2GQCA

Solution structure of the n-terminal domain of rhomboid intramembrane protease from p. aeruginosa
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
MSAVQVLKFPLSVDLAGFVGLLRRLNVPHRVSEESGQQVLWVPDERLAEQVRELYRRYPEGDPQATLEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and dynamics of the N-terminal cytosolic domain of rhomboid intramembrane protease from Pseudomonas aeruginosa: insights into a functional role in intramembrane proteolysis.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Rhomboid Intramembrane Protease
total genus 10
structure length 70
sequence length 70
ec nomenclature ec 3.4.21.105: Rhomboid protease.
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16733 NRho Rhomboid N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2080 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gqcA01
2GQCA
chains in the Genus database with same CATH superfamily
4AYBD 2GAHC 4ECWA 1RTHB 2HVZA 3LP1A 2DR6A 2L48A 2CJAA 3KDOA 2H4YB 4H4MA 3AJ2A 4OI2A 1HNXF 3DRSA 4LBHA 3VZIA 3D28A 2CRLA 1TV6A 3C15B 1UEKA 5L38A 4ZPBA 3HM9A 4ID8A 3TP2A 3ZZYA 2XCPA 3MFHA 2R7RA 1LWXA 1JLCA 1SQEA 3F73A 2FVPA 4AD6A 1RAGB 3MR5A 2RF2B 1BC6A 4OJHA 2RB7A 4I2QA 2A2CA 3MURP 4LF6J 3DXSX 5I4MA 4UY8T 3QAEA 1KWMA 4M63A 3G4SS 4KY3A 3ZTQA 2AKWB 4CO0A 5CYJA 3VAIA 4M5IA 2RH3A 2F8MA 2EKYA 3I9ZA 2Y8YA 1WOPA 4B3MF 4KTQA 1MWYA 3J80Y 4DR5F 5FDLB 1RCOB 2B6AB 5A0YA 4PCQA 4N47A 4C98A 1UJ6A 5F0WA 1XNQJ 4BHQA 1KHVA 1WKLA 2EC2A 3MMAB 1N33F 3BPDA 4ELVA 4IDKB 4HTJA 4PG8A 2PC6A 1YJUA 4QWDA 3CDBA 5C24B 4QU7A 4AL6A 2QTWA 1JMTA 1JXVA 2C2EA 5D0HA 4P71A 3LGHA 3KG4A 3W60A 2IFXA 5KT2A 5ETVA 2NR0A 3FBEA 3QLHB 2B9YA 2IBKA 2MZSA 4F67A 1ZA1B 4ECVA 5HANA 2PIIA 3S6EA 1S1TA 1FDDA 4P7TA 3IAM9 4CLUA 1PILA 2DNPA 5ETNA 5F8GA 2EBGA 5LJ3Y 5KFHA 4X4PA 1TUVA 3B8HA 5HQLA 4XPCA 1MW7A 2VFVA 4O44A 2HYIB 1NO8A 2W9AA 2MGZA 4JI4J 2CNOB 3PW4A 3NS6A 4Z7YA 4IH7A 5B0GA 3D6HB 2N4DA 3CCES 2MQNA 5D0RA 1HW8A 1X4HA 2Z2MA 3LUYA 3RB4A 4DSIA 2JLFA 2HGMA 4K2XA 2B51A 1T05A 1EETB 2CADA 2VPWB 2W01A 3BDPA 2BXJA 1TKDA 3HVAA 2B3TB 5KG3A 2FJWA 2FDNA 2NCKL 4ERDA 3LP2B 3HHNB 2XZWA 4TNOA 1NKBA 4YS2A 1X4GA 3CJ4A 2XS7A 5AJ3J 4OX9F 4LF9J 3O1LA 3MUMP 1HHSA 2BJEA 5LOQA 4JV5J 2HHSA 2A6OA 2FVCA 4KGXB 4DS5A 4B9MA 4C8KA 2XB2D 4P6QA 1C1BA 4XIUA 1R43A 3D68A 4USVA 4NYPA 3OT9A 1N36J 2OPPA 4IOAQ 1R0AB 4FS2A 2DHGA 4NEZA 2QYGA 1K1QA 2OD4A 4J7CA 3TA2A 1MU2B 2E1CA 1VBKA 1S48A 3IS9A 4J90A 2CG8A 2W2PP 4TY8B 4EZ9A 4QOTA 3QAUA 1FWPA 4LIRA 2LMIA 2WONA 3EZUA 1PCAA 2DY9A 1F5CA 1CC7A 2OPSB 2ZOFA 3MD1A 1QE1A 3DLJA 3RYLA 4B02A 4DPWA 4TU7A 4B3TJ 2XS2A 2QLXA 5DG8A 2DNOA 2IM0A 3JB9k 4TYAA 4RW6A 1R8AA 1SC4B 4IR9A 1RWUA 5IFMA 1IKWA 2ALYB 1X5SA 3DGVA 4FF3A 3CGIA 4K4YA 4DX6A 2Z4PA 2J6TA 1RAEB 1Q86T 3I4HX 3LA0A 2WSEC 2ZBIA 4A46A 3OL9A 2APOA 2C2KB 5IT0A 3IRWP 2HLTA 2DIUA 4I0WA 5KFEA 1FFGB 3G6ES 1SUQA 3NCRA 1E6VB 2E9TA 1F2HA 3JSYA 2WVEA 1NNDA 3NWGA 3GCWP 4ED5A 3IWLA 3TARA 4WFAQ 2CNKB 2OPQA 1H98A 2VQFF 1NH8A 2DNZA 2IM1A 3SCJE 1NJYA 2DRAA 2ZHAA 4URQU 3QT8A 1F6TA 3BBBA 1RAOA 2XY6A 4TY9A 1SC3B 2JJ4D 2V8PA 1YJTA 2RS8A 2RHQB 2JH3A 3M05A 4WTYA 5HVGA 3QZ8A 5KG5A 2QA4S 3DOMB 2E9ZA 4EWTA 3N5FA 2FLPA 4AXIA 2XLKA 3GYXB 1IKVB 4HH1A 5H9FK 1F9EB 1LWCB 4MTPA 2NREA 2DNMA 2HWHA 4ZCLA 1RHUB 2I1RA 2BM0A 4OJGA 5M2PA 3HK2A 5F3TA 2WAQD 3K5LA 2R42A 4ZPCA 4B9TA 5J2PA 3K0JA 4ECYA 3PYGA 1N5QA 1VBZA 4X66J 1XK8A 3R7NB 3D66A 3M8PB 5ITHA 2CZ9A 3DCAA 4ZVEA 4DR4J 2KKHA 3AB2B 5KG2A 4ZVGA 3VAMA 1KOOA 2RU9A 3GJSB 2JZ5A 1WUUA 4P72A 4RW9B 5D77A 4J9QA 2UVUA 4RR5A 3H2UB 4QR0A 2YKOA 3A4TA 3PW2A 1X60A 2HNDB 1RT1A 2CQ4A 2M4MA 4USJC 4FPIA 4GVLA 2HHHF 1PJ5A 1QUPA 4J9RA 3CJ5A 2PEBA 3PG9A 2CZVC 2DISA 3LGNA 2OEMA 1WTBA 5F8IA 2P9EA 1SI9A 1NB2A 5IQQA 2DCLA 3D3BJ 2CQBA 2I6WA 4C11B 2CQPA 5HJYA 3HJFA 1FKOA 3CXCR 1R3NA 1HD1A 1S1VA 1ULRA 3OTCA 2CXEA 4W90B 3CCTA 3MR7A 2HZVA 1KVIA 2DR9A 1BE4A 1X0PA 2K1RB 3MPYA 4ED7A 4I6YA 3H5XA 2X1GA 3RAMA 1P6TA 4M5LA 2OPQB 1L3KA 4URGA 4J9UE 2J6UA 4HHJA 1YG0A 3DLEA 1ZAXA 4K7QA 5A6WA 4Y28C 4JI6F 1J27A 3UN2A 2CQGA 1S1TB 1SC1B 2D9OA 4PYAA 2KXNB 2DCUB 2VONA 2UXCF 4WU3A 3MMCB 2J0XA 3F56A 1RSCA 3J81j 2AZ1A 3FDSA 1MN9A 2EFQA 5F41A 2VH7A 3SDEA 4CTAA 2XMUA 2M2BA 4ELTA 3QMQA 2FHKA 2H4WB 4PR6A 2NXCA 3D6TB 1FDNA 2W7PA 4ZCMA 1RAHB 3CCRS 3DMJB 1FD2A 2HNYB 2J7KA 1TL3A 3BKFA 2HHWA 3DOKA 4G65A 1RTJA 2WCXA 4F8RA 2W2QP 2RRAA 4MIWA 3POTA 1SH3A 4DV3F 1W26A 3L9ZA 1ZPVA 3H2LA 4C3MA 3NGDA 2AHOB 1KDNA 2Y1JA 4UZBA 1U1PA 3MMJA 3Q8PB 2QRRA 2YQ0A 3EVOA 4OV1A 2VKZG 5A6PA 3AD7C 5AE1A 2GVZA 4RNHA 2VZ9A 2VA2A 4ETZA 1Y4ZB 3KLGB 1C1BB 3CD6S 2V5HG 3LWLA 4UOFA 4B3OA 1TELA 2OKQA 3BH6B 5HJXA 1VRTB 2GO8A 2IRYA 2HPUA 2ZZTA 3SCIE 3LO3A 5D3GA 5BYRA 4U9RA 3Q8QB 1K47A 1RT2A 1NZ8A 1TZ0A 2KL8A 2ZC4A 3M8ZA 3ENQA 1X9MA 2PFFB 4LRFA 2CDRB 1TKTB 3V6KA 1IKVA 2BE9B 3OTEA 2HIQA 4E8UA 4CLTA 4JYAF 2ZD1A 4WIIA 2CPDA 1QY7A 1MN7A 1RQ0A 4Z37A 2GHPA 3WHIA 4FF4A 3G8QA 1H7WA 3GG0A 2OFGX 4YMEA 3DLGA 3THVA 1LWEB 2MY8A 3H90A 4DG1B 1TAUA 1TUWA 2QC3A 2NXNA 4Q2LA 2B5JB 2BW2A 1RT4A 5AT1B 3VTIA 2W25A 4ZLPA 3T19A 3N6NA 4RNNA 1ZH5A 4P75A 4WBFA 2G2ZA 2F9DA 3HFVA 4X84A 1VQNS 2GQCA 3IWXA 1HW9A 