2GQCA

Solution structure of the n-terminal domain of rhomboid intramembrane protease from p. aeruginosa
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
b'MSAVQVLKFPLSVDLAGFVGLLRRLNVPHRVSEESGQQVLWVPDERLAEQVRELYRRYPEGDPQATLEAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rhomboid Intramembrane Protease
publication title Solution structure and dynamics of the N-terminal cytosolic domain of rhomboid intramembrane protease from Pseudomonas aeruginosa: insights into a functional role in intramembrane proteolysis.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 10
structure length 70
sequence length 70
ec nomenclature ec 3.4.21.105: Rhomboid protease.
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16733 NRho Rhomboid N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2080 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gqcA01
2GQCA
chains in the Genus database with same CATH superfamily
3PG9A 4J91A 2FYXA 1YJTA 4ZVRB 4LQ3A 1AT1B 3C16A 4E8UA 2WK4A 3RR8A 4PG5A 3CJ4A 3AJ1A 3R97A 2KM8C 4IOAQ 4O3OA 4YN3B 3PDNA 1G4CA 5ETOA 2BQRA 4RO0A 3LANA 2JEJA 3V4MA 4PXBA 2IBOA 2RUSA 4UZBA 5DZ7A 2N82B 2DD8S 2HEKA 3FCHA 3CF5Q 1T94A 3EGVA 2ABYA 3UN5A 1VBKA 3VVUA 4F3MA 2CZ9A 4ELTA 4URSA 2DH8A 2E66A 4PAAA 3BF4A 3G71S 2D41A 4AUKA 3ZZRA 1U6FA 2MZTA 5EDWA 3D4JA 1HNZF 4AFFA 2XCPA 4NA3A 3EVMA 2H65B 2P5VA 2RIJA 3IS9B 3W3SA 3K5LA 1NO8A 1J5EF 4UY8T 2V9KA 1BE4A 1LNQA 3FRZA 2OPRA 5HQLA 5KG2A 3TUIC 1FD8A 2VHGA 4J9OA 2RS8A 1S9EA 2YXLA 5KFYA 4RPFA 3C15A 2FZCB 2ZBCA 1VYAA 1WF0A 3ISND 1U49A 1LXJA 2C3MA 3U1NA 2DTJA 3PW5A 1AFJA 4ZVGA 2DPJA 4DCJB 2ZH2A 2B6AA 3BO4A 2OSRA 4Z37A 2OD6A 3JSRA 1KLMA 2N4CA 4XO0A 2KKHA 3ZTPA 4CH7A 2HVIA 2MZQA 1UJ5A 1RT5A 3AQOA 2VQFF 1FVSA 2OEJA 1FVQA 2UUTA 3EXCX 1RHRB 5JUMA 1UFWA 4FP9A 3CMAS 3PYDA 3M6XA 3GCXP 3JTPA 2B0GA 1DTQB 2YKAA 3QPIA 3IFEA 3JQMA 4RBTA 3IMQJ 4JI0J 4DX5A 1NJZA 4KRWA 2B5JB 3FCVA 2JH3A 3NS6A 2CDRB 2Y1JA 4ECQA 4X64J 3BB5A 2BUNA 2W2QP 1NZ8A 2OJ3A 2HNDA 4U8VA 2FY1A 4KPYA 3PFEA 4ZPAA 1RT6A 3GIJA 1HBMA 2V2ZA 5HJYA 2E1MC 3P6YC 2VPXB 4RU2A 3DFEA 4UUXA 2KFZA 1WHYA 2GVDA 4O23A 4ELUA 3ONQA 4K4SA 4C48A 5L1KA 1BQMA 2W9CB 1Q8BA 4NXNJ 2BABA 1RBAA 3C3LA 4WK3A 4TQRA 3W7BA 1IQTA 5H9EJ 3I9ZA 2YKMB 1PJ5A 1RYRA 4I1TA 3K5NA 1OY6A 4ZVFA 3OD2A 5B09A 1UFLA 2RQKA 3PJWA 3LWMA 3VVTA 3BEGB 3RR7A 1SJRA 3ENWA 1U1PA 3DLGB 1LFWA 2YNGA 1U4BA 3GIIA 1N5SA 4E98A 1KKHA 2ZWPA 3HF5A 1MW7A 2GQQA 2RF2B 1NKBA 2HPUA 4FDFA 4K4YA 5HP1B 3HSJA 3BN4A 3UCZP 2FVRA 3GG0A 3WDOA 1U48A 3KK3A 1WTBA 4X4VA 3NG8A 1SUQB 1RHJB 4DG1B 2YH0A 1S5ZA 4ECTA 1QAIA 4U6PA 4C97A 3QO9B 1K47A 2HHHJ 5BYSA 3H2VE 3T1YJ 2BACA 4DR5F 3OLAA 1NPRA 1NJWA 3KWMA 4ES3A 4B02A 3H4BA 5BR8F 4USVA 4H4MB 2Z57B 1UL3A 2WBMA 4C8ZA 2YY3A 1JX4A 5CYJA 1S1WA 1U1LA 2AJ4A 2OMLA 2ADCA 2Z2ZA 1N5QA 4KY3A 5KG0A 3DRRA 1EARA 1JLEA 3UQSA 1YZ7A 2AEMA 3VZIA 2LECA 1UVJA 2CQBA 4A46A 4L76A 5C25A 1WKLA 3IG1B 2KT2A 2ZKTA 4L3KA 4JV0A 1VRQC 2VODA 2YKQA 4CO4A 3KLFA 1SBRA 2K06A 5DRKA 3J7Z5 3NMAA 1VIOA 3H5YA 3LA0A 2ZHOA 2OUGA 5F3ZA 1F5AA 1IKWA 2GHWA 1X31C 1HWKA 4DDFA 2HBRB 1FDAA 3IA0A 4OV6A 3TP2A 4ZJOA 2GMJA 2L3MA 4ZJQA 3EVOA 4MAKA 2KTQA 1T9VA 4K0KJ 2RVJA 2VG7B 3BN7A 2EC2A 2V9WA 1SV5A 3AXKA 4RW9B 1WC0A 2W9BB 1VQ8S 3OUYB 1WNEA 4DCOB 4ZCLA 5SZTA 1WSVA 2CNNB 5A8WB 2X3DA 2L41A 5C24B 3BQ2A 3OTDA 2YH1A 3HHEA 3W61A 1EB0A 1RYSA 2ADBA 2UVVA 2LXFA 1RWUA 2UP1A 4R5PA 2MQQA 5IM0A 2G2OA 2NZ4A 3B8HA 2FY8A 4OI4A 2MKYA 5LSRA 4GKJJ 1P27B 1FJEB 4OYPA 4Q43A 2VASA 4FZVA 2W2PP 2JC0A 2FHOB 4U8YA 4HLBA 4A8FA 4K5RA 2EKYA 1S49A 3W62A 1D8YA 4JBCA 5E3RA 2EG2A 4N5SA 4LT6A 3M7VA 2CADA 1S6QB 3FNNA 2W7AA 1FRLA 3AXMA 5J1EA 1UW9A 3NNAA 2QSFA 2P8IA 4B9TA 4KFBA 1PJ7A 2R8IA 2NXJA 5CXTA 3EE3A 3MMAA 3QJJA 5AXMA 3CULA 2J76E 4O3QA 2QZ8A 2E7VA 1Q79A 1BXNA 1KD1T 2AZ1A 3L3CA 2B3TB 1S97A 1S1XA 2BRKA 4DV1J 3MM5A 1Z1ZA 2GX8A 4WFBQ 3KHGA 5EX3A 4H4OB 4F0MA 1FXLA 4DQIA 4JI0F 4WTYA 5C2CA 1VBZA 1TKXB 3KLHB 1I51B 4X64F 5ITHA 4M5NA 1X4GA 4OI6A 3W2WB 4FF2A 3KG4A 4N8NA 1T03A 3OVBA 1SL1A 2CJBA 2UXBJ 4KPCA 4ZIVA 3CNQP 2D69A 1NJIT 1AA1B 5E41A 2PD1A 3QGGA 5HROB 3EICA 5GAEU 3DC2A 5LSLA 1H3DA 4GVBB 5KTQA 2CA9A 5KG5A 3RJMB 4WKRA 1V9OA 2E7XA 2CJKA 3C66A 1GXUA 3MMCB 3ZZ0A 3HMJG 2MQPA 4NLQA 2FJEB 1PYOB 3NY0A 1TL1A 3RUBL 2I5JA 4NXNF 4D3HA 1X5OA 3FGVA 1RHMB 3KLIA 1HHQA 3C14A 4Q2MA 3KK2B 2JEIA 2BVZA 2CQCA 2ATLA 3A8KA 1M1HA 3JTOA 4ED2A 1NDKA 2BOAA 5KFVA 3AB2B 2A2CA 2GGPA 1RTIA 3MOZA 3O6QA 2BKOA 3M6VA 1FRJA 3T1AA 2CG4A 2EG1A 1VQ7S 2XI3A 4FBUA 3KG0A 4X4PA 1LQ9A 3H5XA 4WZQA 1R43A 2X7IA 3P45B 3GPAA 3T19A 4F67A 3CCZA 2NYIA 3M9OB 3ITHB 3BH6B 1VQNS 2OFHX 2RS2A 1S6UA 2BXJA 2OPSB 3D3CJ 4MK7A 1NHKL 3VV2B 3M30B 4DL7A 3HHLC 2M8DB 2HHHF 3T1YF 5DQIA 1N6QB 4EBDA 1OYEA 4PG6A 2F8HA 4F2SA 