E08A 3DYBA 1Z29A 4LK3A 1YK0A 1IN5A 1OC2A 2VWHA 1PQPA 4DR2I 1NM5C 1R4NA 1SZCA 4R05A 1QR6A 1ZS9A 2MR5A 4Y6QA 1E2PA 1HETA 3KYDA 2RGNC 4YRBA 2FV8A 1NW8A 1WCYA 2UYOA 4MTCA 4QXRA 2IS1A 2CNDA 2GD1O 3GLIA 4J0CA 1M2VB 1CRLA 4JLDA 3AKEA 3ITDA 4EJ0A 5E1MA 1JTFA 2GPSA 1T36A 2Q6KA 4IZOA 4FCVA 5FOUA 3T3DA 2Q5CA 4YRMA 4ZI7F 3DJYA 1AXRA 3DZ8A 3FWHA 1WCIA 5CT5A 1G6HA 4P98A 3OZIA 5HEKA 3L49A 5JAZA 4N8EA 3ONEA 5ALIA 2B8WA 3R1IA 1EVJA 5AOAA 3ELUA 4R1UA 4V24A 3BH0A 3NO4A 2B5VA 2V58A 1HC7A 4B3DA 1P1BA 1OX4B 4GYKA 4DG5A 3VKUA 4P38A 1TAGA 1C8BA 1H4QA 1PJAA 4IICA 4CYMA 3GVPA 3FPFA 4R2KA 2VQEE 1I2BA 1JKJB 1Z5GA 1RQXA 4DG9A 1F0YA 1IEQA 2AE8A 1EIZA 2C4WA 1ORIA 4KQVA 1QQTA 3HU2A 4UPVA 4UEWA 5IRCD 1Z07A 1IOLA 4N49A 2JIRA 5A2QC 3NHUA 4DEXA 3MJFA 1HSOA 4U4AA 4UNIA 1IXKA 2QRNA 5BWMA 4AJPA 3DEJA 3O82A 3WXMA 3REGA 3CLHA 1W2WB 2H2DA 5AM3A 1HGXA 2VATA 1MOQA 2ZPAA 4R8KA 4O4JA 3V80A 521PA 4IXTA 5DWVA 2J0QA 4M7WA 2QRVB 2I4NA 4GKKE 5A02A 3H4LA 5JTUA 3VHXA 2ZAYA 4IV8A 1XJWA 2ERYA 4AG6A 4TYWA 1YR1A 3PQFA 1HWYA 1U1EA 3GIDA 2BF7A 4NTZA 1AN9A 4B45A 1SUPA 3O4IA 2DHDA 4DLAA 1XMOB 4U02A 4QZVA 2X5XA 2X86A 4GECA 5BUZA 1KH1A 2BKVA 1BRTA 2E89A 2V7XA 4JT4A 3GLGA 1HE4A 4IY1A 4TV8F 2Y1WA 3W2EA 1XK6A 2RG7A 2IV3A 3I3OA 1NUAA 5F9MA 4Q7QA 4MO9A 3NVMB 4F97A 3TD2A 5LQJA 5TIIA 3QXSA 1B63A 2D0OB 1YQWA 3ZHCA 2AKYA 2AXPA 2PUCA 5F33A 5H7XA 2ZWIA 1WKCA 2Y0BA 1YZVA 1J8VA 2OHXA 3GCZA 3O4HA 2QX8A 1W35A 4MAFA 4OI4A 4AY2A 4FCWA 2LDXA 1MD9A 2B30A 1XDBA 2Q3HA 3FDIA 4PAGA 5ILGA 1KYWA 1SUFA 2YN4A 3OAAA 2A59A 4NU8X 3B3GA 1T3LA 1RWKA 3GBPA 4M0KA 3HCBA 4CKCA 3LH5A 3LXRA 4I1RA 5BNZA 3H2HA 4IQ8A 3TOXA 4ZVMA 1Z2EA 4CI0B 2DJIA 4NYIR 3RJ9A 4Z0TA 4BQPA 3IAS6 3FOEC 4K05A 2IUSA 4QPJC 4NXME 3WLOA 3KZXA 2VESA 1HT0A 2J3EA 3C7AA 2PBZA 3WOHA 1FDTA 2VF5X 3DMDA 1U2PA 3UUFA 1XQVA 1IJBA 1TVMA 5A6SB 1UEKA 1Z26A 2Z5FA 3CZ9A 3CA8A 1XCPA 4UQPA 2A35A 2FGKA 1G98A 1Y0BA 5LP6B 2B3TA 2P11A 2DHEA 3QVUA 5CDHA 5HJ7A 3RBVA 1XJQA 3TBHA 3WYAA 1RXVA 3WQSB 4C0AC 4OXYA 1FRZA 3SIXA 4P7KA 1H72C 1X77A 1SMKA 4NE9A 4C04A 4F2DA 1R00A 1GN8A 1PBTA 3KYJB 4WN9B 2OMEA 5AW9A 2O5CA 3NM4A 5DM1A 4ZT3A 1NVTA 1T8PA 3ZV3A 3PNPA 3PQEA 1HYQA 3ESBA 4WESA 5AJWA 5AM2A 3PQ8A 2H31A 4FW8A 4P35A 3GMEA 1C4OA 5FTWA 1L5LA 1ODTC 3I8XA 1K5HA 4L8YA 3RGWS 2P4HX 3A9SA 3S2ZA 3O9ZA 4TTRA 3DPSA 3I32A 2P27A 2WD7A 1J1IA 3C6KA 4M83A 3OLYA 1QRUA 3M8KA 3R9IA 2VN8A 1I2MA 3N2EA 3A4TA 4LGMA 4PXSA 4OLBA 1C4WA 1M8PA 4U3JB 4BEBA 2ATCA 2G88A 1MAHA 2NNWB 5CH3A 4Q7EA 1E1MA 2MSWA 4CM3A 2QX6A 2AEFA 4ZRDA 3NVKI 1NBEA 5LMZA 4PNPA 2AQ8A 3TDKA 1V8PA 1ZH2A 2Z5CB 3D3KA 3UHFA 4WSOA 5J1TB 2ZM5A 1T4GA 1QRTA 4JDUA 3DVRX 1E7RA 1KY5A 2H4WA 3H0EA 4P0TA 3SDBA 4UAUA 4PSKA 4ZJPA 1U7UA 5DRPA 1MEOA 2DGDA 3D8TA 4ZCMA