4OJ1A 4AQYF 1FRMA 1UA0A 3EX7B 3KLIB 4YOEA 1LOUA 1RT6B 2XYGB 4J37A 4MFBB 1IR2A 2V68A 1OIAA 3DLKA 2ZC3A 4MKAA 4K4WA 1SQFA 2L9DA 2ZH2A 4DV5F 1CVJA 4NLYA 1FCAA 1MROB 1YQHA 1TKZA 3LH2S 2OPRA 3ZZPA 3OL7A 5MLCV 1QLNA 3OSPA 1L5UA 3BF4A 4LFCJ 4LF1A 3I56S 4DFMA 3P6YC 3AOCA 2CFXA 2RRBA 1URRA 2YWFA 3W2VA 3TI0A 3M2RB 4IG3B 2QMUB 2XULA 5HI7A 1HNZJ 4NXMJ 2CQ0A 1B7FA 3FSXA 1Z2LA 1Z1ZA 3JQKA 2MSTA 4CT9A 2QMXA 4X66F 2V9KA 3MM9A 4DV2F 3KMQA 1HD0A 3SFGA 3MI7X 1AZSA 3S01A 4ETXA 4Z2XA 2W9CB 3G9CA 4L75A 4QIGA 3LAKA 3R9LA 5KT4A 3NMAA 3U1LA 4X4QA 3FQLA 3M32B 2M8HA 2B9XA 1N5SA 4R0EA 5HAOA 2RU3A 3FJ2A 4J9KA 4B3TF 4ZS6A 4DR3F 4CNYA 2A10A 2QLJB 3VALA 3JAMY 2W9BA 4IO9Q 4F4KA 4DJBA 3BPSP 1RHQB 2R2UA 4MT1A 3UD3P 3GJTB 1RAIB 2EK1A 4NWBA 5DG7A 1L3VA 4JI1F 3EJMA 5HSPA 1WSRA 2BQUA 1IQTA 4ZIWA 2XMJA 3H7HB 5DM7Q 1CG2A 3EPIA 1HNWF 1CPZA 4YEAA 2HQGA 2NZCA 5E5NA 4Q45A 2W2MP 5E3AA 4FZVA 2FY8A 2QL7B 4RPFA 4X62F 1JJCB 1UVMA 1JLEA 1P1LA 2XMMA 3T1HJ 1SBRA 2MJNA 2H48B 2QA2A 4XK8C 2IC3A 2RMLA 4JP8A 2MQOA 3DRSB 3CPWR 3Q23A 3ET6A 3LW5C 1U2CA 4QIVA 3TZZA 3EZOA 1CQNA 5DLFA 2FJXA 3E01A 2IRUA 1WKJA 4CH7A 4K4SA 4CIOA 3E8OA 4NZ0A 2JOQA 2M5YA 1R0CB 1WACA 2MKIA 5EX3A 2J76E 3HLUA 5KT7A 4F2RA 1WNEA 1C1CB 2F4VJ 4C8YA 5KFNA 2AYGA 7AT1B 2UUCF 4RW8B 2YKPA 5GMKa 3IP0A 2E44A 2OPRB 4N8NA 1PBAA 1UEUA 2AJ0A 4K4TA 5GMEA 2R7OA 5KFUA 1JXLA 4EFAC 2UUBJ 3TAMA 2UVRA 1K73T 4C0HA 4ECRA 2YH0A 4JI2F 1NPKA 3CNQP 2FTRA 4HT7A 4KHPF 4F02A 2ZWPA 3CC4S 3KJVB 1UFKA 1J5EJ 1NDCA 2GMHA 2VG7B 3I5BA 2D3OR 1FEHA 3RTVA 4MYUA 1UFWA 3CJQA 2FJAB 4LIWA 4A8MP 2K7JA 1Y11A 5E33A 1KLMB 3KFWX 2J6SA 5JMNA 5IWAJ 5CYQA 2FZKB 2J9CA 1CJVB 4G6VB 4DSKA 3UI3A 1WC5A 1PGZA 4YB1P 1N36F 2NXEA 4XDDA 3CD7A 4YR0A 2HQFA 4LVOP 1YJ7A 4NLTA 2R7VA 1Q81T 2NUHA 2BANB 5KFPA 1KNZA 3FKBA 1DLOB 4NRTA 4HACB 3V6DB 1Y00A 2IMWP 1BLUA 1RADB 1ZOTA 1RABB 2XSFA 2R7TA 3QBCA 3KDNA 5KFMA 4U96A 2I8EA 3TRGA 4C8ZA 4PXCA 2FC8A 2AGPA 3L7PA 3TA1A 1JLEB 1R6YA 3ZXWA 2B56A 2DNKA 5ETOA 1S0OA 2KU7A 1VQYA 3A12A 3HHDA 3KUEA 4M5GA 5C42A 2D41A 1FE4A 3DYAA 3FCHA 3TNVA 2Y1LB 3C2PA 4W92B 4L6V3 4P52A 3OVSA 3KLGA 4ED0A 4B3OB 1JK9B 1M5SA 2FGOA 1FTCA 2KB2A 2VG5B 5GVQA 1VC6A 1NSPA 4N77A 5E41A 1VQKS 3FQKA 2ZVSA 3CO0P 3QJPA 1JLAA 5KG7A 2RKIA 1RAFB 3DLHA 1RTHA 3LP1B 3T5KA 1UVJA 1ZM3A 4H4MB 2XHWA 3N4WA 4MMOA 1C0UA 4DOZA 2AZ3A 1DQ8A 1DURA 1FESA 1H3DA 1OSDA 3DYAB 3BB5A 5CCLA 1SIZA 4KO0B 3MR6A 3EPGA 4U7UD 4LF5F 5F9LA 1FNOA 1RWWB 1VLOA 5EN1A 3DNCA 2GHVC 1RDRA 2F3JA 3BKUA 5AXKA 1D9AA 3OV7A 2P9CA 3C8YA 4DUZJ 1KN6A 2GVDB 2DO0A 2GGPB 2HAFA 5F8HA 1N5YA 4GMKA 4C8LA 2Z30B 2M3DA 3OTOJ 1M0SA 3K5PA 2GNKA 4QPTA 1U6FA 3AJDA 1NK6A 4EU0A 1J5OA 3D6MB 2HK2A 1PIEA 4DCPB 3RB0A 1FXLA 3MM8B 1UCNA 3T9ZA 3C3LA 3D6FB 1X4CA 3CCZA 3PZPA 2FVQA 1VJQA 1VOMA 1S79A 3I9V9 4M5DB 4WYWA 4O3NA 3KK3B 2W4PA 2H3EB 2HFUA 2DGSA 1LK5A 4O3QA 2AGOA 2VQEF 1JLFA 1TU0B 4OHWA 4WXOA 4OHZA 3HP6A 1YJRA 2IAJB 4FNHA 3NRBA 3Q86A 3G71S 4DMZA 5G0RB 1WJ9A 1NMEB 2AYMA 2RQKA 1YITS 4WZQA 2ATLA 1LWFA 4LF6F 2I38A 3K2YA 4ZHRB 4ECUA 2D9PA 2E1MC 3HJVA 5AXNA 3I82A 1TR0A 4I7FA 4JI2J 4FYVB 5JUMA 5KG0A 1U8SA 2ZFHA 2D3UA 4LF7F 2C2MB 3CCMS 2IYGA 3WBZA 1P9QC 3QYYA 4CI0B 3VVUA 3HSZA 3QRPA 2DGWA 4URSA 2V6AA 4ZVTB 3OVAA 2P6SA 1IN0A 3BS9A 3FRZA 4P10A 5T7LA 3W2WB 1AA1B 1MNEA 4OX8A 2IBOA 4MIBA 1S9FA 2BYCA 3QGPA 1K8AT 3TJ9A 2YNIA 2MZ1A 1ZTTA 1U1QA 1D1UA 2DVIA 3CDUA 2KM8B 2MHNA 3T6BA 1H72C 5E3QA 4Q0BA 2CNLB 3BSNA 3B4MA 1U45A 1IBCB 2CJ9A 3QQCD 3GR0A 3A3NB 2E5GA 4DV7J 1REGX 3T5HA 2V4RA 1IM6A 3EM1A 1Y0HA 3TWZA 4YQWA 5I3UB 4N5SA 1UVIA 2UZAA 3M2RA 4IG3A 2BX6A 3UD5A 1TL7B 2YNFA 1RTJB 5HVHA 3KLFA 2GA7A 1WC6A 3K8VA 1FWLA 5KT6A 2AWZA 1HYSA 4DV6F 4OHXA 1TL1B 3ELHA 4OYPA 3HFKA 4A8OA 3IG1B 2XZDB 2AQ4A 2Q43A 1IBLJ 1TMJA 4JI7J 5B0CA 4U67Q 2HS0A 3CIMA 2N7YA 4OYOA 2ZH7A 3RBZA 1D8ZA 1LW2B 1VHIA 2D74B 2UUTA 1HWIA 3H20A 3M8QA 4NA1A 4C0OC 1RT3A 1NJZA 1YI2S 3G86A 3FFIB 3KLIA 3FZBA 3HHLC 1UJ4A 3TUJC 3MPUB 1YWXA 1VQ7S 3FVYA 5HBMA 1XEZA 4TU9A 2HHUA 2EFVA 4I69A 1XMQJ 3SQGA 2H9ZA 3MF5A 4YDDB 4OX7A 2HFVA 5DZ7A 2LEAA 4ZPWR 3Q22A 1Q78A 1EARA 1SV5A 4DV6J 1HI0P 2FIUA 5MAOA 3AA9A 1BXNA 3DRPB 1DY3A 1VS3A 3CW2C 1T9VA 3HDSA 4I2PA 5F0UA 1KQKA 1UWAA 3KK2A 4CRJA 3DOLB 1VIOA 1BUXA 3TYTA 1S10A 1FJGJ 1FT8A 1Q95G 4D3GA 3Q8RB 2EG1A 2MQLA 3MM6B 4CDIA 1MLAA 3H4BA 3NAIA 3CD0A 4DHVA 2ADCA 2X3DA 5BR8F 2FYXA 1XIQA 2VC0A 1X4DA 2BV3A 2ZH4A 2LEBA 2ROGA 3DM2A 3I0RA 2LVWA 2C3OA 3X3UA 4CT8A 5H9EK 2YQ3A 4FKXA 1XNRF 1WC1A 2OEKA 5IV3A 2LA4A 3SYZA 5KFRA 5FIIA 4CH1A 2KG1A 1GMUA 1B70B 1RA6A 5ETQA 4QR2A 2B43A 4EUVA 4LSLB 2EC0A 3MAHA 1QAYA 2CPXA 2R2RA 5KOXA 2NXUA 4DBQA 1J2VA 5K9FA 2CQIA 2KYZA 1XBWA 3GFHA 4FYXB 2AW0A 5EUHA 3POTB 2YH1A 1H0HB 4CO1A 2H65B 1EZZB 1YSJA 2D69A 2OI2A 3CTRA 3E3XA 3W5XA 4O4GB 3M2UB 2F40A 2Z2YB 3MOJB 1GEHA 4ECQA 1AW0A 3KK1A 2JLGA 1VQSA 2E5LF 4FKYA 2DTJA 1HNVA 4ZVQB 2YX7A 3CJ2A 4B9NA 1VISA 4M5JA 3AOAA 4UZCA 2AP6A 9ATCB 1N34J 4K0KJ 2LQJA 3OHBA 1CEZA 1HL6A 3H40A 2XWXA 4IOBA 2YPZA 3M1VB 1PJ6A 1B0PA 3MCMA 3P96A 3SQGB 4R5PA 4QWCA 3PDNA 2ZJRQ 4PQAA 2ALZA 2CJKA 4QYZK 1UZDA 3M8YA 4LSNB 4FPRA 5D8HB 2M8DB 2QSFA 2M0GB 2B0GA 1NM2A 3PW7A 2E7WA 1R8CA 1RT3B 3ITHB 4I2PB 