2LDIA 1L3TA 1FFWB 2JLEA 2DH7A 2D3UA 1HWJA 4IRCA 4CTAA 5J2MA 3TJ9A 5A0YA 4OIXA 1QE1A 4X66J 3QJLA 3WZ0A 2XO7A 4ZLLA 4L74A 4PYAA 3LAKA 4ZHRB 3PXGa 1ZM9A 4WYWA 1OO0B 2AGPA 2D9OA 2QJ3A 1CEZA 2GVZA 1T8EA 1DLOA 2J8AA 3LW5C 1HNVB 2R8HA 2MY7A 1RGVA 3CCUS 2NSCA 2VG5B 4HHJA 4LR7A 3ZXWA 2WVEA 4USJC 2EFGA 4LSLB 3PNIA 2HRUA 2GIFA 1D9AA 4X4UA 5MAOA 3TZXA 5HMZA 3PIPQ 2BJEA 3IBWA 1YDLA 2G4BA 1HI1A 1WG1A 4I6YA 3E51A 3IO1A 3DKDA 1S1VB 2E5JA 2MHNA 5ADZA 2FUG9 4DR7J 4GC6A 2D74B 1T05A 3I4HX 1I1GA 2AKWB 5T7LA 2R2SA 1RWVB 3FFIA 1N56A 4K0KF 1H2UX 3HO1A 4RKUC 1CULA 4EFAC 1H0HB 1ZAXA 1CQNA 1FKOA 1D09B 2LA4A 1SC4B 3UD3P 2RB7A 4QYZJ 1S6PA 2DNQA 3X3UA 1MSWD 1S4EA 2J9DA 4F04B 2XEXA 2QL7B 4MK9A 4CLTA 1Q16B 4KO0A 5CHCB 4F25A 1XERA 2YNIA 3RYLA 2CPJA 1VRUA 1RCOB 4C9DA 2CWKA 2KRBA 4TLRA 3IXQA 3OR2B 4MIAA 3AQPA 3BJYA 4JOUA 2HGMA 1S4FA 3RTVA 4GKJF 2DR6A 1BGXT 1WG5A 2EFOA 3O8WA 2M4MA 1NSQA 3M8QA 4MTPA 3W1YC 4EO8A 1IBMJ 1NJXA 4HACA 1AZSB 4MIBA 1C0UB 3J7AN 4A8QA 2RRAA 1N32J 4A8XA 2HHTA 1KQGB 3RRKA 3SSQA 1DARA 2F9DA 4CT9A 2K3KA 4LSZB 3DYAA 5E5NA 3D66A 1QVGR 3WIVA 4AL7A 2OPPB 5CD4A 3GIKA 3MM6A 1RAOA 3UNGC 2MTLA 4DV2J 1TMJA 5IS2A 5EUHA 2H48B 3SQGA 2ZC3A 2AJQA 1TL3A 4WJBA 3HDSA 1OS5A 4NYZA 2MSSA 4DV1F 4MKYA 4Z2XA 1H6KX 1XIQA 4RW6A 2QO3A 4O44A 5FD1A 4FXDA 5ETQA 5IFMA 1K0VA 1YJNS 2OEMA 2FGOA 2H3EB 2VH7A 2B43A 2JL9A 4QIGA 1RWKB 2CRLA 4IH7A 3LOUA 1MWYA 1XR5A 1JMTA 1OY9A 2MHEA 1C0TB 2XY5A 4J5OA 2KXNB 1C1BA 4OYMA 4DV6J 1HL6A 2XSJB 2VOOA 2LP4A 1MROB 2UZAA 2BEFA 2UXBF 3MR2A 4WKYA 1SXLA 2IDLA 2QX0A 2BJ3A 2RNEA 3EGWB 4CLZA 5DDPC 1NK7A 4KAIA 1NNDA 2GW8A 2CQPA 3PJXA 2DHSA 3H2LA 3WC0A 1VJWA 2C3YA 5CYQA 1HYSA 2DGOA 2VG6B 4X4TA 2XZTB 1GMWD 4ZPVR 3CT9A 1Y11A 3DOLB 3E3XA 3SBMA 1TK5A 3F0NA 5F8HA 1W25A 3UR0A 1UCNA 2EFPA 1E6YB 2B8PA 4DSIA 4DL2A 4OZLA 3LP1B 1S0OA 1U0HA 5D4LA 5D0RA 2HG4A 5DLFA 2IPOB 1WORA 4JP8A 3I82A 5I42A 5KT5A 4LRAA 2IBKA 5E0OA 1X4BA 5KFDA 1QVFR 2NS1B 2JHEA 2PMHA 3GCWP 4O0IA 3AD7C 3K59A 3QRPA 1GX5A 1MMLA 2DHAA 3TZWA 3TVYA 4B3RJ 2U1AA 3R27A 3MCNA 4FKXA 3ZZZA 2F4VJ 2AJFE 3HM9A 1X4DA 1Y5IB 2AJ2A 4R8UB 4JI5J 4JI6J 1P9YA 2BW2A 4C11A 4HR2A 2E44A 4DHVA 4OZ2A 1GAOA 4ED5A 1FESA 3CJ3A 1T95A 2W2OP 3A8IA 3KNAA 2Z2MA 5BYQA 3JSMB 4X66F 1ICEB 4QZVB 2KJVA 1WTFA 4FXVA 2FLNA 3OFFA 3N6LA 4KHMA 2W4CA 1A7GE 3V81A 2X1GA 1RE1B 2DNYA 3TA2A 5J2NB 2HLTA 1JQGA 1B0PA 2DEJA 4KR0B 3DDIA 1TV6A 3JB9k 3QSIA 1EKRA 3VAIA 1TKDA 1IVZA 1KONA 1U26A 4PPZA 4D3GA 4RU9A 3DGPA 5F8MA 2FZGB 1BY9A 2FHKA 3G96A 3G82B 1T9XA 4AL6A 5HBMA 1YBAA 5LJ3Y 1RWWB 3GIMA 4CLYA 5CYMB 2HS0A 4ZN1A 2F1FA 4F8RA 3FUYA 3NRBA 4DMZA 3HHNB 3D0GE 3P5BP 2V6AA 4B3SJ 4QR2A 1HQUB 1SB6A 3ENVA 1UA0A 1IQZA 4DR7F 3EMTA 2ZDPA 1YIJS 2ZE2B 2RMLA 5D77A 3TJ8A 2W7PA 5B0BA 3NOCA 3PACA 4ZCKA 3I5BA 3RAMA 2KG1A 3EYZA 3O5TB 4PUOB 4I67A 5H9FJ 1EAYC 4Y2CA 3CIMA 4ENOA 3ET6B 3GZ7A 4QWBA 3BV8A 1DURA 1X7VA 1BHNA 2AJ1A 4TYAA 2KU7A 1RWOB 4G1IA 3W8GA 3W64A 1IBMF 3HLUA 2HHXA 1B7YB 2JX2A 4LF5J 4BLGA 2XYGB 1D1UA 1N32F 1HBUB 2NPIA 3TRGA 1H98A 4O3SA 3HSGA 3FEZA 4OJ3A 3MAQA 2ACMA 2YNHB 1Q8KA 1HBOA 1S10A 1RI7A 3SCIE 2AYMA 4O4GB 1RP5A 4QQBA 2MGZA 3K2YA 2JFKA 2VBWA 5J2PA 2ZD1A 3HCXA 4DV2F 3THVA 3CMQA 1QUVA 3M6WA 2AX0A 1CBKA 1KTVA 3TZYA 2LU2A 1MWQA 4L75A 2B4VA 2WB1D 3GR0A 1JWWA 1UEVA 2W1BA 2ZJRQ 5HLFB 3DNCA 3T1HJ 5ETPA 2UU9J 1GT8A 4Q44A 2QA2A 1QTMA 2BV3A 2FQQB 5HMXA 3LAMA 3HULA 2VBXA 2Z56B 3DOKB 1OMSA 2PDAA 4NWBA 2B7CB 4HTJA 4FYYB 4DV6F 1X9SA 3M05A 1VLYA 4NCGA 3ILIA 1NK8A 4U7UK 1MU2A 1YRTA 1XBWA 2HQGA 1T3NA 2IA0A 2J6SA 1SC3B 2DR8A 1HHTP 3ELHA 1W2IA 3DRPA 2O66A 5HQMA 2VONA 1VR6A 4YR0A 1S79A 1SC1B 2HRYA 3T6BA 1VISA 3QAUA 1UVIA 3KHHA 2ACYA 3ENQA 1LW2B 4LF9J 3AA8A 1R3NA 3IM8A 3QAEA 3TAQA 4TKTA 3UWTA 4WIIA 1NSAA 4J9MA 1BQNA 3VR1A 4LFCJ 4DL5A 4ZMMA 3G4SS 4ZKAA 2GAGC 2DB1A 3V6KA 3Q8QB 1PSDA 5F8LA 2V94A 2HNZA 2CJXB 2DXDA 3KMSA 2E29A 4B3RF 3BO3A 3FBFA 3EWGA 2OPQA 2F4VF 1HNIB 4YB7A 3NCPA 3I96A 3BGRB 1RHQB 2R7UA 4JI5F 4LIWA 1WG4A 4JI6F 3MOJB 2NUHA 5KFSA 1IKVB 1PBUA 2PI5A 4NLWA 1YX2A 2A3JA 3HVTB 4ZS6A 2XMJA 4CO5A 3K57A 2K7JA 4R0EA 1DAXA 1KHWA 2XYHB 3TVKA 2DCUB 2YWFA 2QTWA 4UTGA 2DO4A 1OQ6A 4QCLA 3FMBA 1QUPA 3K17A 3RRGA 4N77A 2ILYA 3FRYA 4C7QA 1YQHA 1WC3A 5A6PA 4MT1A 2JLFA 1WC6A 3NGTA 2B7BB 2FJBB 3VAFA 1HQEB 3U1MA 5CCLA 3W60A 1N5VA 2R7XA 1O5JA 2OO4A 3OL9A 4MKVA 4B3TJ 2QFJA 3C6UA 1XWLA 1GK8A 3TO8A 3KK1A 2ZOFA 4B3SF 4Y34A 4IFYA 1UZDA 1DBDA 2GQCA 1UFKA 1K1QA 5ETLA 1WOOA 2K7KA 3QJPA 2HFZA 3MPVA 3LP2A 4JUZA 2P6SA 4LVNP 1U45A 1JLAA 3M8YA 3HVWA 2BMBA 2YWKA 2KG0A 3KFWX 2ZVIA 2V8GA 2ZEJA 3JYTA 2K2PA 4AXJA 1LOUA 2HHSA 4DCPB 1LWFA 4Q7AA 3DOMA 4IG3A 2IMWP 4DX7A 2VA3A 3CJKA 1BWEA 5KG7A 1R8HA 2N4DA 1H7WA 1K44A 4PWDA 2C28A 3AODA 4YQWA 2A2DA 2KO1A 3AH6A 1EHWA 1OSCA 3M32A 4H4KA 1ACMB 1HPZA 3A4TA 4LF5F 