2IMOA 2QG9B 3GV8B 1D8YA 1XNQF 4YHHJ 3VF0B 4OX6A 2G0IA 3OFHA 1IWAA 1KQGB 1CULA 3RU0A 4EYIB 5HBMB 4KYZA 1BMQB 1NBEB 1RJJA 1HQUB 1V3SA 4ED1A 3PKMA 1E6VA 1FE0A 1Q4RA 3W61A 5C24A 2KT2A 3AFGA 3CJKB 1AUSL 2QIFA 2YWGA 2GIQA 4UQTA 3C19A 3Q24A 3QIPB 4C9DA 4FVCA 4K5SA 1GFWB 3K5OA 3ENVA 4PYDA 3M1VA 5FDLA 3W8PA 1NRKA 1VQ5S 4RW7B 4JI6J 3OPKA 4QR1A 3UDVA 1X4EA 1S1VB 4WP8A 3KHRA 1HWJA 4WE1A 3LWMA 1SL1A 4CNZA 3FC9A 1DARA 3WIVA 2BKOA 4DCJB 1XMOF 5D4PA 4F25A 4DX8H 3NNCA 2JHEA 5LSRA 2G13A 1N5VA 4IG0B 4K2JA 4IFVB 2BOPA 3RRGA 3OUYA 3RBDA 2V2VA 3VAFA 4QBUA 5D78A 3FNNA 3HHLD 2N7CA 3C66A 3FUYA 2DD8S 1RWNB 4H4OB 1NJXA 1S77D 2BBEA 2PGCA 3I32A 5CXTA 4C3LA 1FHTA 2M70A 2FD2A 2R3VA 3IRXA 3KG0A 4PWUA 3PW5A 5ETRA 3A1YG 3CCWA 2OUGA 2V50A 2IJRA 2YWKA 4IFVA 4OZLA 3D7SB 4FNIA 2XI3A 2ZH8A 3CCVS 4DR3J 1Q8KA 3HVTB 3ISNC 2FLOA 3CB4A 4ZPVR 1WC0A 4NEYA 4JI0J 3S1TA 3WDOA 2WW4A 5B0DA 4M1KA 1PYTA 2NSBA 3IO1A 3D1QA 2D3ZA 2MLXA 5A76A 2W24A 3I5CA 4NXMF 3NNAA 1YDLA 3N0VA 2XM3A 1S6UA 3K7RA 4RWXA 5U47A 3BO3A 4A4JA 1FD8A 3QWPA 2AJ1A 2V0NA 1EQ0A 2QN6B 4DR6F 1JB0C 2CPYA 4OYIA 3CO9A 3I5AA 1LK7A 4LT6A 3CWJA 4OZ2A 3GIKA 2R2SA 1BQMA 2F8EX 3TZWA 3C14B 3I55S 3N28A 4MYTA 4ZPAA 1QSLA 2J0SD 4USMA 2YKMB 2GVDA 1HLWA 1QE1B 1UWBB 4DL7A 2HHTA 3ADAC 2WOMB 1NK9A 4UY85 3AJ1A 2ASLA 1MSWD 2KRBA 4OYBA 1LW2A 3JSBA 3FBBA 4C8OA 1Q8LA 1TVRB 2BE7D 2CZ4A 2PMHA 2WW8A 4ALZA 1U6ZA 2R7XA 4A8XA 4DR2J 4DFKA 1TP7A 4ZVPB 1I51B 2XLIA 4L74A 2YXLA 1ACMB 2BW7A 1QTMA 1JLBA 3B54A 3CC7S 3TOQA 3FGVA 3SIPB 4OYWA 4LF5J 5J2NA 3BN4A 5T14A 1IWGA 1UETA 1CJUA 1IJFB 3HI9A 4ZP8A 2ACYA 3K17A 3QGIA 4TY8A 2B6AA 1S49A 2HG4A 1LQ9A 1RWPB 4OQJA 2DNLA 5SZTA 3LANA 3TAPA 4L3KA 2ZUGA 4PWDB 3OVBA 1FK9A 1Q5YA 2Z2ZA 4LF8J 5L1IA 3T6JA 4CO3A 1R0AA 1PJ7A 3A3OB 1U1MA 2X1AA 2XLJA 2GV1A 3Q8UA 4CLPA 3BH7B 2GC8A 4WWSA 3US5A 1T3NA 4N56A 2YBVA 4R25A 1X7VA 1URNA 4IRKA 2EFPA 1EQMA 3KG1A 1NCLA 4C7QA 4ICLB 4KT0C 4ES1A 1JLBB 1TFYA 1QAXA 2LA6A 3B6BA 1O5JA 3D9BA 3PM9A 2JVRA 2CJXB 3S8SA 4H4KA 2DNQA 1R89A 2GIRA 2HWIA 3M32A 3QSIA 2LYVA 3KLHA 3CCUS 4Y2CA 1PYSB 3RBXA 1BQXA 3PACA 4CM0A 1L3SA 1IUJA 3P3DA 1IBKJ 2Q66A 3K57A 1H73A 1OQ3A 5LXRA 3MEDB 3ZZTA 4DF4A 5CQGA 4DSJA 4LSZB 6FDRA 3DC2A 5C2CA 2QEXS 2BR0A 4JI8F 3WZ0A 3IAS9 3E2EA 1HQ2A 2J9DA 2J0WA 2FLNA 1HQEA 3AQOA 4LR9A 1F5BA 2BKNA 4KB7A 1UTAA 2OMOA 3P5TL 5GADU 3KLEA 2MXYA 4JI4F 3HXMA 4YR3A 1S1WA 2JFKA 1TQLA 2N3OA 3CULA 2ATCB 2KXFA 3E01B 3TAQA 2CPZA 4NRUA 4RUAA 1NSAA 3FCWA 4NLXA 3IR7B 4OZ1A 2FZGB 2RRNA 2IM2A 3FMBA 3PYEA 3ILLA 2P6TA 1MMLA 1RTIA 3ISND 4OZ0A 4RJVA 3W9HA 2KDOA 1C0UB 2B5JA 4ZP9A 5KFIA 1WEZA 1Z4UA 3R3TA 5I3UA 1OMSA 3ET6B 5BXIA 3THTA 1K44A 1OYEA 4IH6A 4BC7A 3D0IE 5IXUA 2XMAA 4KPYA 2DGTA 1Q8BA 1N33J 1WF0A 2VBZA 2ZOMA 2R7SA 4PWDA 3VQSA 3A8IA 1SXLA 4ZVOB 1N32F 2FUG9 2W4CA 1LEOA 3BBCA 4X65J 2NPFA 4BLGA 1HR0J 3WC2A 3B78A 4BDPA 2NYIA 1U8WA 3Q8YA 1RWMB 3SZ2A 1Q79A 2C2ZB 2MB0B 1G2EA 2NLWA 3FEXB 4X4SA 3OUYB 2CJYB 2XZTB 4DLGA 3P5BP 4KFBA 4M8LA 3PW0A 3RJMB 3IWNC 3V6JA 3OD2A 3PFOA 4LRDA 3BSOA 4IQXA 4ANCA 4I64A 2VFRA 3MZIA 3V6DA 2HBQB 1FX2A 2XYPB 3BJYA 2AIRB 2XG8A 3OFGA 4TU8A 2BJ3A 4LF4F 4GVBA 3K5MA 5J2QA 4B9VA 2AEFA 5F8MA 1AZSB 4OYXA 3BQ2A 3D5MA 2AYBA 4JBCA 1S1UA 1TKXB 4K4VA 5G0RA 5L1LA 3JTPA 5F8JA 4KH0B 1U48A 2PD1A 2XI2A 2YTCA 1UWBA 3SEOA 2F1FA 5JJBA 3M8SA 1SL0A 2GJIA 1V6HA 3OXLA 4OI3A 1KVJA 2GS8A 4G1PA 3U7JA 4TQRA 1MROA 4CO5A 1SB6A 3C14A 2HNZB 1VDHA 4FXWA 3D3CJ 1YHQS 1SKRA 1RWXB 3D1HA 4YB6A 2LDYA 4TN2A 5CYMB 5KG6A 2B9WA 3QFWA 3QT6A 8RUCA 2N82B 1JLGA 2A3JA 2RSQA 3KUGA 3KLHB 3DRRA 4DL4A 3BYPA 1WWHA 4AFFA 1A0OB 4WP9A 5DQHA 2HBRB 1Q16B 5BJRA 4AQYJ 3MCSA 4L3NA 2QV6A 3ISZA 4BBYA 2D7SA 4EO8A 5C25B 3OSNA 2D3O1 1RGVA 3W3SA 2YPYA 1S76D 3IBCB 1C1CA 1YGYA 2YQ1A 1WHYA 2W8LA 4B3SF 4O4RA 4ZJOA 4PEOA 4FS1A 4FYYB 3EYZA 2XGQA 2MMYA 2IC3B 4Q43A 1PO6A 3MHYA 3OR2A 4TVAB 1QD1A 4LQ3A 3ZZUA 3SCKE 4I56A 3IM9A 1WC3A 3MCNA 2VODA 1U2FA 2JNJA 4DPTA 2R7UA 1VJWA 1T9XA 4ATNA 3IXQA 3UR0A 3QGHA 1FK9B 2OHDA 1YZ7A 2JLEA 2DBBA 3J7Z5 2YVSA 3U27A 3P4UB 4NLGA 1RT5A 2V4JB 4WFNQ 2EG2A 2ZH5A 5BYQA 3TR5A 1YIJS 2OSQA 4HKQA 4OX9J 5AJ3F 2KVIA 1LV5A 3M4XA 2M9KA 3EVMA 5IT4A 2CQ3A 4DQPA 1HWLA 2DB1A 4R8UA 3O6QA 3ZTRA 4NCGB 4JI5J 4JV1A 2IY5B 3M6XA 3GILA 2LU2A 4HACA 2GW8A 3NOCA 4GC6A 3HSDA 1RHJB 3MPWA 3NNHA 3JQMA 5K14A 1QJHA 3EDRB 3MM9B 5ETSA 2AX0A 3MTJA 4PAAA 1HBOA 1NPPA 3EGWB 3OXFA 1H2UX 3O3LA 2GHWA 3AHPA 3K8WA 4F3MA 1FRKA 3PFEA 1KTQA 1W25A 3U1MA 2ASYA 2HFSA 5D0EA 4UT4A 3L7OA 1PAUB 3UVJB 3N6LA 1FRXA 2B4PA 2DPIA 2E1RA 1C2PA 1RK8A 2R2TA 2QFIA 1F1BB 1TKZB 3KWMA 3LTOA 5ETTA 3HD1A 2PA8D 3PNIA 2FC9A 2F4FA 3PIPQ 3HX9A 4OZ5A 4R0JA 4AT1B 2YKMA 1SH2A 2BA9A 3MECB 4USWA 5IV4A 2HW3A 2W2NP 3EXYA 1T03B 1AYEA 1PYOB 3NAHA 2HZCA 4ED3A 4EK2A 2MKYA 2PT0A 1D3WA 2ZHOA 4LF4J 5CD4H 1M1HA 1NZAA 1Y10A 1ELOA 4ANDA 4J9MA 2UV8G 4F0HA 3CCLS 1WD6A 1T9YA 2LFVA 3MR2A 1Q5VA 3PKYA 5HMZA 3J7YU 1SL2A 5J1PA 5CZVA 4X4VA 3GSDA 3LPEA 5B09A 3GV5B 3TJAA 3G6YA 3UR3C 2C2OB 4UQGA 5F8LA 1EAYC 1MWQA 2HNDA 4I4BA 2OH2A 4WIQA 2JL9A 1CBKA 2ZZNA 1CLFA 4UOGA 4X65F 2QX0A 4DN9A 2YY3A 2BJ9A 4WPAA 3GWCA 2HZAA 2YKNB 2NSCA 1YRTA 5IM0B 3KTQA 4E0DA 3QO9B 4ZMMA 2KFYA 1NB7A 