1VQKS 4P74A 2HNYA 3IRXA 1FKAF 1TL7A 1SJ1A 1JLFA 2J9CA 3N5BA 2XM3A 4DQQA 4IO1A 3BQ0A 2P6TA 3A3PB 3VZHA 4K4TA 1S76D 1CJVB 4A4JA 1UW4A 4DV4J 1VHIA 2JJ4D 4DF8A 3OFGA 1K1SA 5KFPA 3M9MB 2ALZA 3SMZA 2VF3A 4WTOB 1X4EA 4EYHB 3F41A 3NAHA 1JJ4A 4BCAA 1ZZFA 3KDOA 4NPOA 3ZO7A 5F8GA 3HZGA 2Q6BA 3AOCA 1RACB 3UNYA 1RADB 4B9VA 5KFMA 2H4WB 4M5LA 2BJ7A 3T1HF 2YNFB 2UU9F 5D0GA 2Y8WA 3J81Y 2HVDA 2DHHA 4OHZA 4DXLA 5DO2A 3ISNC 4Z7YA 2QSWA 1G2EA 4ZN3A 1FJGJ 5D4OA 1XTZA 1RDRA 3HD2A 1TU0B 2B4PA 2K3IA 4MIWA 4O4RA 3CDUA 4DU8A 1X5TA 4OJHA 4FF1A 2AT1B 4WU2A 2D9PA 1TVRB 5L39A 4OZJA 2F3JA 3MAAB 3UD5A 1NPKA 3MUVP 3IAS9 5JVGQ 2SXLA 4GVLA 3N0VA 5GAGI 2DGQA 1N52B 4C0OC 2XWYA 3DHXA 5HVFA 1R89A 3J81j 4C2MA 3E8OA 3BKTA 3AOBA 4BWJA 2H4YB 4RUHA 2LQ8A 5FJ4A 5K8OA 4ES2A 5AE1A 3TOQA 2NZCA 4LF9F 4CNYA 1F9FA 4Z7CA 3M2UA 4RUAA 3M2VB 2ZBPA 2HK3A 1SKRA 4ILMA 2FGCA 2IM2A 3MEEB 3UI3A 4LFCF 3VGTA 2MZRA 2O3DA 1JJHA 4HT7A 1DTTA 4QYRA 4TU7A 5KFIA 2G9OA 2JC1A 3GYXB 4ID8A 4UQTA 1OPZA 2CPXA 5F9NA 2R7QA 1R0BG 3N5FA 3SFGA 3QT5A 3I5AA 2ZH6A 3PW2A 2W7OA 2C2DA 3LALA 2PN6A 2XS5A 1BMQB 1FDNA 5DDQC 2Z30B 2C2RA 1FXDA 2DGUA 1B64A 4K59A 3WIUA 3KJVA 1JKHB 2NYHA 2R2RA 3GJTB 4DFPA 1TL4A 4UUWA 1YG0A 2VFUA 3SDEA 5T41A 2XMUA 1XR7A 4NLUA 4ECXA 4ZK7M 5F0WA 4EZ9A 2RUGA 1HLWA 1GMUA 2XHWA 4JI8J 1TR0A 3PX6A 3NAIA 1KTQA 4P6QA 2V4JA 3NCRA 3V6DB 4LFBJ 2BKNA 5D78A 4MFBB 4OZ3A 4NLGA 5LXYA 1F3FA 3CSKA 1TKZB 4FPIA 1PJ6A 1HKAA 1ZAVA 2DHXA 5DETA 4B3TF 3O44A 3KLGA 3PYGA 1KS2A 2A6MA 3DLBA 3QIDA 1S1UA 1RA7A 2E1RA 3CJ2A 1UJ6A 1PAEX 4NLSA 2B4UA 5CABA 1NH7A 4NLXA 4IDKB 3A1YG 4IKAA 1JXEA 3TQEA 4LF1A 3DLEA 2HURA 4NEYA 1P8GA 4USTA 4R25A 2AJ0A 4RNFA 2UVUA 3GJQB 5A8KB 2QG9B 4LF8J 1QD1A 4DSLA 4ZLNA 2LXUA 3K89A 3PM9A 4C3KA 2ZBIA 1VGYA 3I32A 3RBZA 2CNLB 3GJSB 2W24A 2DGWA 2ZUGA 3W65A 1S9GA 5DLGA 4QOTA 4ICLA 1FE0A 3Q2SC 4RBVA 2KT5A 2EXUA 3P3DA 1M5OC 4DR6J 4C6AA 1Q78A 2RD5C 3PHEA 3QSYB 1S57A 3HFZB 1FFSB 3RG6A 3BGOP 4XTTA 2CQ0A 1REVB 2HHPA 2BM0A 3NL0A 1RISA 2VU5A 4DV4F 3Q22A 4OQJA 4I7FB 1Y5NB 4C98A 4OZ5A 2YQ3A 2JVRA 3J7A1 3PRBA 3BZQA 1KFDA 1TAUA 2WZ1A 2V68A 2AYBA 1X4AA 3CCJS 3FQLA 2V2KA 3TWZA 1FE4A 4QIFA 2XULA 3CCWA 1HBNA 3NKYA 4QPXA 5KFQA 4KGVB 1YBUA 3MEGB 2ZH1A 1V3SA 3LGHA 1U2RA 1FJGF 1XMOJ 1G1XA 1H74A 3UVJB 2IC3B 4ID5B 2E5IA 2QLXA 4HI1A 3I56S 4V1Ak 3IC1A 5J1PA 4C8OA 5KFRA 1S72S 3L7OA 3I0SB 2CVEA 4RLEA 1HD0A 3LUYA 3Q2TC 2MKHA 3IAM9 1PKUA 3GYNA 4KKOB 1S0NA 3KHRA 3N28A 4KV8B 4RW4A 4BHQA 2R42A 3DCAA 3W2VB 3BSAA 1HARA 3HX9A 3ADAC 4ZVSB 2X1FA 5K14B 5C5JA 4KT0C 1UVMA 2QC3A 4P71A 4P10A 4CYUB 2BX6A 2XMTA 4ED4A 2R4FA 1YI2S 5F3TA 1FK9A 5H1SV 1UZHA 1E6VA 2PIIA 4I2QB 1VOMA 2HQ3A 3DRYA 3EDQB 3QLHB 3TEGA 1WEXA 3JS9A 4DQSA 1C1CB 2VJUA 1IJFB 1KRPA 2HHQA 5C42A 4HVZA 2HVHA 4C4WA 2F65A 2JSXA 5AT1B 3DU6A 3JXOA 2DR9A 1WUUA 1KP6A 1FKPA 1FTCA 3LH2S 4URQU 3AAWB 1TKTB 2NXEA 1X4FA 5KFLA 1JLGA 1G3OA 2CUYA 1CS4B 3NWGA 2XLJA 4B3MJ 4MYTA 3BREA 5GVQA 4IFVB 2I2YA 1ZETA 4JI8F 1N5YB 5DM6Q 3TAMA 4KE5A 3CJ0A 1YK9A 1JLQB 2OGUA 1T3OA 2H9ZA 3MPWA 4JB8B 4UZCA 3W5ZA 3J7YI 4TNOA 2R2UA 2AGQA 4EYIB 3QBCA 3PKMA 4LFBF 2LYVA 3O1LA 5G4DA 1WC5A 1IBLJ 4WIQA 3SXLA 4QR1A 2VUGA 3F44A 2QGFB 2POKA 4OX8A 4KC5A 1O8BA 3RU0A 1RAEB 3M8SA 5A8RA 6FDRA 1Q7LB 4RX6A 2LEPA 4YB6A 7AT1B 2KZZA 5L46A 5ETTA 5B0AA 2FJVA 3U02A 4DBQA 1HMVB 4ZVTB 3DRSB 3V2UC 4EO6A 4OHYA 1AXQA 1SL0A 3UE2A 1RT4B 5L8RC 2HBYB 4LUBA 3DMJA 6AT1B 2JEFA 4WK1A 1RTHB 2HWHA 1N0VC 4XPCA 1X5PA 5ETRA 4LBHA 2QLBB 2AYEA 1UEUA 2OD4A 3MEDA 3KLVA 2V8HA 4U7CA 1R0AA 3NP5A 4ED0A 2ASYA 4LF8F 3MM7A 2XLIA 3OR1A 1EQMA 1LWEB 2EVZA 2JLGA 1VIXA 2Q66A 2VPZB 1KVKA 2QL9B 3R5AA 1GNKA 1HI0P 2WONA 1ZTWA 1RT3B 4YR2A 4ECYA 3THPA 4QR0A 2CKWA 3HPOA 2HFVA 3I0RA 3MMBA 3TA0A 2GHVC 1QAYA 4C8YA 2HBZB 2QT7A 4DSFA 1ZM3A 4A47A 2MKSA 1SC6A 4UOFA 4Q45A 2MJUA 2HMIB 3OW2R 2MLXA 2O67A 3MXHP 3AHPA 4DR6F 1DFDA 3MCOA 1TUWA 1GFWB 3ILOA 1I94F 1S1TA 5GAGU 2UUCJ 2DRAA 3H42A 4RNOA 3FEYB 4DR4J 3Q8UA 1W2BR 2HS4A 4DX8H 3MECA 4UOCA 2DO0A 3MM8A 1U1QA 2IY5B 3M1VB 1LW0A 3BR8A 3C6TA 2FDNA 1F0XA 4I2PA 1RT2A 3HFVA 4H4KC 3KXDA 4TU8A 1RBOB 4WCEQ 5HANA 3IR7B 1Q7YT 1SCJB 3VGSA 4YUDA 2IJFA 2VJVA 3M2RA 5K5MA 2C2EA 2C2KB 3RB0A 2RT3A 4ITSA 1X4CA 1EETA 3DN9A 5I3UB 1RT7B 5HQ8A 4JI7J 2V2QA 4QWDA 4IOCQ 3E01A 1M0SA 3TX8A 3W5XA 4U7UD 3BDPA 1JLBB 2KYZA 1K9MT 2ILZA 2ZVSA 3R8YA 4ZPBA 2R3VA 4EUVA 2VFRA 3SQOP 1RB0A 5LOQA 1XMOF 1YZ6A 2P9CA 4AYBD 1EP4B 1UWAA 4U95A 2KFNA 3U27A 2VFSA 3BYRA 3R7BB 2VFVA 3NS5A 4ZLPA 4FYWB 4USKA 1YRUA 3OLBA 2XZWA 4DUYJ 2MKCA 2ZBRA 3QGPA 5DG9A 5B0EA 4A8YA 4L6V3 3NBPB 3IWLA 2HIQA 1VQLS 3MHYA 3SCJE 4TY8B 1MMDA 3M8PB 4ZA1A 1IWGA 1IKYB 2K1RB 4RW8A 1NSPA 3BGLA 3MM9B 1FF2A 4Y2AA 3V4IA 3UN3A 3R2DJ 2QE5A 2FVSA 4QIEA 2JDJA 2R7OA 4Y2KA 5IQ6A 2NLWA 1GXTA 3EZOA 2ZH9A 1F60B 2V2VA 