4LSLA 1NXIA 1X5TA 1BQNB 2OPPB 2J8SA 2LQ9A 3DU6A 3FSIA 2OIHA 4TQSA 2ZBQA 4IG0A 1VBXA 1VRUB 2H54B 1RYSA 4KHRA 4DZ6A 1JWWA 2N4CA 2WB4A 3FBCA 2G0CA 2CDQA 3BQ0A 2P9GA 4U95A 5LMNF 3MM6A 4XTTA 4V19X 1JX4A 1TL3B 1FXRA 2BACA 3FZ2A 1JLQB 2Y0SD 2ZH3A 1Q0NA 2LXIA 4NCAA 1DQAA 5KFYA 1C0TB 4DSLA 1HI8A 5DETA 1SJFA 3T3FA 3GIIA 5C2GA 3DRPA 2MEWA 5D0GA 4QU6A 3IBFB 2ZE2B 5F8NA 1WEXA 2HS3A 2Q3PA 3HKZD 2UU9F 3BM7A 2XEXA 4H54A 4X4UA 1UPPA 4ELUA 2WVDA 2GZOA 2FHJA 2XCAA 1HBMB 3ITHA 4KHMA 3BGFA 4ED2A 4MH8A 3CSKA 4YHHF 5HVFA 4OI0A 2AYEA 4KSEB 1FFSB 2OLWA 5ETPA 3ZTOA 2UUAF 4V1Ak 1IBKF 3UCGA 4LBPA 3BO2A 4JI5F 1YJVA 1GXLA 1OQ6A 4OLPA 1XR5A 3IM8A 3PV8A 5F9NA 1ZM4A 2IDEA 2OFHX 3M30A 4YY3F 4DUYF 2WZ1A 3QZ7A 2H5IB 3IS9B 2B7BB 4NX9A 1U09A 1HMVA 2IJFA 2HVEA 3UCZP 1FRIA 2RIJA 1T11A 3MAQA 5KFWA 4K50A 1Q82T 3SSRA 2E5LJ 4ENOA 4EEYA 4P74A 5GAGU 4Y6IA 2E7XA 2WONB 3ZZ0A 2AJFE 4O4GA 1U1NA 4UUXA 1TFWA 3GU0A 2PFDA 4ECSA 1SC6A 1TK8A 4FDFA 1VRUA 1YKWA 2LLZA 3OL8A 3NOGA 2EFOA 2RHSB 4OV6A 3NP5A 3PX4A 1RWKB 4B3SJ 4QWBA 1G3OA 2Y1RI 4J9PA 4QYZJ 5HROB 4RNFA 4YFUA 2UXBJ 4ITSA 4JOUA 2HURA 3N9UC 4K4UA 2FJDB 5E7OB 2Z56B 3DLLQ 4USIA 4TXSA 3QO9A 5D15A 5EWGA 3KHGA 1GXUA 2E1PA 2FQQB 2ZM6J 1M1KT 3GIRA 1UVLA 4JV5F 3T5LA 2QLBB 4LF9F 4FYWB 2DNHA 2KI2A 4CO2A 2MKJA 3R7BB 5DDRC 2GIFA 1Q1KA 2J9DE 2NS1B 1YK9A 1RI7A 1KP6A 1AXQA 2BRLA 2V8HA 1NDLA 3DOLA 2EFGA 3PYFA 3U1NA 1SJ3P 1X9SA 4OL8A 1RB0A 2DHSA 1DLOA 3ETMA 4I1TA 4I6WA 4DSEA 1O6XA 4I7FB 5H9FJ 4PQUA 4M5MA 1LKZA 2XMTA 4YDXA 4RU2A 1NHKL 4LF2A 2CQ1A 2DGOA 2XYHB 4ZA1A 2V67A 4NZ6A 4QIWD 1U2RA 3W9IA 4U7CA 5DS7A 2KH9A 4DV4F 1S12A 5IT9U 4WFZA 2PEHA 1CJVA 2VL1A 4X4OA 1RTDB 5CCMA 3QLHA 1XR7A 4WYLA 3MTKA 3F41A 3W5YA 1T0TV 2G2OA 4UTGA 5H1SV 2F7VA 4QWAA 1I94F 3V4MA 1KBRA 4L73A 3EUNA 1XJWB 5KG4A 1RXOB 3BSCA 5IC4B 1K0TA 5AXMA 2WBRA 3PX0A 1SV5B 3BQ1A 5CYMA 4DR6J 3W64A 4ZP7A 1LXJA 2RT3A 2E29A 2VFSA 3UVJA 3C46A 1N56A 2V2QA 2H1YA 3R6GB 4O0IA 1TL7A 1VYAA 2YNFB 5HLFB 4PUOA 3R8YA 1N5TA 1U0HB 2VC1A 2BUNA 2VG6A 5K14B 3KLFB 2LECA 1HWKA 3WX4A 4ECZA 2J0QD 4P2SA 3CJ8A 1GTEA 1PBUA 2BMBA 2GQ2A 3HKWA 2XSJB 4MK8A 2BZ2A 3T1AA 4DV7F 1RT1B 2KT3A 1CJTB 1SJ1A 4UF4A 3W5ZA 4DU8A 3I0SB 4KPCA 3NKYA 5KFSA 1ZM2A 3AY0A 3MUVP 3BGRA 1AFIA 2MKSA 1R8HA 1FI4A 5L9NA 3BN7A 3H5YA 4K0KF 3TA0A 4NASA 1KHWA 2HSEB 1FJEB 3OLAA 4RNOA 2ZOGA 3V6HA 4I2QB 4NA2A 4ZLJA 1QUVA 4NI2B 2BE2B 4Z7CA 5KFAA 4W98A 5KTQA 3BKTA 4EZ6A 4UOHA 2B8PA 1ZPWX 3R5GA 4M5NA 4WP3A 1HNXJ 4I68A 5C25A 1QSYA 1N6QA 4BWMA 1XMOJ 3V81A 4V19J 1RLDA 1LWFB 1T05B 4J9VA 1NDKA 4LBIA 4LFAF 4ZN3A 1WKKA 2MSSA 1OY8A 1FKPA 2GAGC 3NGRA 4LFBF 3AA8A 1JLGB 4LR7A 1RKJA 4JI8J 1HI1A 1X9WA 2ILYA 2G9OA 5CABA 4XAKA 4DFJA 1JLFB 3J80U 1RUSA 5KFGA 1E6YB 1UZHA 2ZH1A 2IAJA 2ZBCA 4DV0F 1KLMA 1U1KA 1M5HA 1APSA 5DJBA 5KT5A 2J9EA 1ZBTA 3H59A 1GX5A 4HI2A 1H7XA 3IN5A 1KC8T 4O3OA 2DNNA 1TL5A 1GMVA 4UOCA 4EMDA 1R7IA 3QFHA 1S57A 1V3RA 1NK4A 2RDJA 4C6AA 2HBYB 1G4CA 3F0NA 4GO7X 3G82A 3A8KA 5KAKA 5A2QU 5HL7Q 2A18A 4F4WA 1S0MA 1BWEA 4N76A 2ZKTA 4WK3A 4ED4A 4Y2MA 2LEPA 5LM7E 4QCLA 2F5GA 2A2DA 2ZVIA 4M5HA 3L4BC 3AQPA 4ICLA 2G1HA 1F0XA 3LPYA 1XQIA 3MEDA 3MR3A 2DPJA 2OPSA 5J1EA 1KLNA 3I31A 3SXLA 4FYDA 2M88A 1WHVA 1U26A 4E98A 2RILA 2VA3A 1RCXB 2DO4A 2XS5A 1KSPA 5B08A 3CUNA 1EP4A 1YRUA 4FXVA 2N3LA 4F0KA 5J2QB 2CQDA 4Y2IA 4HLBA 1JLAB 5I42B 1YLXA 2NPIA 4DFPA 3ULHA 2R8KA 4J9NA 2HEKA 5HO4A 2YNIB 3CEDA 4KGKA 1NLKL 2CPHA 4CWBA 3MAAA 5J2MA 1X4BA 4WTOB 2E7VA 1VC5A 1T9TA 3BGLA 3PJ9A 4F50A 2YWHA 4CLZA 4D3HA 5D3GB 1U1LA 3RRKA 3VVTA 2BDPA 4FF1A 1FDBA 4LJMA 1RT7B 2O1PA 2Z0GA 3NBPA 3DI6B 4OJ3A 4WK1A 4CLFA 3CCQS 3FEZA 3HVWA 1A9NB 3L7UA 5G4DA 4YB7A 5K5MA 1TV6B 3C15A 4NLUA 2E5JA 3A8EA 3I6PA 4KAIA 1IQZA 3ZZRA 2WBMA 1XNRJ 2PA3A 3D0GE 1YTYA 1O51A 2G1DA 1UJ5A 3DDNA 4ES2A 2CWXA 1JKHA 1SJ4P 1EETA 3WC0A 2XQCA 1TK5A 2VBXA 1EP4B 1NK7A 4CYUB 1SPBP 3H0PA 3SQOP 2J7WA 2UXBF 1MMDA 1LW0B 1NKCA 3OFEA 4A8SA 1RTIB 5J2NB 3NL0A 2WOMA 3G87A 1S5ZA 2F9JA 3EVWA 4DZDA 4EGLA 1FJGF 1TAQA 3AT1B 1KONA 4Y00A 5GAEU 4ZITA 5E3RA 5CYQB 3E51A 1X4FA 5IWAF 2OD6A 4GRSA 3T5JA 1VQ8S 5E0OA 3N6MA 4TKTA 4U7UK 1S6OA 3GB0A 2CPIA 1VQMS 3O44A 3T1YJ 3PR5B 5HK4A 1V5IB 4QJVA 1OPZA 5AXLA 1NEEA 4DR4F 3K89A 2EWHA 2L9WA 4DLEA 2JSXA 3EXCX 3RRHA 2GO9A 4RZRA 3DRXA 3GP9A 4TLRA 3R1LA 4LRBA 4NLRA 3N79A 2RVJA 1Q53A 5A8RA 2DEIA 2DYAA 3M6VA 2AEMA 5GAHI 3VAHA 2UUAJ 4JI7F 3W65A 5I42A 3B4DA 2IRXA 4ZJQA 4NYOA 1XC9A 3DGPB 1LW0A 2KFNA 1RBLA 4Y34A 3MMBA 2JX2A 4N7TA 4JUZA 2HHXA 1RHKB 2UXDJ 3UD4P 3SBMA 3M8RA 5CD4A 1M90T 1S7HA 4HL9A 3D54A 3IGNA 4LQ9A 4LR8A 3GZ7A 4NLQA 3VWSA 2VBYA 2R7WA 4ID5A 5LL6d 1N32J 4JI3F 3G6VA 3N5BA 3T1HF 1EIYB 1KFDA 4NMXA 4O3RA 4NI2A 1Z2ZA 5THWA 2G0JA 1RBAA 1VLYA 2MZTA 5CZXA 2X1BA 3TANA 3HMJG 4X4TA 5C42B 1AB8A 2LCWA 2V2ZA 1B4SA 2X51A 1NSQA 5HMYA 5GMDA 3MAAB 4TYBA 5DZ6A 1XN9A 4DR1J 4RU9A 4YN3B 5AE3A 3UPFA 2R8HA 1UMJA 4U6PA 5FLXY 5HROA 3G6XA 1VC0A 1GQEA 4QYRA 2CJBA 4OYZA 4PXDA 1JNZB 1CJTA 3LGMA 4WFBQ 2VJVA 2CPJA 4IFYB 5DO2A 2HK3A 1K1SA 2XNQA 5ETKA 1LWCA 2WVFA 3HSGA 3P8BB 1CS4A 1WG1A 3MCOA 3MEEB 3IGVA 2V8DA 3MWBA 3J7YI 4IRCA 2AJQA 3I96A 1R8BA 1TMMA 2DR8A 5D6GA 2HIYA 3DKDA 1U0HA 1O8BA 1Y5NB 1YVFA 