2P2CB 2FLLA 2AIRB 3UD4P 2BE2A 3CJSA 1IKXA 3OV7A 3FSXA 3OHBA 5HO4A 4NCAA 2D3O1 4N41A 1FJCA 1UA1A 1J27A 4RL1A 2KJWA 2HAFA 3AY0A 1HQ2A 3MPDA 1FNXH 5KG3A 2RILA 3Q8SB 5KFFA 2DT9A 3BS9A 2XLKA 5HMWA 3CCLS 1KVIA 1CJTB 5F8NA 1Q4RA 1G7CB 5CA5A 1IR0A 3M8ZA 3OXLA 4RW7B 1FRXA 1S0MA 2FHJD 1KC8T 1VRTA 5AXKA 2FJAB 1VBXA 1IN0A 3PR4A 3D5MA 3W5YA 1WF2A 5HVGA 2N3OA 2VQEJ 2IMOA 4U67Q 4DN0A 2IHR1 1CJKA 4B3MF 3VGVA 1NRKA 4G1QB 2J7UA 2I0XA 1YJUA 3ICLA 5FDLB 1HIYA 4MMOA 2E5LJ 2B8QA 1VQMS 1F9HA 2BKPA 3RAQA 4QW9A 1XC9A 2BM1A 3NOGA 2ZFHA 3PTWA 1RT1B 4EZ6A 4ZCMA 3HKZD 1IBLF 2WHOA 2BZ2A 5ETNA 2VPWB 4WP8A 3DM2A 4JI2J 2OTLS 3GE9A 3T41A 2Z2LA 3CO0P 1F2GA 4ZPWR 1KDNA 2PE8A 3J80U 1J5OB 1FCAA 5K9FA 3MR5A 4F3OA 2IAJB 2IVMA 1U7LA 2AV5A 2OSQA 1AB8A 1MNEA 3FDSA 5I3PA 1BWVA 5F9LA 4I68A 3HHKA 2DNGA 2ZM6J 5DG8A 1PO6A 4DZ6A 2G1HA 4IG0B 4M5DA 3AB4B 4P7TA 3HZEA 1NK0A 2RKIB 5I4MA 4DS5A 1WEYA 4OI0A 3UR3C 2KH9A 2FVCA 3CGIA 3QIPB 4DUTA 2HLUA 1FX4A 1NB2A 1RTJA 3RRHA 2QYGA 4EI2A 2J6UA 5KT4A 2Y9HA 1TELA 5A2QU 5DQHA 4HL9A 1Q8IA 5M2RA 4USWA 3POTA 1KQFB 2VICA 2XMVA 1IM4A 3Q23A 4M63A 1SIZA 2DJWA 1YJ9S 5ETMA 1U6BA 2XS2A 4QJVA 3UDCA 4DOZA 5B0FA 4OHXA 4ZCIA 1RK8A 1AUSL 4FS1A 4GRSA 2H1YA 3OJSA 4ZVHA 3JAMU 2JRSA 2DXEA 3RW7A 4ANDA 3TQ1A 1KQKA 1CC8A 2QEXS 5J2QB 2Y1IA 2WRMA 5EWEA 4DR4F 4NLPA 4J9NA 4K4UA 4L72B 4AQYJ 1V6HA 4ZPCA 2IVFB 2KN4A 4OHWA 2V67A 2WSCC 4LF7J 2CVIA 1CJUA 4NCBA 3UDLA 3GU0A 1KHVA 2E1AA 2PEBA 2DCLA 1RTDA 4PQUB 1TQLA 4Q8FA 3DXSX 5E33A 5CAAA 4IRKA 3KHLA 1PIEA 3FSYA 3AD8C 3CCRS 2NREA 1VQ9S 1MWZA 4JI7F 4RNMA 5DG7A 1IR2A 3OPKA 4MH8A 2BYCA 3SCLE 4C8KA 1SI9A 1U24A 4I6WA 2DKOB 5D3GB 4B3OA 1HHSA 4Q0BA 1KR4A 4QBUA 3FCWA 2Y0BB 3C19A 3OBIA 1R31A 4LVOP 3LP0B 3MD3A 2ASDA 2YKNB 3DLKB 3KLEB 3CB4A 4DUYF 4UOGA 2WOMA 1JNRB 2XY6A 3BSOA 4DPTA 1RU1A 3WC2A 2OMOA 3AJDA 4FVCA 3R7SB 1KOOA 3MGJA 1YWXA 4K5SA 1RAHB 3VAJA 3DI6A 2VC1A 1Y9OA 2VFTA 4ZVEA 5G0RB 1WDDA 3J7YU 2EW9A 4OLOA 4CO2A 1LWCA 1X5SA 1U8WA 2HYIB 4PXDA 2A0FB 1OIAA 2B9XA 4KH0B 1UWBB 2Q3PA 2DNOA 4YB1P 2GNKA 5D0EA 3ZTSA 1KEKA 4DFJA 4BC9A 1OQ3A 2BW7A 5FLXU 2FVQA 4YP3A 1TFYA 2RH3A 1M5HA 2XB2D 4RZRA 3RB3A 1YJWS 2W01A 1KOHA 2J5AA 2CDQA 4OLPA 2RU9A 5KT7A 2VIHA 2J7KA 5IV4A 4ILRA 1GH8A 1R8PA 1OY8A 1N48A 4P7VA 1UPMB 3GWCA 1FT8A 4N47A 2D3ZA 2KI2A 2HQIA 4CLLA 3BKFA 3Q8PB 2BANB 4NLVA 4ILLA 1ELOA 1S9FA 4W98A 4NI2B 4YEAA 3TUZC 3L09A 1RWPB 1N33J 2CIMA 4YMEA 4IQMA 2W2NP 2LQBA 3KJQB 2ZJQQ 5IWAJ 2VQEF 3HSZA 4USIA 2CZVC 5EGYA 2FLPA 4ZITA 4LSNB 3A3OB 2GQ2A 2YBVA 5IT0A 3HHLB 4LF2A 2E5LF 1JJCB 1WJ9A 2A10A 2GZOA 2GAHC 3IS9A 2HW3A 2IDEA 3R2CJ 3CJ8A 4WZMA 2QLWA 1S7HA 4OX9J 4JI2F 2UVWA 2XSFA 4X4NA 4G6VB 5D6GA 3I87A 2WW4A 4P52A 4G65A 1YBTA 1ZPVA 2MB0B 1FWKA 4G1PA 1FWLA 2CJ9A 1BC6A 1T9UA 1JLCB 4WBFA 5F0UA 1IWAA 2ZM6F 3UCUP 3MTJA 3W63A 3B4MA 2CJQA 2DHGA 2HZVA 2HGNA 4WE1B 1Y5LB 2FZKB 3C16B 4PPDA 2LKZA 1NK6A 1MN7A 2ASJA 1WDTA 1DTQA 3ETMA 4P72A 2W8KA 3GYGA 4RWWA 2V8VA 4CLSA 1WWHA 2HAIA 1A9NB 4KB7A 4G3IA 3I55S 2B5JA 3L7UA 3G9CA 2J9EA 3PKYA 2AP6A 2PEHA 2NPFA 2D3OR 2V5HG 3THTA 3J7ZT 4DWIA 2DNMA 1X8DA 3T9NA 4JI3J 2VB6A 1Q86T 5L9NA 2FC9A 2Q1LA 1H73A 5RUBA 2E7WA 4NRTA 2ZH4A 4DUZJ 4LMZA 4FF3A 3QATA 4AQYF 1N8RT 3HSDA 2NSBA 4CZCA 1NHUA 4IOBA 3D1QA 4LF7F 2W9CA 2QV6A 2LCWA 3H8YA 3PEHA 5IZHA 2NCKL 3ENAA 5KFNA 4PZVA 4IH5A 1NU4A 3D3BJ 3K5PA 4N8OA 3VAHA 2OPRB 2YKMA 4O3NA 1S9EB 5CZXA 3C15B 5ETSA 4W90B 3HHDA 1NCLA 1SJ4P 1RAAB 4OYAA 2BQ3A 5MLCV 2RQMA 3WHIA 3DLGA 3FMWA 2B4OA 3GIRA 3GV5B 2RF2A 2BOPA 2B6AB 5HP1A 1TK8A 4FPRA 3CMES 1KLMB 2QYCA 4QIVA 4N56A 1SUQA 1RT5B 4DG1A 4BBYA 2GJ2A 4QU7A 3QO9A 4WFZA 2VDHA 3KOAA 4PQAA 1WF1A 2GS8A 3D1OA 4ZVQB 3ZTOA 4OI3A 4X4QA 2DNRA 4H4MA 5F41A 1NHVA 4Y28C 3BH7B 3SYZA 3J80Y 3NEKA 3CCMS 2BE7D 1EX8A 1SKUB 2DNZA 2M7SA 5EWFA 3QYYA 2XMWA 3NGKA 3QZ8A 2HVEA 2HNDB 1U1MA 2RRBA 3N6MA 2MQMA 2FVPA 2HZCA 2ROPA 4IH6A 2HHWA 1EQ0A 2GHPA 1VBYA 3IG1A 1RT6B 1HBMB 3A12A 4M95A 2GVDB 4OFZA 3ZZPA 4U96A 1R8BA 5A2QY 3BYPA 3GONA 4A48A 1BQMB 1TUGB 1UKUA 3BGUA 3NGUA 4F0HA 3EVWA 1PYTA 2OIHA 3OL7A 4OJGA 3H4DA 4OYXA 2XG8A 1N33F 1X60A 5IC4B 2VC0A 3VF0B 2VOPA 2BJ1A 2VG7A 4I4BA 4MYUA 5IWAF 3KJNB 5LMNJ 4GO5X 2W9AA 3N4WA 4RW9A 3PX0A 2W9BA 3OUYA 4UY85 4NRUA 3JAMY 4P73A 2YNGB 5A8WA 5M2UA 2DBBA 2LQJA 2VD3A 1RHUB 1F2HA 5C24A 5EN1A 4UOHA 4XAKA 1ZAWA 1VQ4S 2IJNA 4RR5A 1I5OB 1WI6A 1JIHA 2JFDA 3KK3B 5E3QA 4OX9F 4KGKA 2ROEA 2YQ1A 3FZBA 5KFWA 1HD1A 4PR6A 4QW8A 1WKJA 3D2WA 4M8LA 4CO3A 2DISA 4YOEA 3Q0AA 2XY7A 4NASA 3MPYA 5L1LA 4MKAA 4WXWA 8ATCB 4FYDA 1S1WB 1KBRA 3S01A 2IRUA 4J90A 2E9TA 1S6QA 5LMUJ 3DRRB 1PYSB 4FBTA 2DY1A 1JLEB 2A18A 3ILLA 2I1RA 3LGNA 2ZNYA 3R1HA 3UN2A 2H5JB 2ZBQA 5C25B 5GAEI 3T9ZA 2N3LA 3FBEA 3I31A 1EIYB 3OTEA 3UDEA 3CCQS 1R8CA 4I6AA 5DGBA 3KLFB 1GTEA 4X84A 3QFHA 4NOHA 4H4OA 