3OBIA 2OAUA 4ZVRB 1RLCL 3HD2A 2I5JB 1B99A 4F3OA 1U1OA 3Q83A 2M52A 3CMES 4NXNF 3FK4A 2HVIA 1RU2A 1VCTA 1ZS6A 4CTAB 2AJ4A 2IVFB 2ZH9A 1IR1A 2ERRA 2CIMA 2ZNYA 2ZBPA 1T8EA 4FN5A 4WKYA 2QFJA 2VQEJ 2DITA 1RP5A 3KXDA 5K8MA 4LFBJ 3HHLA 5E3PA 1WI8A 2KTQA 1HQEB 3CDAA 3ILOA 1DFDA 3LAMA 2DGQA 2HAIA 2GX8A 2K3IA 2V63A 4ZIVA 2R7QA 4KKOA 4RW8A 2JVOA 2VUGA 3O2IA 2Q6BA 2R8IA 3OJUA 2CWKA 3RR7A 1Y7PA 3UO0A 3O5TB 2ZDOA 4R5PB 4X4RA 1IKWB 1VQ6S 4X64J 1DRZA 3RGIA 1WHXA 3CCJS 2RD5C 1KQFB 1F3VA 1RACB 4Q44A 2JEIA 3DLGB 1XTZA 1S6QA 3OTOF 1YBTA 5HQ8A 4Q8EA 2CG4A 4HT5A 5HATA 4QWEA 3BBFA 1HNVB 2XY5A 1GH8A 1N48A 4XDCA 4L72B 4I6AA 5C5JA 4PQUB 2ZHBA 4IUFA 5JVGQ 1VQ4S 3UCUP 5DM6Q 1ZA2B 4DXLA 4F0MA 1IKYB 3PRVA 2OTJS 1R8PA 1VK3A 2CVIA 5KT3A 1BWVA 2QYCA 4DX7A 2VJUA 4JYAJ 2KO1A 1VFJA 3GJRB 1CJKB 2GJFA 2QMWA 4PABA 3FCVA 1U24A 4YUDA 3HVTA 3IR5B 2JDJA 3PR4A 2OEJA 3H42A 1YJNS 3SFUA 1WC4A 3MEGA 1ZM9A 3KKFA 2W8KA 2HHPA 2CAJA 1QVFR 4X2BA 2GVZB 3BGRB 2HQCA 3NS5A 1V5VA 1AT1B 3M8PA 1S9GA 2EVZA 3D0HE 3QJLA 2JFDA 3FBFA 1WF1A 5IM0A 5B0AA 1FKAF 4CCHA 4G3IA 3MM7A 4EO6A 4GC7A 3PEHA 3MXHP 2DH8A 1CJKA 5CA5A 2UUWA 4P2FA 2HRYA 1T94A 2M7SA 3OXGA 4ZDNA 3PJWA 2LU1A 2AV5A 2EK6A 1PC5A 2E1AA 2P2CB 1G7CB 1JIHA 2SXLA 1YX2A 2VFTA 3ZC4A 4DV3J 4ECTA 3DOKB 5T41A 3NCQA 4YB5A 2L41A 2XY7A 2FVRA 4PUOB 2LQ8A 2KZZA 5L9XA 1CQMA 4LREA 4DPOA 2QE5A 3VAGA 3C16A 3ZNUA 5SUHA 2XTJP 5KG1A 2H5JB 4PWWA 5IQ6A 5A8KB 3JTNA 3EE3A 3BSAA 2NXJA 2KVQE 1UW4A 3C6TA 4ZVHA 2ZNZA 3QIPA 1VIXA 4Y65A 1H74A 1KOHA 3G2XA 2GCFA 5E3CA 3SDEB 4DCOB 1KR4A 3EICA 1R27B 4OFZA 2GMJA 1I1GA 4DL2A 1IBLF 1FX4A 3CJ0A 1IM4A 2LDIA 3MDFA 4OYAA 1NK8A 3GFYA 3BEGB 3H98A 1Y3JA 1JQGA 1WORA 2QZ8A 3HHLB 3TJ8A 4DEZA 1JNRB 4ES3A 4NA3A 2OO4A 2Z57B 4OIXA 3S7RA 3ZO7A 1YZ6A 4LFAJ 5M2UA 3PIOQ 1U49A 2JEFA 1QTNB 2DH7A 3J7AN 4MKBA 5CAAA 1NPRA 3GMGA 1YRXA 2CUYA 3RBEA 2UUBF 3M6WA 2K1RA 3AD9C 4O0NA 4DU7A 3HCXA 2HVHA 5EHHA 1PKUA 2DXDA 2HQDA 3V5RA 2FPHX 4MKVA 3RAXA 3QIDA 1F5AA 5J1EB 4Y2KA 4P2MA 2G4BA 3TQEA 3DLEB 4AE5A 4RL1A 3NCPA 4J91A 3AXKA 1JLQA 3OW2R 4DR7F 1HBOB 2EW9A 5KFZA 5FLXU 4XO0A 2F65A 1NUEA 3C6TB 3WIUA 1HA1A 2BOAA 5D4OA 4J9OA 3R1HA 2PO4A 3UNGC 2YKAA 1KQSR 1Y9OA 2HFOA 4OHYA 4NLPA 4DPXA 3KHHA 3KNGA 1HHTP 4LVNP 1S97A 3RW7A 4F36A 5A2QY 4G1IA 2B9EA 4X62J 1DTTB 3PRBA 3KK1B 4UUWA 4N41A 2HGLA 3HHEA 1RT5B 3GJQB 4NLWA 3MM5A 3NLCA 1RA7A 1I3OB 2DJWA 5J2PB 3IRXB 5JXSA 3K59A 4K4ZA 2QSWA 2YKNA 2QJ3A 2VASA 4AUKA 1KTVA 3MM7B 4RW9A 1D0EA 2BM1A 2RDDA 2W7AA 2XMWA 4PZVA 2I9SA 4CLSA 5LMUF 2HQ3A 3JYTA 1AFJA 1UFLA 1DTTA 1GMWD 1R6VA 1BGXT 2ZUAA 2ILZA 3DDKA 3DMJA 3QGGA 4DDFA 1L3TA 1HMVB 1FNMA 1ZZNA 2DRBA 3KNAA 5B0FA 3GG1A 3IR6B 3TUIC 2Q1LA 1IR0A 2C28A 4NOHA 3CT9A 2MKKA 1HWUA 4WJBA 5DDOC 1D9DA 3NY0A 1I94J 4FF2A 2UP1A 1ZYQA 3H2VE 2VQFJ 1GTHA 2RQ4A 3TVKA 3VV2B 1NAQA 4JI1J 4LFCF 5A8WA 5GADI 1U6BA 2R4FA 1EHWA 3GONA 3FFIA 3Q8VA 4P2XA 4USHA 2OMLA 3CJKA 4MK9A 3G96A 1SKWA 2DR7A 5K8PA 2V8GA 3OJSA 2PI5A 4DR7J 5DQIA 4M94A 1B0TA 2GMLA 4B9UA 2YWWA 1UVKA 3P45B 1N0UA 4WFYA 2KM8C 2CQCA 1G6BA 3MPVA 2DKOB 3PCOB 2XMVA 5A8KA 1RHRB 2POKA 2IJNA 1AUDA 1T9WA 3NWRA 5L8RC 1UPMB 1RYRA 4CLKA 2CPFA 3C6UB 2VB6A 3MOZA 4AL5A 3HPOA 2FB0A 1S72S 2MDAA 4CYUA 3D4JA 1RAJA 1RHMB 2LQ5A 3CJRA 2QA4G 3X1LB 5EWFA 2UV8A 4NZ7A 5J1NA 1IVZA 4GVBB 2IVMA 3KJFB 3W9JA 5DDQC 4DN0A 2BABA 4A8KA 2Y1IA 1SKSA 2ASJA 1NKEA 3PJXA 2K06A 3KMSA 1D9FA 2QA1A 4KFBB 2ZJQQ 2QT7A 3M8WA 1UL3A 2EBEA 4FBTA 2AMCB 1HNIA 4ECXA 4KO0A 3I87A 4A8QA 2GQQA 2V4JA 2A6MA 3BO4A 1C4AA 2DGVA 3DLBA 4DQSA 4M95A 2GJ2A 5HMWA 3U02A 4ZKAA 1WTFA 4O23A 2RKIB 3VCDA 4GKJJ 5KFCA 3UW1A 1NJIT 4HEA9 1QDUB 1WEYA 4HI1A 2MY7A 4ID5B 4DPUA 1D09B 4C8MA 1REVA 7FDRA 4ED6A 1WELA 2AT1B 1X31C 3MEGB 3HHKA 2OGUA 4HVZA 2MQQA 2AGQA 2HGNA 2DRDA 2DNGA 3W8GA 4NPOA 2CYYA 4HTIA 1WF2A 2CJQA 3NGTA 2XO6A 3DHXA 1J5EF 1IBMF 4LF8F 3FRYA 3VQTA 3KLVA 5KFTA 4C2MA 2RQMA 1MMNA 3LP2A 1FERA 1PAEX 3W1YC 3W62A 5A8RB 3TUZC 1A6LA 3BDEA 4MAKA 1OYDA 2MQ8A 3MECA 5LSLA 4NLOA 3GIJA 3CMAS 2MKHA 2MPUA 3QWUA 4B9SA 2OELA 1KKHA 4WKRA 4K59A 3MMBB 4KGVB 3RAQA 1P27B 4OI6A 4DS4A 2UUCJ 3OTBA 4PG5A 2IA0A 1HPZB 1S9EB 3LQVA 1OY6A 6FD1A 1P9YA 2HS4A 2FHOB 3UDLA 2P8IA 1DAXA 4M5DA 3KK3A 3UN5A 2K8GA 4WF9Q 4F04B 1E6YA 1SH0A 4B08A 5IOLA 3VGTA 3GYGA 2WK4A 1H2VZ 1S1UB 1TKXA 2RNEA 1LFWA 3M8QB 4ZVSB 3UNYA 5KFXA 3HZGA 1QVGR 4IRDA 4LUBA 3EGZA 4KRWA 1S4EA 4QQBA 1QM9A 4Y0FA 5A0YB 3V4IA 3UN3A 3BGUA 3CDEA 1VQLS 1A7GE 4CZCA 4B3MJ 2BJDA 2HHHJ 4NLDA 4NE9C 2VD3A 2RAQA 4OZ3A 4CLWA 2IIHA 2J5AA 3L3CA 1WHWA 2CPEA 1U25A 2ZKUA 1VRQC 1CC8A 2Y9HA 5EX0A 4ZPTR 3OR1B 1X4AA 3T41A 2FVSA 9RUBA 3NS7B 3VGSA 4OLOA 1GX6A 1JLCB 2XHCA 2ACMA 2RF2A 4A8YA 5FD1A 5L39A 1O0PA 4MKYA 4NMLA 1Y3KA 2KHCA 2ZBRA 2VPXB 3DXBA 3TVYA 3D2WA 1Q7LB 5HMXA 3SI8A 4Q0BB 4ZP6A 4NLVA 3JAMU 3KJQB 3MUTP 4EBCA 4DV2J 4WZMA 2FJBB 2WSCC 2COLA 3Q8SB 3VHQA 1F2GA 3DI6A 4ILMA 1X5PA 2B8QA 4HDHA 4RW4B 4DX5A 5L1KA 1VQ9S 5T7LB 4HHUA 4B3RJ 2C3UA 2FHJD 4WXWA 1EKSA 5J2MB 1WI6A 3OQ2A 1RWVB 2VG6B 4G1QA 3ZFVA 5EGYA 4DR1F 1S59A 2DXFA 3GPAA 2HLUA 2RDIA 2P5VA 1X0FA 1ZZFA 2DNRA 3CJTA 3BR9A 2WVBA 2KYXA 3LP0A 4O3SA 2DNYA 3L09A 1BD6A 2WRMA 2VG7A 2Z2LA 1UKUA 3PHTA 4PXEA 2B7CB 