4W4MA 2YX7A 1VDHA 1NBEB 1AUDA 4F26A 4RNNA 1TKXA 2MXYA 3KLHA 1WKKA 1LKZA 3T5KA 4J9KA 4DR3J 1IKWB 3CWJA 4XK8C 3W2WA 1QM9A 3MUMP 3GV8B 4W92B 4JI3F 3H2UB 3Q24A 3O3LA 1R0CB 1HFEL 3EJMA 4WP3A 3MR6A 4Y65A 4DUZF 1P1LA 1SV5B 5HROA 4ED7A 2CQ1A 3C46A 2R7TA 1VQOS 4GVBA 5E3CA 4LIRA 4LBPA 5FLXY 1FEEA 5HK4A 2VZ9A 2JEGA 3MMCA 2PI4A 3CJTA 4X4RA 1GXLA 3DLLQ 4DL0C 3GB0A 4R5PB 4IRDA 2FC8A 5IM0B 2EC0A 1VQPS 2XTJP 5BJRA 1JXLA 3KK2A 2E5GA 2IFXA 4NZ0A 4ZPTR 1N34J 3NWRA 2BRLA 2CFXA 5KFHA 2BA9A 4JV5J 3T5JA 1VQYA 3G6YA 2YTCA 2M5YA 3J81U 2ZH8A 3D6TB 1ZPWX 5KFJA 4DPOA 4HHHA 4S0MA 1NDLA 3D0HE 3CVKA 4J9VA 4FKYA 2KRRA 1T02A 1CSJA 3S6EA 4CWBA 4J9SA 4IO9Q 5J1EB 3ITHA 3R5CA 4X4OA 2KVIA 4CM2A 1VHFA 4F50A 2OPSA 2ZH7A 3PW0A 3NGDA 4KFBB 3M30A 5DJBA 4OYWA 2EI5A 1URNA 4MK8A 4J7CA 3MMAB 1N6QA 3AOAA 2KB2A 1S77D 1IM6A 4Y0FA 4TQSA 3UW1A 4LF4J 3L9ZA 1PGZA 4NL5A 1S1XB 3MM5B 4OYIA 3BBFA 4NLRA 2VL1A 1IBCB 4NLYA 1KFSA 1D0EA 1OWXA 4TY9A 2F5GA 3KJFB 2F63A 5HL7Q 3PO4A 4ZHRA 4DLGA 4OYOA 4DSEA 4CLFA 2R7RA 1HNVA 1NAQA 2WSFC 3KTQA 4BS2A 3GSIA 1T03B 2ZOMA 2VG5A 2G1DA 2WTFA 5A6WA 1VQ6S 1JXVA 4LSLA 4JV1A 3V6HA 3VAKA 4Q5VA 2XNQA 5B0CA 2PA3A 4LRCA 2QFIA 7FDRA 2KZMA 2W8LA 3HJFA 1T9YA 4FNHA 1Q95G 2DNHA 3ZC4A 2LQ5A 4Q8EA 1TL1B 1SQGA 2I5JB 3KKFA 1S1VA 3H0PA 3G6VA 2GIRA 1LV5A 3KLIB 5DZ6A 2CQHA 5KFZA 3RB6A 3C14B 5AJ3J 3D68A 3CE8A 4HI2A 3NMRA 3CIZA 2UV8A 3T3FA 4DPWA 3DU5A 5LMNF 4PCQA 3PYFA 5IC6B 1WI8A 2M2BA 2GGPB 1NEEA 1RTIB 1WOPA 4QU6A 2MDAA 5HMYA 1KVJA 2FJDB 2MYFA 1L3VA 5KFOA 4TXSA 1MLAA 2ZHAA 4FNIA 4WU3A 2RHQB 3CCES 1WOSA 2QA4G 2HQCA 4F4XA 1D9FA 3CCTA 3OTOJ 1LFPA 2X1AA 5E7OB 2XHCA 1VS3A 2DYAA 3OR2A 4Y3CA 2KL8A 2P9GA 4UT4A 2IYIA 3RGIA 3T6JA 5L9XA 3ULHA 4PKDB 4PWWA 4ETZA 1AZSA 2JWNA 4M5MA 4NYOA 1C0UA 2X1BA 5KOWA 2FLOA 4CTAB 5J2MB 2CJYB 2HKEA 5A0YB 3F56A 1QE1B 2VKRA 1B7FA 2Z4PA 3HJVA 2DGVA 3CO9A 3P5TL 2IRYA 2WVFA 5LMUF 2OPPA 2QL5B 4ER8A 2Q6CA 5B08A 2MLZA 2GVZB 1SH3A 1DLOB 4EU0A 2QRRA 5KFCA 3B78A 3RBEA 2AX1A 2DITA 4F0KA 1RLDA 1R27B 2C3PA 2G2YA 1U02A 4K8RA 3FBCA 4J37A 3OJUA 5DM7Q 1I6JA 3H25A 2HQFA 1V3RA 4NLTA 3KMQA 3PIOQ 1FWPA 4OYBA 5K8NA 1X0PA 1UTAA 1SL2A 2UUBJ 1YJRA 4DR3F 3R6GB 1C0TA 3P8BB 4I69A 2E9ZA 2X3GA 4EGLA 2DGXA 2XSJA 2J0XA 1MROA 3NCQA 1T05B 3EGNA 2FHMA 5T7LB 4CDIA 4C0BA 4OZNA 1X9MA 3FFIB 3CDWA 1CULB 3TVZA 2HGLA 3JTNA 1AROP 1FKOB 2I6WA 4K2XA 1Q8LA 2R9LA 3CDBA 3RBDA 1S6PB 2EK6A 1F9EB 3TW0A 2AEJA 4KGXB 2VG6A 3PHTA 1QAJA 2WVCA 2D1CA 2WAQD 4KO0B 4C8MA 2YNIB 1VRUB 4LF6J 3DOLA 5EWGA 4ED8A 2OFGX 5L38A 1RAJA 1W26A 2HSEB 3H90A 1E6YA 2HS3A 1HWLA 2CPEA 3LP1A 1YITS 2JVOA 1N34F 1FD2A 1N4LA 3M8QB 3RZAA 4JV5F 4NZ6A 4DFMA 3H20A 3QT8A 2H51B 4HACB 1HI8A 1BLUA 4RWXA 2G0IA 1SQFA 4NZ7A 5ETVA 1ZBTA 1TMMA 2IM3A 4DQRA 3DYAB 4ELVA 5THWA 3QZ7A 4LRFA 2MLYA 2BBEA 3WX8A 3MM6B 1UPPA 3I6PA 3MF5A 2G13A 2LEBA 2BDPA 4V19J 1FNMA 3R5GA 3SQGB 4R8UA 3B6BA 1TL3B 1TL5A 4LF4F 9RUBA 2G0CA 3CDAA 1ZM2A 4RW6B 4USHA 4O44B 4HYKA 3JSMA 1NK4A 3R6LB 2OAUA 4A8WA 1A6LA 1H2TZ 2Y1LB 3U7JA 5M2PA 5J2NA 1RKJA 1YJ7A 2I9SA 1HNWJ 2M9KA 2IIHA 3SEOA 2DR5A 4ZP7A 1C1BB 4NA1A 2KFYA 4OMFG 3VQSA 3Q86A 2M8HA 2MPUA 4F4AA 5D4NA 3IM9A 3ISZA 2J6TA 3KUHA 1QSSA 3G82A 2VBZA 1S12A 3V6JA 2DY9A 4B17A 1VQ5S 3B4DA 5CYQB 3DDNA 1CPZA 4AL5A 3LGMA 5CYMA 3EPGA 1HYSB 1P9QC 1NLKL 3SSSA 4O3PA 2J0QD 2LDYA 1HQUA 3M8WA 3G87A 5JVHQ 1M5VC 3MFIA 5AJ3F 4MKBA 1H38A 2ZE2A 1IUJA 4J9UE 2APOA 3VHQA 4ED3A 1U0HB 1FRIA 1U8SA 3Q8YA 5J1NA 3P4UB 3MDFA 4EWTA 1OJ4A 2HWTA 1XNRJ 5I42B 4PUOA 2H54B 3CJQA 1L3SA 3NGRA 4USUA 5LT5A 2LXIA 3QQCD 3G6XA 3ET6A 1Y10A 4C8NA 1U2CA 3OTOF 4YS2A 3IWXA 5KAKA 3H40A 4LRDA 2CQDA 4F4ZA 3D7SB 5CQGA 3MMJA 4C11B 2DIUA 4UQGA 4O0NA 2DVIA 2NQPA 1N36J 2UXDJ 1FO1A 3PVXA 1HBUA 3ETOA 1T9TA 2C1EB 3C2PA 5DS7A 1D9DA 2QMXA 3W9HA 2YNHA 3BPDA 1D3WA 1RWNB 2RRNA 2LFVA 3H5SA 1XMBA 3OQ2A 4ZVPB 3R5DA 1NPPA 2XO6A 4CI0B 3V81B 3I4PA 2JNJA 3CTRA 1URRA 3BBBA 3KUGA 4O4GA 4K4VA 4FVMA 2ZZNA 4CCHA 2OI2A 1TV6B 1RLCL 2RU3A 1SIWB 1W7WA 5KFTA 1REGX 4C3MA 2Z0GA 1KSPA 3DGPB 1RAIB 2DR7A 2L48A 4V19X 2XMAA 4ZP9A 2PO4A 1YKWA 5HBMB 5HLFA 3IWNC 2R8GA 3ZNUA 3W9JA 2UUBF 5ETKA 3K58A 2ZITA 2GMLA 3DOKA 2GJFA 1MMNA 5D0HA 4PYDA 2AD9A 1JB0C 4ZLJA 4K7QA 2HFSA 4PXCA 4AXIA 1JJ2R 3R5BA 4KHRA 2QIFA 3UO0A 3OHAA 2WW8A 3MCMA 3CJ5A 5HAOA 3I9V9 5B0DA 1SH2A 3FKBA 5HATA 5U47A 4PG7A 4DN9A 4NMXA 4HDHA 1HWIA 1Y7PA 1CLFA 4LF6F 1IBKJ 3D67A 1V5IB 1EJ7L 1GMWA 3K0JA 2HIYA 1ZTTA 3VALA 2CJAA 4P2FA 1UETA 3CPWR 5HN0A 1LW2A 4DL3A 1CG2A 3WX4A 3PW7A 1ZA2B 3CC2S 2EEYA 2DNNA 3FEXB 2XS7A 5LL6d 2RDIA 3R5JB 4FS2A 3G8QA 2ALYB 1HBOB 1U2FA 5AXLA 4J9QA 2EKNA 3OL8A 5EX0A 4Y6IA 2XGQA 1X4HA 2MGZB 1VCTA 1HNIA 5J2PB 2ZD1B 4NXMJ 3BGRA 2MZ1A 4M94A 1RQ0A 2PC6A 3D6HB 1RZMA 4CO0A 3AA9A 2E1CA 1CC7A 3SCKE 1B4SA 1KWMA 1DJ0A 1IKVA 1FXRA 1M1KT 4PWUA 2I38A 