3TX8A 3GV7B 3HVRA 1S1WB 3NMRA 1S6PB 4RUCA 3PX6A 3KLEB 1XR6A 3CE8A 3DRRB 3DGPA 2X7IA 2K7KA 3NGUA 1TVRA 2VOPA 5HP1A 2R8GA 1U7LA 3TAMB 1EKRA 4IYQA 3B82A 5GAHU 1OJ4A 1WG4A 3C6UA 2B4VA 2MLZA 3MPDA 6AT1B 3OHAA 5HN0A 4KJIA 1W2IA 5JVHQ 2L08A 5I3QA 3SSSA 1M5VC 4RBVA 4CLLA 1FA0A 3HT0A 4IDKA 1F3FA 2JC0A 2OP5A 4J5OA 1DHMA 1RT4B 3R5CA 3MD3A 4USTA 1ZAWA 3TZXA 2DR5A 3KUHA 2IM3A 1LFPA 3QPIA 2FHMA 3MM8A 2QL9B 4TLQA 5DDPC 2MZQA 3R5AA 5B7WA 1NJWA 5AE2A 2CKWA 4C8NA 4RUHA 3DLKB 2F63A 4Y3CA 1B64A 1RT6A 4MFBA 1FKPB 2WSFC 2HHQA 2B4OA 3NG8A 4DL5A 2ASDA 3LP0B 4B9LA 4RO0A 3ZTPA 5GAEI 2GGPA 1N5YB 1P1TA 5DLGA 3T9NA 2Y8WA 1HNZF 1TKTA 1BHNA 3T1YF 1Y5LB 3ETOA 1ZTWA 1FF2A 1M5PC 5KFFA 2FLLA 1WOSA 3AODA 3Q0AA 1WSVA 2E9RX 4LRCA 3R97A 4AXJA 5K8NA 4B17A 5K20B 4RW4A 2HWTA 1HNIB 1B7YB 2XO7A 4RNMA 2W9BB 2VOOA 4GKJF 1ITPA 3RB6A 3P49B 2KFZA 4OZJA 1U02A 4A8WA 3NGSA 2CNNB 2DEJA 4PG4A 5BYSA 2KJVA 1KEKA 5KFDA 3R2DJ 1JXEA 1KVKA 2KJWA 2VDHA 3CD5A 4RUBA 3BR8A 3TX0A 1JJ2R 1UEVA 3VAKA 3RR8A 1ROFA 3M2VA 2C2DA 2YNHB 3A8JA 2BJ1A 4IO1A 4RBTA 2XSJA 2DHHA 2WTFA 2ZJPQ 4IOCQ 2MZJA 2IYIA 3OR1A 2ZH6A 3TUPA 3R7SB 4J9SA 3AXMA 3W63A 1UA1A 4ER8A 1FDAA 2L9NA 4JB8B 5F3ZA 3UE2A 4F4YA 3ZNJ1 1I6JA 2VU5A 2V4QA 1N52B 2W1BA 4QZVB 4CM2A 1GAOA 1K9MT 3PY8A 5HLFA 1TUGB 4YR2A 1YJ9S 2UXCJ 1S1XB 2K3KA 1SQGA 3IA0A 1JJ4A 5D4LA 2RS2A 1QAIA 2C2NA 3W2VB 1ZAVA 1B0VA 3CJSA 4X64F 3DHWC 2VF3A 2DY1A 4S0MA 2XGPA 3DFEA 4ZCIA 1T02A 2IVYA 2ROPA 2HNYA 3OFFA 3PTWA 2BVZA 1RKIA 3VGUA 5H9EJ 1F9FA 1SJRA 3PXGa 5BR8J 4K8RA 2YNGB 4IQMA 1PC4A 3A13A 1GNKA 2MQMA 2QLWA 1FTRA 2W2OP 3CMQA 3GFXA 4PG7A 4RBUA 4C97A 4ZLLA 5B0BA 3KJVA 3J7A1 3RUBL 3QT5A 1HBUB 4LF7J 5B0EA 4I67A 1XWLA 1C0TA 1VK8A 4PPZA 2BJ8A 2F8HA 3A3PB 4USKA 2AX1A 2EI5A 2JEJA 3R5BA 1N6QB 5LXYA 4P73A 3PYDA 1HR0F 1OWXA 2HFNA 3M9MB 1GT8A 1XMQF 2DIVA 2MLYA 1VMBA 2RQCA 2ZWOA 3ZTSA 1F9HA 1Y5IB 1L3UA 1C4CA 3SSQA 3R27A 1RT2B 2X3GA 2QO3A 2J7UA 4DUTA 4Q7AA 1VQOS 4ZVFA 1QSSA 4IR1A 2OSRA 5IC6B 4U8VA 1FKOB 2V69A 1IBMJ 1NH7A 4BCAA 4F4ZA 5LMUJ 1SVDA 2VPZB 2VKRA 2HRTA 2WB1D 3GSIA 4LMZA 3M2UA 2WVCA 3K5NA 4HH0A 1IKXA 1NHVA 2DXEA 4OYMA 4H4OA 1FRJA 5L46A 3J81U 3GYNA 3BREA 2BE2A 3HT3A 3H25A 3CC2S 5C7PA 2BEFA 3DU5A 3GFZA 3H4DA 1VRTA 4U8YA 3BGOP 1I5OB 1DJ0A 2H51B 4Q8FA 2DHAA 4QW9A 2ZEJA 2V2KA 4ZJLA 2C42A 1WDDA 2YX4A 2V8VA 4IH5A 4KE5A 3I0SA 2MZRA 4HR2A 3DDIA 3W7BA 3IBWA 4MJKA 1KD1T 1WOOA 4K5RA 2E66A 2O3DA 4WE1B 2V94A 3V4IB 1FFWB 4OZNA 2FY1A 4O3PA 1HARA 2VBWA 2W9CA 4DQQA 4PRFA 2A0FB 2KN4A 3RZAA 2LQBA 3TQ1A 2BKPA 3BV8A 4F4XA 4GKKJ 2H5EA 3HFZB 3TO8A 3PO4A 2V9WA 1HQUA 3FSYA 5KFKA 5LJ5Y 4OI4A 2Z8QA 3TW0A 3EGVA 4KQZA 1HBNB 5IZHA 3CDWA 3M30B 2BQRA 1BQMB 1HPZA 1CULB 1S9EA 1SCJB 1UP1A 2G2YA 2YNGA 2D1CA 2E5HA 3PHEA 3V2UC 4F4AA 3GLJA 4KV8A 3WQPA 2O67A 4CH0S 4EI2A 4DL6A 2ZE2A 2FJEB 1YJWS 5DRKA 3M9NB 5LT5A 1RU1A 4F7VA 2IA6A 1N54B 4DL3A 1EX8A 2BRKA 2RUSA 4FP9A 4OHVA 4EBEA 4X4NA 5A8WB 3BYRA 1HBMA 1NDPA 1RTDA 1H2TZ 3EZ5A 1MG7A 2HVDA 2ZDPA 3HZEA 3HO1A 1N4LA 1HYSB 4KC5A 2CVEA 4ZOSA 5IS2A 3VR1A 1TL1A 2B4UA 2EEYA 2KT5A 4WU2A 1IXKA 1EB0A 1SIWB 4C11A 1RBOB 4XPEA 2PMZD 2U2FA 1MWZA 1RE1B 1REVB 2VV5A 3UDEA 1H38A 1OO0B 3QATA 2ZD1B 4KGMA 2R8JA 2IPOB 3EGNA 4C4WA 2UVVA 4WFXA 1DTQA 4YP3A 1OS5A 1IJEB 4RKUC 3TZYA 4ILLA 4PKDB 1N8RT 1DTQB 1TL4A 2LXFA 2BQ3A 4DUZF 1ICEB 2KHDA 1LNQA 2HKEA 2ABYA 3NXZA 4DQRA 1HHQA 2EFNA 3MM5B 4DR2F 2VICA 2AJ2A 3MGJA 4OMFG 4P9SA 3WX8A 2V34A 5I3PA 8AT1B 4NLSA 1Q8IA 3RW6A 3EMTA 4DV1J 1FRLA 4LRAA 1VBYA 1KFSA 2HBZB 1V9OA 1W7WA 3CVKA 3M7VA 4ILRA 4W4MA 4BS2A 2RUGA 3AH6A 4RW7A 1N0VC 1T03A 4JV0A 4FXDA 5LSOA 1R31A 1P8GA 2J8AA 2QL5B 3JSRA 1IKYA 2PDAA 2ROEA 3DOMA 1HIYA 3FMWA 4C0BA 4CO4A 4F3QA 1FVQA 2AF6A 1GXTA 2DH9A 1U47A 3R5JB 2IDLA 3KK2B 1S7IA 1QAJA 1PSDA 1HBUA 3R6LB 3PVXA 1S6QB 4H4KC 3SMZA 3OLBA 3EWGA 4DF8A 1HBNA 3UFCX 2FGCA 4BC9A 5EDWA 1BY9A 1G1XA 2HRUA 4KKOB 3MMCA 5EWEA 2C1EB 4PG6A 4ZPDA 1DZ5A 4KGZB 5CH7B 4DUYJ 1K0VA 3SV4A 1VHFA 5KFJA 3OTDA 4JI0F 4DR5J 3VAJA 3L95X 2ZZMA 3N01A 4KV8B 4ANEA 2OJ3A 4GKKF 4OI1A 4RWWA 2IHR1 3QNWB 4LSNA 1NK0A 1J5OB 7FD1A 3K58A 5RUBA 4RW6B 4ZN1A 3TEGA 2PSZA 2XBPA 4NXNJ 1H6KX 3ILIA 4RX6A 2JEGA 4C48A 4R8UB 3RG6A 1HKAA 3J81Y 2I5JA 1NU4A 5KOWA 4KHPJ 4P7VA 3C16B 4EBDA 3H5SA 1YBUA 3GIMA 2I2YA 3UWTA 2RE1A 1SJQA 4DI6A 3JYTB 4DWIA 1FVSA 5ADZA 3M2VB 1OPIA 2YX1A 3AD8C 1MU2A 2EKNA 3EDQB 2YNHA 3JS9A 2X1FA 1JKHB 3CIZA 2JC1A 4Q2MA 3LF0A 1S9GB 3HF5A 4NCGA 3ZZOA 2F4VF 2JRSA 1S4FA 1GK8A 3UDCA 5LMNJ 1SKUB 3Q2SC 1HFEL 2JWNA 4QIEA 3TEHB 1BQNA 2MYFA 3DRYA 1WDTA 1NSKL 3QRRA 4CLYA 1RZMA 3SCLE 1RWOB 2CQ2A 2Y0BB 3ENWA 2Z58B 2Q79A 3DM2B 3I0RB 2EPIA 3ICLA 3JTOA 3OR2B 1RISA 2A1BA 4L76A 2MJUA 2PN6A 2PMWA 3GQCA 3W2WA 4DSFA 5KFQA 3NGKA 3QT7A 4IKAA 1V3ZA 2AU0A 2O5DA 1M5OC 4JI3J 1FEEA 1NK5A 1IKXB 4DPYA 4A8FA 5ETMA 1FJ7A 1R0BG 3O8WA 2RJZA 2C3YA 3CJ3A 4J9LA 1UW9A 1HNWJ 2C22A 3H8YA 2L3MA 2VIHA 4A47A 1GMWA 1U4BA 2VDIA 2BANA 3CCSS 5E2QA 4KR0B 5DGBA 2I0XA 2UVWA 2UXDF 3ENAA 2XMKA 2W4DA 1VR6A 4NL5A 2KZMA 2PI4A 2O66A 1NHUA 3THPA 3FEYB 3HULA 2Y3YA 1XERA 1FXDA 2MGZB 3VGVA 2C3PA 4HDGA 4O44B 3Q89A 1FRHA 2YKQA 2DGXA 1FNXH 4E2FB 2PE8A 1FJCA 1KS2A 1FWKA 3AAWB 2E5IA 4KH1B 4EYHB 5DGAA 1SUQB 1W2BR 1N34F 2MTLA 2BJ7A 3G8TA 4F26A 1WG5A 5HQMA 4DQIA 1VI7A 3GTYX 3F44A 3IG1A 3R5DA 4WCEQ 2NYHA 5IT9Y 1F60B 3DN9A 2NUUG 4PPDA 3PRDA 4DV4J 1UVNA 3AOBA 2MQPA 1TTHB 4HYKA 2DGUA 2LKZA 3JSMA 2MKCA 3OL6A 1OY9A 4DV5J 4MK7A 1PG5B 4GO5X 4KIAA 1TK0A 4ZVUB 5DQGA 1RT7A 2C3MA 2LXUA 2VFUA 3MMAA 2O01C 3NBPB 4ZCKA 4CQ1A 1DQ9A 1ZETA 3IMQJ 3AB4B 4DV1F 4IFYA 3VZHA 1U0SA 3ONQA 5K8OA 2C2RA 3PO5A 4QPXA 2KRRA 1CS4B 3MEEA 5M2RA 2ZM6F 2W7OA 3ZZZA 1U1RA 3I4PA 2HFZA 2ADBA 2OTLS 3V81B 1EJ7L 1JJHA 2VG5A 1DBDA 1CSJA 4QIFA 4CP5A 4Q5VA 3RB3A 3QRQA 3GR1A 5KFLA 3MFIA 3KOAA 3QJJA 1T3OA 2CQHA 3PEJA 3GE9A 3MEKA 2VHGA 2U1AA 1YBAA 4BWJA 1CJUB 3LOUA 2AEJA 1T9UA 2LP4A 2VPYB 1S0NA 4PXBA 5DG9A 3SV3A 3JXOA 2CA9A 4NYZA 4K4XA 4M5KA 3UQSA 3JSMB 1N88A 4KBIA 1S0VA 1T95A 4Y2AA 4A48A 4ZHRA 4FVMA 2HMIA 4NCBA 2DT9A 3HSJA 3M9OB 1XMBA 4MIAA 3J7ZT 4ED8A 2XC9A 3G8SA 2FJVA 2GFFA 4HHHA 4F2SA 1X8DA 3TVZA 3G82B 4YY3J 1X5OA 3M6UA 2DK2A 2WHOA 2HNZA 1M1GA 2XNRA 2R9LA 4N8OA 1T7PA 3W66A 3IC1A 5D4NA 5ETLA 1Q7YT 1LXNA 1KRPA 2KXHA 2ZITA 2FZCB 2XWYA 2YWEA 2QLFB 3KJNB 1B3TA 4FBUA 1M5KC 8ATCB 3GCXP 3KHLA 2DHXA 5HP1B 2QGFB 3KYLA 1VQPS 4ZLNA 4USUA 1AROP 4DL0C 3R2CJ 2NQPA 1S1XA 3BZQA 3IFEA 1VGYA 2EXUA 1RAAB 2HQIA 3D67A 1RTZA 4C3KA 5L1JA 2UU9J 1FO1A 1S6PA 2HHVA 4AL7A 5CHCB 3LALA 5KFBA 2MHEA 2HMIB 2KG0A 4DV0J 3QSYB 2AD9A 4QW8A 3D1OA 4G1QB 1UAWA 3H5UA 4JV2A 2Q6CA 4RLEA 5GAGI 3CF5Q 2NZ4A 3Q2TC 1S99A 5KFOA 3JQJA 1LWEA 4DG1A 4ZK7M 1OSCA 3ILJA 4B3RF 2K2PA 3NEKA 5KFVA 5FJ4A 4UW2A
chains in the Genus database with same CATH topology
4AYBD 4ECWA 1RTHB 2HVZA 3LP1A 2L48A 2CJAA 4H4MA 4OI2A 3AJ2A 1HNXF 3DRSA 3VZIA 3D28A 2CRLA 1TV6A 5L38A 4ZPBA 3HM9A 4ID8A 3TP2A 3ZZYA 2XCPA 3MFHA 2R7RA 1JLCA 1SQEA 3F73A 3MR5A 2RF2B 1BC6A 4OJHA 2RB7A 4I2QA 2A2CA 3MURP 3DXSX 5I4MA 4UY8T 3QAEA 4M63A 3G4SS 4CO0A 5CYJA 3VAIA 2RH3A 2F8MA 2EKYA 3I9ZA 4B3MF 4KTQA 1MWYA 3J80Y 4DR5F 5FDLB 2B6AB 5A0YA 4PCQA 4N47A 4C98A 1UJ6A 5F0WA 4BHQA 1KHVA 3MMAB 1N33F 4ELVA 4IDKB 4HTJA 4PG8A 2PC6A 1YJUA 4QWDA 3CDBA 5C24B 4QU7A 4AL6A 1JMTA 2C2EA 3KG4A 2IFXA 5KT2A 2NR0A 3QLHB 2B9YA 2IBKA 2MZSA 4F67A 4ECVA 2PIIA 3S6EA 1S1TA 1FDDA 4P7TA 3IAM9 1PILA 2DNPA 5F8GA 2EBGA 5LJ3Y 5KFHA 4X4PA 1TUVA 3B8HA 4XPCA 1MW7A 2VFVA 4O44A 2HYIB 1NO8A 2W9AA 2MGZA 3PW4A 3NS6A 4IH7A 5B0GA 2N4DA 3CCES 2MQNA 1HW8A 1X4HA 2Z2MA 3LUYA 3RB4A 4DSIA 2JLFA 2HGMA 4K2XA 2B51A 1T05A 1EETB 2VPWB 3BDPA 2BXJA 1TKDA 3HVAA 2B3TB 5KG3A 2FJWA 2FDNA 3LP2B 3HHNB 2XZWA 1NKBA 2XS7A 1X4GA 3CJ4A 4OX9F 3O1LA 3MUMP 1HHSA 2BJEA 2HHSA 2FVCA 4DS5A 4B9MA 4C8KA 2XB2D 4P6QA 1C1BA 4XIUA 1R43A 4NYPA 2OPPA 4IOAQ 1R0AB 4FS2A 2DHGA 3TA2A 1K1QA 2OD4A 1MU2B 2E1CA 1S48A 3IS9A 4TY8B 4EZ9A 4QOTA 3QAUA 4LIRA 2LMIA 2WONA 3EZUA 2ZOFA 1F5CA 1CC7A 2OPSB 3MD1A 3RYLA 1QE1A 3DLJA 4B02A 5J1EB 4TU7A 4WF9Q 2XS2A 2QLXA 5DG8A 2DNOA 2IM0A 3JB9k 4RW6A 1R8AA 4IR9A 1RWUA 5IFMA 1IKWA 1X5SA 3CGIA 4K4YA 2Z4PA 2J6TA 1Q86T 3I4HX 2WSEC 2ZBIA 4A46A 3OL9A 2APOA 5IT0A 3IRWP 2HLTA 2DIUA 4I0WA 5KFEA 3G6ES 1SUQA 3NCRA 1E6VB 3JSYA 3NWGA 1NNDA 4ED5A 3IWLA 3TARA 4WFAQ 2OPQA 1H98A 2VQFF 1NH8A 2DNZA 2IM1A 3SCJE 1NJYA 2DRAA 2ZHAA 4URQU 2XY6A 4TY9A 2JJ4D 1YJTA 2RS8A 3M05A 2JH3A 3QZ8A 4WTYA 2QA4S 5KG5A 2E9ZA 4EWTA 3N5FA 2FLPA 4AXIA 2XLKA 3GYXB 1IKVB 4HH1A 1LWCB 4MTPA 2NREA 2DNMA 2HWHA 4ZCLA 2I1RA 4OJGA 2BM0A 5M2PA 3HK2A 5F3TA 2WAQD 3K5LA 4B9TA 4ZPCA 5J2PA 3K0JA 4ECYA 1N5QA 1VBZA 1XK8A 5ITHA 3M8PB 3DCAA 4ZVEA 2KKHA 3AB2B 5KG2A 4ZVGA 3VAMA 1KOOA 2RU9A 4RW9B 2JZ5A 4J9QA 5D77A 4ED6A 1HNZF 2UVUA 3H2UB 4QR0A 2YKOA 3PW2A 4W90B 2HNDB 1RT1A 2CQ4A 2M4MA 4USJC 2HHHF 1QUPA 4J9RA 3CJ5A 2CZVC 2DISA 3LGNA 1WTBA 5F8IA 2P9EA 1SI9A 5IQQA 2E9TA 2DCLA 4C11B 2CQBA 1K0VA 3HJFA 2CQPA 1HD1A 1FKOA 3CXCR 1R3NA 1S1VA 1ULRA 3OTCA 3CCTA 1KVIA 2DR9A 2K1RB 1X0PA 3MPYA 4ED7A 4I6YA 3H5XA 2X1GA 3RAMA 1P6TA 2OPQB 1L3KA 4URGA 2J6UA 4HHJA 1YG0A 3DLEA 1ZAXA 5A6WA 4Y28C 4JI6F 2KXNB 2CQGA 1S1TB 2D9OA 2VONA 2UXCF 2DCUB 4WU3A 3MMCB 2J0XA 3F56A 3FDSA 5F41A 3SDEA 2EFQA 2VH7A 4CTAA 2XMUA 2M2BA 4ELTA 3QMQA 2FHKA 4PR6A 1FDNA 2W7PA 4ZCMA 3CCRS 3DMJB 1FD2A 2HNYB 2J7KA 1TL3A 2HHWA 3DOKA 1RTJA 2WCXA 4F8RA 2RRAA 4MIWA 3POTA 1SH3A 4DV3F 1ZPVA 3H2LA 4C3MA 3NGDA 2Y1JA 1U1PA 3MMJA 3Q8PB 2QRRA 4OV1A 2VKZG 5A6PA 5AE1A 4RNHA 2VZ9A 2VA2A 4ETZA 1Y4ZB 3KLGB 1C1BB 3CD6S 2V5HG 3LWLA 4B3OA 2OKQA 3SCIE 1VRTB 2GO8A 2IRYA 2HPUA 5D3GA 3LO3A 5BYRA 4U9RA 3Q8QB 1RT2A 1TZ0A 2ZC4A 2PFFB 3ENQA 1X9MA 1TKTB 3V6KA 1IKVA 3OTEA 2HIQA 4E8UA 4JYAF 2ZD1A 4WIIA 2CPDA 1QY7A 1RQ0A 4Z37A 2GHPA 4FF4A 3G8QA 1H7WA 3GG0A 2OFGX 4YMEA 3DLGA 3THVA 1LWEB 2MY8A 4DG1B 1TAUA 4Q2LA 2B5JB 2BW2A 1RT4A 3VTIA 2W25A 4ZLPA 3T19A 3N6NA 4RNNA 1ZH5A 2F9DA 4X84A 1VQNS 2GQCA 3IWXA 1HW9A 4OJ1A 4AQYF 1FRMA 1UA0A 3EX7B 3KLIB 4YOEA 1LOUA 1RT6B 4J37A 4MFBB 3DLKA 1OIAA 4MKAA 2ZC3A 4K4WA 2L9DA 2ZH2A 4DV5F 1CVJA 4NLYA 1FCAA 1MROB 1YQHA 1TKZA 3LH2S 2OPRA 3ZZPA 3OL7A 5MLCV 1QLNA 3OSPA 1L5UA 3BF4A 3I56S 4DFMA 3P6YC 2CFXA 2RRBA 1URRA 2YWFA 3W2VA 3TI0A 3M2RB 4IG3B 2XULA 5HI7A 2CQ0A 1B7FA 3FSXA 1Z2LA 1Z1ZA 4CT9A 2MSTA 4DV2F 2QMXA 4X66F 2V9KA 3MM9A 3KMQA 4DR4F 1HD0A 3SFGA 3MI7X 3S01A 4ETXA 4Z2XA 2W9CB 3G9CA 3NMAA 4QIGA 