2E9RX 2DH9A 2V8DA 1WHWA 2XMMA 3HVTA 2OKQA 2HQDA 3B82A 3QT6A 4L3NA 5AXNA 4CP5A 4TYBA 3V5RA 2RQCA 2GCFA 3L4BC 4N7TA 1HNWF 2P9EA 4I64A 1NKCA 1K73T 1U09A 1VFJA 3MWBA 4FF4A 1Q1KA 4NCGB 1SJ3P 2UVRA 3TUJC 4JI4J 3OFHA 2PMZD 4A8SA 1HQEA 3NS7B 3BSNA 1MU2B 2M3DA 4DV5J 1SQEA 1QY7A 3UDVA 1UP1A 1Z2ZA 1SPBP 3TR5A 3DRPB 1B70B 3GTYX 1EZZB 1S48A 3QMQA 4M5IA 5LXRA 3HI9A 2XQCA 3PJ9A 3R9LA 4XPEA 1IJEB 4P9SA 5HSPA 2C3UA 4FYXB 3PRDA 1SKWA 2H5EA 2V0NA 1OPIA 1XNRF 2BJ8A 2CQ4A 4P2MA 1BQNB 1HA1A 5E2QA 3MCSA 2KYXA 2L9DA 2JOQA 2KHCA 4FXWA 3OTCA 1S99A 1KLNA 1XNQJ 2HNZB 2Y0SD 4DJBA 3JSYA 2DNPA 1F5BA 4LJMA 1AW0A 2D7SA 4PEOA 2OPQB 2HFUA 9ATCB 5K8MA 4DR1J 2XI2A 4ES1A 5KT2A 1NM2A 2YWHA 1I3OB 1ULRA 1WEZA 1Y4ZB 2DRBA 5EHHA 4CT8A 4P75A 2XC9A 2C2NA 4L73A 1N36F 1VK3A 2UXDF 3T5LA 2LEAA 5I3QA 1WC1A 1FNOA 5KG1A 4CLKA 4NYPA 4OHVA 2EBGA 1FDBA 3BO2A 1CJVA 3PRVA 4ZVOB 2R7WA 2Z2YB 2PA8D 4HH1A 4RJVA 3M4XA 2AHOB 2YKOA 4R0JA 5IT9U 2VV5A 4HHUA 2L9WA 3RW6A 2QN6B 2DRDA 5KT6A 4ZDNA 5DDOC 3OT9A 2NUUG 1DHMA 1VJQA 3TANA 3NXZA 8RUCA 2MQOA 2CXEA 2LVWA 3SIPB 2YNFA 2ZOGA 1RBLA 4DSKA 3TI0A 3GFXA 5D15A 1S0VA 4DV3J 1UVKA 2HBQB 4OL8A 3EGZA 3D9BA 2YKPA 2AWZA 3D28A 3C6UB 4F4WA 1WC4A 3KK1B 2Y3YA 4B9MA 3EZ5A 5C2GA 4IFYB 2GA7A 4CNZA 5B0GA 5K20B 3NNCA 1TVRA 1PC4A 4OX7A 4PG8A 5D4PA 1L3UA 3LP2B 3MAAA 1JLAB 4X62J 2MQLA 3PCOB 2ASLA 4K4XA 1RAGB 1ZOTA 1R6YA 3JYTB 1VI7A 1QJHA 3N6NA 5KFGA 4E2FB 1LWFB 2RJZA 3DOMB 4IG3B 3ZTQA 2HHVA 4AE5A 3RB4A 1IBKF 3CJKB 3H98A 4OZ0A 2YX4A 4DF4A 2OLWA 1J2VA 4PWDB 3LF0A 3MAHA 1R6VA 1RKIA 2YWGA 2J0SD 3IRWP 2U2FA 3TYTA 3TARA 3M32B 2R8KA 3M2VA 1HPZB 3BQ1A 1PC5A 1M1GA 4OV1A 2HNYB 1DQAA 3IRXB 3MEEA 1TL7B 4ANEA 1JLFB 2UUAJ 2B9EA 4IYQA 1SJFA 3CD5A 1B3TA 3A3NB 3UCGA 1O6XA 3R3TA 2V34A 3VAGA 3N79A 2KHDA 3UPFA 4LR9A 1H72C 2DGTA 2NXCA 4OI2A 2DIVA 1K8AT 3G8SA 2CPZA 3EXYA 4NXMF 2O1PA 2GJIA 5IOLA 3TX0A 3GR1A 2LA6A 2PSZA 4KSEB 3A8EA 1QLNA 3GP9A 5LSOA 4QPTA 4KGZB 4Q2LA 5KFAA 2XNRA 1JKHA 4KH1B 4XDDA 1RTZA 2CPHA 1RUSA 2C2OB 1R7IA 1RAFB 2NXUA 3GJRB 4URGA 3HFKA 1NMEB 4DLEA 3CC4S 3CCSS 4YHHJ 1G6BA 2VPYB 2XWXA 4E0DA 2BJ9A 4X65J 3AFGA 4CLUA 5E3PA 4H54A 3V6DA 4LFAJ 3H7HB 3CD7A 5DGAA 2XCAA 3TAPA 2MZSA 2OP5A 2K8GA 4MFBA 4DQPA 4K4ZA 4USMA 4JI4F 2BE9B 1TKZA 2KM8B 2F4FA 3UFCX 2ZZTA 3P96A 4YR3A 3MR7A 2UXCJ 4DV5F 4ETXA 2MJNA 2R2TA 1TK0A 1UAWA 1U6ZA 2Q43A 1WACA 3NLCA 4EBEA 2XZDB 4DPYA 4CH1A 2EK1A 2J7WA 4LQ9A 3HP6A 1TP7A 3DDKA 4CQ1A 2MZJA 4IDKA 3BPSP 2UV8G 4B9NA 5HJXA 3G86A 4KIAA 2RSQA 4Y2IA 4B9UA 1SKSA 4B9SA 5KG6A 3M2UB 2G2ZA 4LBIA 2R7SA 2ZDOA 5A8KA 4QWEA 2DPIA 2Z8QA 2WBRA 3BM7A 4CM0A 3OVAA 4C8LA 1D8ZA 1QSYA 2ZWOA 4J9LA 4GKKJ 4DV7J 1DTTB 1FRKA 1XNQF 1FRMA 1H2VZ 5GAHI 4F7VA 3B54A 3Q8VA 2C3OA 3Q83A 1NZAA 2CYYA 4DR1F 3DXBA 2JZ5A 4AT1B 3JSBA 4OYZA 3WBZA 2F8EX 3C8YA 1P6TA 4DSJA 3GG1A 3QRQA 1VK8A 5LM7E 3KJVB 1KQSR 1REVA 4P2SA 4EK2A 3SDEB 2B51A 2YWWA 4F36A 4I7FA 2R8JA 3PW4A 4F4KA 2V4JB 4QWCA 3ZZOA 2N7CA 1U47A 1C2PA 2IM0A 5AE2A 2FD2A 3CD0A 4TVAB 2V63A 4X4SA 4FYVB 2HZAA 3TZZA 3MURP 3HVAA 2C2ZB 2O5DA 5KT3A 3MEGA 1Q81T 6FD1A 4DV3F 4QIWD 2XMKA 3KLGB 2AEFA 3LTOA 4M5HA 1SJQA 5E3AA 2G0JA 1O0PA 3GFZA 1S1UB 3PV8A 1XK8A 3UVJA 2IC3A 4ID5A 4AD6A 1L3KA 3ZFVA 4F02A 4YDXA 4ZP8A 3MI7X 3VTIA 1FTRA 3M9NB 1H7XA 4A8MP 3DLEB 2J9DE 2MQ8A 3I0SA 4PXEA 4OJ1A 4PG4A 1UMJA 2KXHA 3CCVS 3G2XA 4DFKA 3QWPA 1XJWB 5GADI 5IT4A 3FK4A 4X62F 4DPUA 1SVDA 5H9EK 4ECVA 5KFKA 3IR6B 5KFUA 4KKOA 1ZA1B 1Y00A 2MQNA 3BKUA 4EMDA 2M88A 4KV8A 1FFGB 1U1OA 3W2VA 3DHWC 3O2IA 1S9GB 3IGNA 2QA1A 5K14A 1XMQJ 4ICLB 2NXNA 4FN5A 5A76A 2R7VA 2CG8A 4HT5A 2AMCB 3G6ES 4CYUA 4WFAQ 3LO3A 4MJKA 2BQUA 5KFBA 2X51A 3GMGA 3D6MB 2ZH5A 2GFFA 3TJAA 3VCDA 4YFUA 2PGCA 3SSRA 5KFEA 4I2QA 3SI8A 2UUAF 1AYEA 3CW2C 3OVSA 3QLHA 4CLPA 1B0TA 1TAQA 1GEHA 1RCXB 3OSNA 1C1CA 3HHLD 4CRJA 4IQXA 2MEWA 3ZTRA 5CCMA 2ZH3A 4C0HA 1A0OB 5T14A 2J0WA 1RU2A 1UVNA 5IV3A 3HXMA 5KOXA 3BGFA 2RHSB 3US5A 1PBAA 3FC9A 1LEOA 1TKTA 1HBNB 1MG7A 4OX6A 4OI1A 2RDDA 1CS4A 2L9NA 1HNXJ 4IFVA 4YHHF 3MEKA 1N5YA 2Z58B 2C22A 4X65F 1HR0J 2AGOA 2VA2A 5GMEA 1JLQA 3CC7S 3QNWB 3L95X 3EUNA 1PG5B 4HDGA 4LFAF 4ECUA 3Q89A 1FEHA 4NLOA 1RJJA 5JJBA 1P1TA 5IT9Y 5F8IA 1MN9A 2FB0A 1CQMA 3AD9C 1NK9A 1U0SA 2UXCF 4JI1J 1FX2A 2XGPA 4ECRA 1YVFA 3TA1A 3F73A 1HMVA 5CH7B 4RW4B 3DRSA 3ZZTA 2CNKB 1Y0HA 2M70A 1RT4A 2COLA 1RTHA 3PO5A 4QWAA 4ECSA 2KXFA 1WHXA 2XBPA 3CUNA 1TZ0A 5DQGA 1KNZA 4KQZA 2HVZA 4NEZA 4WFNQ 2FIUA 4XIUA 1FK9B 1LWEA 2H5IB 4ECWA 1E6VB 3FBBA 2I8EA 2ZC4A 3TUPA 2VDIA 4C3LA 1XR6A 4DPXA 5CD4H 3Q8RB 5D8HB 1RT3A 2UUCF 4GKKF 5BYRA 4DV7F 3D0IE 1NDPA 1K0TA 3VAMA 1Q5YA 1HW9A 2YWEA 5C42B 1NB7A 2DNKA 3EZUA 1M90T 1VC5A 2HMIA 4IR1A 2CWXA 1X9WA 3HKWA 1Z2LA 1WSRA 3I5CA 4DI6A 1FKPB 3N9UC 1YHQS 1RA6A 2E5HA 4JYAJ 2AU0A 2OH2A 2CPDA 4TN2A 2F7VA 1JLGB 4ECZA 1F6TA 4J9RA 3M1VA 1QSLA 1TUVA 3R1LA 4NX9A 5C7PA 4DV0J 3R7NB 2OEKA 2ZUAA 2NR0A 4CLWA 1VLOA 3TAMB 4HKQA 4DX6A 2IYGA 1L5UA 4M5GA 2V4RA 4DL6A 2XYPB 3CXCR 5L1IA 1RSCA 1VMBA 3SV3A 2ROGA 1KN6A 2V69A 5I3UA 5A8RB 2GO9A 1RT7A 4NA2A 4KHPJ 1JLBA 2GIQA 1WELA 4LR8A 3PR5B 5HVHA 2UUWA 2EBEA 2BJDA 3JQKA 3CEDA 1YTYA 1FJ7A 1JNZB 1GX6A 1EP4A 2CPYA 2VKZG 2FJWA 3K5MA 3L7PA 2V8PA 2W4PA 1BUXA 3DMJB 4YY3J 2Y1RI 4F3QA 4NMLA 2F40A 4I56A 1X0FA 1QTNB 3IN5A 4YB5A 3MEDB 4F4YA 2AQ4A 1R0AB 1BD6A 1UVLA 3NBPA 1UEKA 4WYLA 2WVDA 3MM7B 3OR1B 4CH0S 4TLQA 2W25A 2HWIA 4N76A 4WWSA 2YPZA 2B56A 4TY8A 4EBCA 3M8PA 1Q82T 1IKYA 2K1RA 2WONB 4UW2A 1FDDA 3MM9A 5HI7A 2WB4A 4RUBA 4DZDA 3I0RB 4DR2J 3MMBB 1V5VA 5IXUA 3T5HA 1XMQF 3IBCB 4KTQA 3P49B 2F9JA 3IR5B 3MR3A 1N88A 1C4CA 3CDEA 4A8KA 3BSCA 1B0VA 4ALZA 1S1TB 2DK2A 2ZNZA 3EX7B 3ZNJ1 4ZIWA 1T9WA 4RNHA 1Q53A 2MKIA 4HH0A 3WQPA 2B9WA 3MECB 3GFYA 2B9YA 4ANCA 3MM8B 4RUCA 3MUTP 2HRTA 4WP9A 3GSDA 1VC0A 1LW0B 4HTIA 3C6TB 4GO7X 1T0TV 3K8WA 4I2PB 1DQ8A 2MKJA 1RT2B 4WF9Q 3CJRA 1CJTA 1SH0A 4XDCA 5DDRC 4DU7A 5JMNA 1I94J 4RW7A 2CQGA 3E2EA 2DGSA 1PILA 2AYGA 4M1KA 2QLFB 1S7IA 3G8TA 3M2RB 2CQ2A 1FI4A 2PT0A 2WVBA 1DRZA 2LLZA 2LQ9A 2N7YA 3X1LB 1EETB 5K8PA 1YRXA 5SUHA 2IRXA 3E01B 3AJ2A 1S6OA 1C4AA 1HNXF 4NLDA 5GAHU 4G1QA 4X2BA 2WSEC 1NKEA 1QDUB 3DRXA 3DGVA 2FJXA 3OFEA 5FDLA 1RXOB 1ZH5A 1HR0F 1GTHA 1NXIA 1RT1A 1ZM4A 3SFUA 3AT1B 4ZOSA 3KG1A 1FA0A 2VBYA 4CO1A 3HVRA 2MSTA 5IQQA 2L08A 3QWUA 4ZPDA 1J5OA 4JI1F 2O01C 3RBXA 2AW0A 2IAJA 2GMHA 1DY3A 3LPYA 2EFQA 2Y8YA 3NGSA 1IR1A 2RAQA 4O3RA 4RW8B 3GILA 3PFOA 3W66A 1FRHA 4GC7A 4LRBA 4IG0A 4B9LA 2RKIA 3V4IB 1AFIA 4QYZK 1N54B 1Z4UA 4WPAA 2AF6A 3QIPA 3K7RA 1GMVA 1JK9B 4GMKA 2CZ4A 2BE2B 2PFDA 4WXOA 1YSJA 1IKXB 3PY8A 1RWXB 3BDEA 1XN9A 2YVSA 2ZKUA 5GMKa 1DQ9A 1Q5VA 2OHDA 3GLJA 3ZZUA 4PABA 4WFXA 2QA4S 3FQKA 3FJ2A 3S1TA 4ZP6A 4UF4A 2CNOB 2ZJPQ 3TNVA 3HK2A 5KG4A 5GADU 3QRRA 5CZVA 3OTBA 4BDPA 2QLJB 4RBUA 2HK2A 4EEYA 3OL6A 4LREA 1ITPA 1VRTB 4DL4A 4B08A 4JV2A 3PYEA 4J9PA 3MD1A 5J2QA 1UJ4A 4JYAF 5GMDA 2PMWA 3OSPA 1CJKB 3OXGA 4M5JA 2KVQE 3ILJA 1ZYQA 1T11A 4PRFA 2KDOA 3JQJA 4DV0F 1HNZJ 2DNLA 1Q0NA 1OSDA 3VQTA 1DZ5A 2QMUB 4KYZA 3IP0A 1GQEA 2WCXA 3M8RA 4PQUA 1J5EJ 3K8VA 2GV1A 3A8JA 3DM2B 3MTKA 3GQCA 1XQIA 3IBFB 4NE9C 2ATCB 4Y00A 1M5PC 2V4QA 4KHPF 3KDNA 5B7WA 2GC8A 2CPFA 2HFOA 2M0GB 3QT7A 1YGYA 2A1BA 3FVYA 5LJ5Y 3BR9A 4Y2MA 1EKSA 2FPHX 5D3GA 3LPEA 2C2MB 4M5DB 3EDRB 4ZVUB 3RAXA 2F8MA 5BXIA 1RWMB 3OXFA 4YY3F 3PZPA 3LP0A 1HW8A 1R8AA 4DS4A 1QAXA 2YKNA 3DLKA 3KLEA 4K2JA 1RTJB 3TEHB 5KFXA 3W8PA 2VQFJ 4TU9A 2RE1A 4WFYA 4K4WA 1LK7A 7FD1A 2DEIA 8AT1B 1F1BB 3FSIA 3HT3A 1FHTA 4ED6A 4KJIA 1U1RA 2ZHBA 2EPIA 3POTB 3MPUB 1YJVA 3NNHA 3SV4A 3M6UA 1HWUA 1V3ZA 2W2MP 5G0RA 4IR9A 4F2RA 1LXNA 3VGUA 2LU1A 2E1PA 4DEZA 2Q79A 4DR2F 3EM1A 4ZJLA 1T7PA 5F8JA 3HD1A 2ZZMA 1NSKL 3LWLA 2W4DA 1UWBA 2IM1A 1NH8A 1OYDA 3N01A 2MKKA 2C42A 5L1JA 1U1NA 4ATNA 1RHKB 3EPIA 1ZZNA 1O51A 2ERRA 5FIIA 1FERA 3LQVA 3QFWA 2IVYA 3K5OA 2QMWA 2YQ0A 3S7RA 2M52A 1M5KC 3BBCA 3H59A 4ERDA 3ZZYA 4M5KA 2KT3A 1N5TA 3H5UA 1YLXA 3U1LA 1IXKA 2V50A 1VC6A 4KBIA 1CJUB 2FTRA 2RQ4A 3A13A 3PEJA 1Y3KA 4IUFA 4U9RA 2BANA 3VWSA 1RTDB 3KNGA 4I0WA 1NJYA 4NI2A 1BQXA 2HHUA 3GV7B 3PX4A 1U1KA 2CQIA 2FHJA 3SZ2A 2OTJS 3HT0A 1PCAA 1NK5A 1ROFA 3GFHA 3CD6S 1S59A 2CPIA 2EFVA 1LK5A 2CQ3A 2PFFB 4LSNA 1APSA 1WHVA 2HFNA 1XEZA 4OZ1A 3HHLA 3KUEA 3MFHA 4HEA9 2EWHA 3D54A 4B3OB 4Q0BB 2IA6A 1RABB 2IJRA 1TTHB 2A6OA 2GO8A 3S8SA 4CIOA 5AE3A 1F3VA 4KGMA 1U25A 2CAJA 2DXFA 4BC7A 1N0UA 5JXSA 1WD6A 2BR0A 3DLHA 1PAUB 4A8OA 4ED1A 2WOMB 1ZS6A 4K50A 1LWXA 2LMIA 2YX1A 4DR5J 2YPYA 3D1HA 3QGIA 2RDJA 3KYLA 1NUEA 4P2XA 3W9IA 4YDDB 3MZIA 5BR8J 3DI6B 1Y3JA 3D6FB 1JLCA 2EFNA 1B99A 3DLJA 1LWCB 1M5SA 3QGHA 1F5CA 3FZ2A 5H9FK 1NDCA 1VQSA 1CVJA 2AZ3A 2MY8A 4BWMA 3IGVA 2J8SA 2OELA 2MMYA 4WE1A 1TFWA
chains in the Genus database with same CATH topology
3RRGA 2CQ4A 1BQNB 2E5LF 1HA1A 4N77A 5E2QA 2A10A 1YJTA 3IS9A 4LQ3A 2ILYA 3MCSA 3FRYA 2KYXA 2L9DA 2JOQA 1YQHA 4C7QA 2HW3A 2KHCA 4FXWA 3OTCA 4E8UA 2WK4A 1S99A 3RR8A 4PG5A 5A6PA 3CJ4A 3AJ1A 2KM8C 1KLNA 4IOAQ 2JLFA 2HNZB 2Y0SD 4DJBA 4O3OA 2B7BB 2FJBB 4WZMA 2QLWA 3JSYA 1S7HA 3VAFA 2DNPA 4JI2F 3PDNA 1F5BA 1HQEB 2UVWA 2XSFA 4LJMA 2BQRA 3U1MA 5CCLA 4X4NA 1AW0A 2D7SA 3LANA 1N5VA 4G6VB 2OPQB 5D6GA 2R7XA 3I87A 2JEJA 1O5JA 3V4MA 2OO4A 5K8MA 2XI2A 3OL9A 4PXBA 2IBOA 4ES1A 5KT2A 2YWHA 1ZPVA 1ULRA 2QFJA 4G1PA 2MB0B 1WEZA 1Y4ZB 2N82B 2DRBA 3C6UA 5EHHA 1XWLA 2DD8S 3FCHA 4CT8A 3TO8A 2XC9A 2CJ9A 3KK1A 3CF5Q 1T94A 2ZOFA 4B3SF 1N36F 1BC6A 1VK3A 2UXDF 1JLCB 5F0UA 3T5LA 2ZM6F 4Y34A 2LEAA 4IFYA 3UCUP 5I3QA 3MTJA 2ABYA 1FNOA 3B4MA 5KG1A 1DBDA 2GQCA 4F3MA 4NYPA 4OHVA 2CJQA 2EBGA 1K1QA 1FDBA 4ELTA 3BO2A 4URSA 2DH8A 