3LAKA 5KT4A 3U1LA 4X4QA 3FQLA 3M32B 2M8HA 2B9XA 1N5SA 4R0EA 2RU3A 3FJ2A 4J9KA 4B3TF 4ZS6A 4DR3F 4CNYA 2A10A 3VALA 3JAMY 2W9BA 4IO9Q 4F4KA 4DJBA 2R2UA 4JI1F 3UD3P 1L3VA 2EK1A 4NWBA 5DG7A 1IQTA 2BQUA 2XMJA 5DM7Q 1CPZA 1CG2A 3EPIA 1HNWF 4YEAA 5E5NA 4Q45A 5E3AA 4FZVA 4X62F 1UVMA 1JLEA 1P1LA 2XMMA 5I42A 1SBRA 2MJNA 1N32F 2QA2A 4XK8C 2IC3A 2RMLA 2MQOA 3CPWR 3DRSB 3Q23A 3LW5C 4QIVA 2FJXA 5DLFA 1CQNA 3E01A 2IRUA 4CH7A 4K4SA 4CIOA 3E8OA 4NZ0A 2JOQA 2M5YA 1WACA 2MKIA 5EX3A 2J76E 3HLUA 5KT7A 4F2RA 1WNEA 1C1CB 4C8YA 5KFNA 2AYGA 2UUCF 4RW8B 2YKPA 5GMKa 2E44A 2OPRB 4N8NA 1UEUA 4K4TA 2AJ0A 1JXLA 2R7OA 5KFUA 2UVRA 4EFAC 3TAMA 1K73T 4C0HA 4ECRA 2YH0A 4JI2F 4HT7A 2FTRA 4KHPF 4F02A 3CC4S 3KJVB 3I5BA 2GMHA 2VG7B 2D3OR 1FEHA 3RTVA 4MYUA 1UFWA 2FJAB 4LIWA 4A8MP 2K7JA 5E33A 1KLMB 3KFWX 2J6SA 5CYQA 2J9CA 4G6VB 4DSKA 3UI3A 1PGZA 4YB1P 1N36F 4XDDA 3CD7A 4YR0A 4LVOP 4NLTA 2R7VA 1Q81T 2NUHA 2BANB 5KFPA 1KNZA 3V6DB 1DLOB 4NRTA 1Y00A 2IMWP 1BLUA 1ZOTA 2XSFA 2R7TA 5KFMA 2I8EA 3TRGA 4C8ZA 4PXCA 2FC8A 2AGPA 3L7PA 3TA1A 1JLEB 1R6YA 2B56A 2DNKA 1S0OA 2KU7A 1VQYA 3HHDA 5C42A 2D41A 1FE4A 3DYAA 3FCHA 3TNVA 3C2PA 4W92B 4L6V3 3OVSA 3KLGA 4ED0A 4B3OB 1JK9B 1M5SA 2FGOA 1FTCA 2KB2A 2VG5B 5GVQA 1VC6A 4N77A 1VQKS 5E41A 3QJPA 3FQKA 2ZVSA 1JLAA 5KG7A 2RKIA 3DLHA 1RTHA 3LP1B 3T5KA 1UVJA 1ZM3A 4H4MB 2XHWA 3N4WA 4MMOA 1C0UA 4DOZA 1DQ8A 1DURA 1FESA 1H3DA 1OSDA 3DYAB 5CCLA 3BB5A 3MR6A 1SIZA 4KO0B 3EPGA 4LF5F 5F9LA 1FNOA 5EN1A 3DNCA 2GHVC 1RDRA 2F3JA 5AXKA 3OV7A 1D9AA 2P9CA 3C8YA 1KN6A 2DO0A 2GGPB 5F8HA 1N5YA 4GMKA 4C8LA 2M3DA 1M0SA 3K5PA 2GNKA 4QPTA 1U6FA 1NK6A 4EU0A 1J5OA 1FXLA 3RB0A 3MM8B 3T9ZA 3C3LA 1X4CA 3CCZA 3PZPA 2FVQA 1VOMA 4M5DB 1S79A 3I9V9 4WYWA 4O3NA 3KK3B 2W4PA 2DGSA 1LK5A 4O3QA 2AGOA 2VQEF 1JLFA 4OHWA 4WXOA 4OHZA 3HP6A 1YJRA 2IAJB 4FNHA 3NRBA 3G71S 4DMZA 5G0RB 2AYMA 2RQKA 1YITS 4WZQA 2ATLA 1LWFA 4LF6F 2I38A 3K2YA 4ZHRB 4ECUA 2D9PA 2E1MC 5AXNA 3I82A 1TR0A 4I7FA 5JUMA 5KG0A 1U8SA 2ZFHA 2D3UA 3CCMS 2IYGA 3WBZA 1P9QC 3QYYA 4CI0B 2DGWA 4URSA 3OVAA 3BS9A 2P6SA 1IN0A 3FRZA 3W2WB 5T7LA 2FVSA 1MNEA 4OX8A 2IBOA 4MIBA 1S9FA 2BYCA 3QGPA 1K8AT 1D1UA 2YNIA 2MZ1A 1ZTTA 1U1QA 2DVIA 3CDUA 2KM8B 2MHNA 3T6BA 5E3QA 4Q0BA 3BSNA 3B4MA 1U45A 2CJ9A 3GR0A 2E5GA 3T5HA 2V4RA 1Y0HA 4YQWA 1UVIA 5I3UB 4N5SA 2UZAA 3M2RA 4IG3A 2YNFA 1RTJB 3KLFA 2GA7A 3K8VA 5KT6A 2AWZA 1HYSA 4DV6F 4OHXA 1TL1B 3HFKA 4A8OA 3IG1B 2AQ4A 2Q43A 5B0CA 4U67Q 2HS0A 3CIMA 2N7YA 2ZH7A 1D8ZA 1LW2B 2D74B 2UUTA 3H20A 1HWIA 4NA1A 3M8QA 4C0OC 1NJZA 1RT3A 1YI2S 3G86A 3FFIB 3KLIA 3FZBA 3HHLC 1UJ4A 3TUJC 1VQ7S 1YWXA 3FVYA 5HBMA 1XEZA 4TU9A 2HHUA 2EFVA 4I69A 3SQGA 2H9ZA 3MF5A 4YDDB 4OX7A 2LEAA 4ZPWR 3Q22A 1Q78A 1SV5A 1HI0P 2FIUA 5MAOA 3AA9A 3DRPB 4I2PA 1VS3A 5F0UA 3HDSA 1KQKA 3KK2A 4LF7F 1S10A 3DOLB 1VIOA 3TYTA 1FT8A 4D3GA 3Q8RB 2EG1A 2MQLA 3MM6B 3H4BA 3NAIA 3CD0A 4DHVA 2ADCA 5BR8F 2VC0A 1X4DA 2BV3A 2ZH4A 2LEBA 2ROGA 3DM2A 3I0RA 2LVWA 2C3OA 3X3UA 4CT8A 1XNRF 2YQ3A 2LA4A 3SYZA 5KFRA 5FIIA 4CH1A 2KG1A 1RA6A 4QR2A 2B43A 4EUVA 4LSLB 2EC0A 3MAHA 1QAYA 2CPXA 2R2RA 5KOXA 2NXUA 4DBQA 1J2VA 5K9FA 2CQIA 2KYZA 1XBWA 3GFHA 2AW0A 5EUHA 3POTB 2YH1A 1H0HB 4CO1A 3CTRA 1YSJA 3E3XA 4O4GB 3M2UB 2F40A 3MOJB 4ECQA 1AW0A 3KK1A 2JLGA 1VQSA 2E5LF 2DTJA 1HNVA 2YX7A 3CJ2A 4B9NA 2AP6A 2LQJA 3OHBA 1CEZA 1HL6A 3H40A 2XWXA 4IOBA 4R5PA 3M1VB 4QWCA 1B0PA 3P96A 3SQGB 2ZJRQ 3PDNA 2ALZA 4PQAA 2CJKA 4LSNB 4FPRA 5D8HB 2M8DB 2QSFA 2M0GB 2B0GA 3PW7A 2E7WA 1R8CA 1RT3B 3ITHB 4I2PB 2IMOA 3GV8B 1D8YA 3VF0B 4OX6A 3OFHA 3RU0A 1KQGB 4EYIB 5HBMB 1RJJA 1HQUB 1V3SA 4ED1A 1E6VA 1FE0A 1Q4RA 5C24A 2KT2A 3CJKB 2QIFA 2YWGA 4UQTA 2GIQA 3Q24A 3QIPB 4C9DA 4FVCA 4K5SA 3K5OA 3ENVA 3M1VA 5FDLA 1VQ5S 1NRKA 4RW7B 3OPKA 4QR1A 1X4EA 1S1VB 3KHRA 1HWJA 4WE1A 3LWMA 1SL1A 4CNZA 1XMOF 1DARA 5D4PA 4F25A 4DX8H 3NNCA 2JHEA 5LSRA 2G13A 1N5VA 4IG0B 4IFVB 2BOPA 3RRGA 3OUYA 3RBDA 3VAFA 4QBUA 5D78A 3FNNA 3HHLD 2N7CA 3C66A 2DD8S 4H4OB 1NJXA 1S77D 2BBEA 2PGCA 3I32A 5CXTA 4C3LA 2M70A 2FD2A 3IRXA 3KG0A 4PWUA 3PW5A 3A1YG 3CCWA 4IFVA 2YWKA 4OZLA 4FNIA 2XI3A 2ZH8A 3CCVS 3HVTB 3ISNC 2FLOA 3CB4A 4ZPVR 3S1TA 3WDOA 5B0DA 4M1KA 3IO1A 2NSBA 3D1QA 2D3ZA 2W24A 3I5CA 4NXMF 3NNAA 3N0VA 1S6UA 3K7RA 4RWXA 5U47A 3BO3A 4A4JA 1FD8A 3QWPA 2AJ1A 2V0NA 4DR6F 1JB0C 2CPYA 3CO9A 3I5AA 1LK7A 4LT6A 3CWJA 3GIKA 2R2SA 1BQMA 2F8EX 3I55S 3N28A 4MYTA 4ZPAA 1QSLA 2J0SD 2YKMB 1QE1B 2HHTA 1UWBB 4DL7A 2WOMB 1NK9A 4UY85 3AJ1A 2ASLA 1MSWD 2KRBA 1LW2A 3JSBA 4C8OA 1Q8LA 1TVRB 2CZ4A 2PMHA 2WW8A 4ALZA 1U6ZA 2R7XA 4A8XA 4DFKA 1TP7A 2XLIA 1QTMA 1JLBA 3CC7S 3TOQA 3FGVA 5J2NA 3BN4A 5T14A 1UETA 1IJFB 3HI9A 4ZP8A 2ACYA 3QGIA 4TY8A 2B6AA 1S49A 2HG4A 1LQ9A 4OQJA 5SZTA 2DNLA 3LANA 3TAPA 2ZUGA 4PWDB 3OVBA 1FK9A 5L1IA 3T6JA 4CO3A 1R0AA 1U1MA 2X1AA 2XLJA 2GV1A 2GC8A 3US5A 1T3NA 4N56A 4R25A 1X7VA 1URNA 4IRKA 2EFPA 3KG1A 4C7QA 4ICLB 4KT0C 4ES1A 1JLBB 1TFYA 1QAXA 2LA6A 3S8SA 1O5JA 3PM9A 2JVRA 4H4KA 2DNQA 1R89A 2GIRA 2HWIA 3M32A 2LYVA 3KLHA 3CCUS 4Y2CA 2Q66A 1BQXA 3PACA 1L3SA 1IUJA 3P3DA 3K57A 1OQ3A 5LXRA 3MEDB 3ZZTA 4DF4A 5CQGA 4DSJA 6FDRA 3DC2A 2QEXS 2BR0A 4JI8F 3WZ0A 3IAS9 3E2EA 2J9DA 2J0WA 2FLNA 1HQEA 3AQOA