2E66A 2DHGA 2K7KA 3BF4A 3QJPA 2HFZA 3MPVA 3G71S 3LP2A 4JUZA 2P6SA 4LVNP 2HGNA 2R7WA 1U45A 2D41A 2PA8D 4HH1A 1JLAA 4AUKA 3M4XA 3ZZRA 3HVWA 1U6FA 2MZTA 2YKOA 4R0JA 4WE1B 2YWKA 5EDWA 2VV5A 1HNZF 2KG0A 4AFFA 2XCPA 1Y5LB 2L9WA 4NA3A 3KFWX 2P5VA 2RIJA 2V8GA 3JYTA 3RW6A 3IS9B 2K2PA 3W3SA 4PPDA 2LKZA 1NK6A 4AXJA 5KT6A 3K5LA 2ASJA 1LOUA 4ZDNA 2HHSA 1NO8A 5DDOC 1J5EF 4UY8T 1LWFA 2NUUG 4Q7AA 2V9KA 3DOMA 1DTQA 1DHMA 3FRZA 4IG3A 2IMWP 2OPRA 3TANA 5KG2A 3TUIC 2W8KA 1FD8A 4J9OA 4RWWA 2RS8A 1S9EA 2V8VA 2VA3A 5KFYA 3CJKA 1BWEA 5KG7A 1R8HA 1WWHA 2N4DA 2HAIA 1A9NB 4KB7A 2MQOA 2ZBCA 2LVWA 1WF0A 1H7WA 2YNFA 2ZOGA 4G3IA 4PWDA 3I55S 2B5JA 4DSKA 3ISND 2C28A 3TI0A 3GFXA 4YQWA 3G9CA 2A2DA 2J9EA 1S0VA 2KO1A 3AH6A 1UVKA 1OSCA 1U49A 3M32A 3PKYA 4OL8A 2AP6A 2PEHA 2NPFA 2D3OR 1LXJA 2AWZA 2YKPA 2C3MA 2V5HG 3D28A 3C6UB 1HPZA 4H4KA 3THTA 3U1NA 4F4WA 4LF5F 2DTJA 3J7ZT 1VQKS 4DWIA 3KK1B 2DNMA 3PW5A 1X8DA 2HNYA 3T9NA 2VB6A 1Q86T 4B9MA 3IRXA 3EZ5A 1AFJA 5L9NA 2FC9A 1FKAF 2Q1LA 4ZVGA 2DPJA 4IFYB 1SJ1A 2GA7A 1JLFA 2J9CA 2ZH2A 3N5BA 4DQQA 4CNZA 2E7WA 4NRTA 5B0GA 2ZH4A 2B6AA 3BO4A 2OSRA 4IO1A 3NNCA 3BQ0A 2P6TA 4Z37A 2OD6A 1TVRA 3JSRA 3VZHA 4FF3A 4LMZA 1PC4A 1KLMA 4K4TA 4AQYF 1S76D 2N4CA 4OX7A 4PG8A 4XO0A 2KKHA 4A4JA 1UW4A 5D4PA 1L3UA 4CH7A 1N8RT 3LP2B 2HVIA 2JJ4D 2NSBA 4DF8A 2MZQA 1UJ5A 1RT5A 3OFGA 3AQOA 4CZCA 2VQFF 1NHUA 1K1SA 1JLAB 5KFPA 3M9MB 2ALZA 3SMZA 4IOBA 3D1QA 2MQLA 4LF7F 2ASLA 4K4XA 1ZOTA 1FVSA 1X4EA 4EYHB 3F41A 1FVQA 1R6YA 2UUTA 3EXCX 3NAHA 2W9CA 1JJ4A 3JYTB 1VI7A 2LCWA 2QV6A 3H8YA 5JUMA 4BCAA 1QJHA 1UFWA 4FP9A 3CMAS 1ZZFA 3N6NA 3M6XA 3PEHA 5KFGA 5IZHA 4NPOA 5F8GA 3JTPA 5KFNA 4IH5A 1LWFB 1NU4A 3HZGA 2B0GA 2RJZA 2Q6BA 3K5PA 4N8OA 1DTQB 4IG3B 3VAHA 2YKAA 2OPRB 3QPIA 2YKMA 2HHVA 4O3NA 4AE5A 3RB4A 3IFEA 1IBKF 1S9EB 3CJKB 5CZXA 3H98A 4B9VA 5KFMA 4OZ0A 4RBTA 2YX4A 4DF4A 2OLWA 4W90B 3T1HF 3HHDA 1J2VA 2YNFB 3LF0A 2UU9F 3MAHA 1NJZA 4PWDB 4KRWA 2B5JB 1SJ4P 3J81Y 4OHZA 1RKIA 2JH3A 3NS6A 5DO2A 2YWGA 2Y1JA 4ECQA 3ISNC 3BB5A 2QSWA 5MLCV 2BQ3A 1G2EA 2J0SD 3IRWP 2U2FA 3TYTA 3TARA 2BUNA 3M32B 2RQMA 2R8KA 3M2VA 1HPZB 5D4OA 3BQ1A 2OJ3A 3DLGA 1PC5A 1XTZA 2HNDA 1RDRA 4OV1A 2HNYB 1DQAA 3FMWA 3IRXB 2B4PA 2K3IA 3MEEA 2B4OA 2FY1A 4MIWA 3GV5B 4KPYA 1JLFB 3PFEA 4O4RA 4ZPAA 2RF2A 3CDUA 2BOPA 4IYQA 1SJFA 1RT6A 2B6AB 3CD5A 1HBMA 3GIJA 5HP1A 1X5TA 4OJHA 1TK8A 4FPRA 4FF1A 4WU2A 2E1MC 2D9PA 1TVRB 3P6YC 2VPXB 5L39A 4RU2A 3UCGA 4OZJA 3CMES 1KLMB 3DFEA 4UUXA 2KFZA 3R3TA 1WHYA 2QYCA 2F3JA 4O23A 4QIVA 3VAGA 4N56A 1SUQA 1RT5B 3MUVP 4DG1A 3IAS9 3N79A 2KHDA 2SXLA 5JVGQ 4ELUA 3UPFA 4BBYA 2GJ2A 4QU7A 3QO9A 3ONQA 4K4SA 2DGTA 3N0VA 4OI2A 2DIVA 1BQMA 4WFZA 5L1KA 2W9CB 5GAGI 1K8AT 3G8SA 1Q8BA 2CPZA 3EXYA 4NXMF 2O1PA 2GJIA 4PQAA 3KOAA 1WF1A 2BABA 3D1OA 3GR1A 2DGQA 2LA6A 3C3LA 2PSZA 1N52B 4KSEB 4OI3A 3A8EA 4X4QA 4WK3A 4C0OC 4TQRA 2XWYA 3W7BA 3DHXA 1QLNA 1R89A 2DNRA 1IQTA 5LSOA 4QPTA 5H9EJ 4H4MA 5F41A 4Q2LA 4C2MA 3I9ZA 3E8OA 2YKMB 5KFAA 2XNRA 1JKHA 4BWJA 1NHVA 4XDDA 4RUHA 1RYRA 4Y28C 2CPHA 4I1TA 3K5NA 3SYZA 5FJ4A 1R7IA 5K8OA 2NXUA 4ZVFA 4URGA 3J80Y 4ES2A 3CCMS 3HFKA 5B09A 1UFLA 2RQKA 3PJWA 5AE1A 3TOQA 3LWMA 4DLEA 3CC4S 4LF9F 4CNYA 3CCSS 1F9FA 1G6BA 2DNZA 2VPYB 3BEGB 3RR7A 3M2UA 4RUAA 3M2VB 2M7SA 5EWFA 1SJRA 3QYYA 3ENWA 2XWXA 4E0DA 2XMWA 3NGKA 3QZ8A 3DLGB 1U1PA 1LFWA 2YNGA 2HNDB 1U1MA 2RRBA 1U4BA 3N6MA 1SKRA 4ILMA 2MQMA 3GIIA 2FVPA 2FGCA 1N5SA 4E98A 2IM2A 2HZCA 3MEEB 5E3PA 4H54A 3UI3A 4LFCF 2ROPA 4IH6A 2HHWA 3HF5A 3V6DA 1MW7A 2GQQA 2GHPA 2RF2B 2O3DA 2MZRA 1NKBA 2HPUA 3CD7A 5DGAA 4K4YA 2XCAA 3TAPA 3IG1A 1VBYA 1JJHA 1RT6B 2MZSA 1HBMB 5HP1B 4HT7A 3BN4A 2OP5A 2K8GA 4MFBA 4DQPA 1DTTA 4K4ZA 4M95A 3UCZP 2FVRA 3GG0A 4JI4F 3WDOA 4QYRA 4TU7A 1U48A 3KK3A 1TKZA 2KM8B 5KFIA 1WTBA 4X4VA 4OFZA 2G9OA 2JC1A 3NG8A 3GYXB 3UFCX 1SUQB 4ID8A 4DG1B 2YH0A 4UQTA 1OPZA 3P96A 3ZZPA 2CPXA 4YR3A 1R8BA 2R7QA 1OPIA 3N5FA 3SFGA 5F9NA 5A2QY 4ECTA 1QAIA 4U6PA 3I5AA 4C97A 3QO9B 4DV5F 4ETXA 2ZH6A 2MJNA 5BYSA 3PW2A 3H2VE 2W7OA 2R2TA 1TK0A 1UAWA 1U6ZA 2BACA 4A48A 1BQMB 3OLAA 4DR5F 2C2DA 3LALA 2PN6A 1UKUA 1NJWA 2Q43A 1WACA 3BGUA 3NLCA 2XS5A 1FDNA 4EBEA 3KWMA 5DDQC 4ES3A 2OIHA 3OL7A 2C2RA 4B02A 4CH1A 3H4BA 5BR8F 2EK1A 4OJGA 2J7WA 3H4DA 1FXDA 4LQ9A 2DGUA 1TP7A 4H4MB 3HP6A 1B64A 4K59A 1UL3A 2WBMA 2XG8A 3DDKA 3KJVA 1JKHB 4C8ZA 1N33F 2YY3A 2R2RA 4CQ1A 2MZJA 1JX4A 5CYJA 1S1WA 4DFPA 4IDKA 1U1LA 1TL4A 2AJ4A 2UV8G 2OMLA 4UUWA 4B9NA 3G86A 2ADCA 4KIAA 2VC0A 1YG0A 1N5QA 2VFUA 5KG0A 2RSQA 3VF0B 2VOPA 2VG7A 4I4BA 4Y2IA 3SDEA 3DRRA 4MYUA 5IWAF 4GO5X 4B9UA 1JLEA 5T41A 2W9AA 2XMUA 3N4WA 1XR7A 4NLUA 1SKSA 4RW9A 4ZK7M 4ECXA 3PX0A 5F0WA 2W9BA 5KG6A 2RUGA 4B9SA 4EZ9A 3UQSA 3OUYA 4UY85 3M2UB 4NRUA 3JAMY 3VZIA 2XHWA 1TR0A 2LECA 3PX6A 1UVJA 2R7SA 2CQBA 2ZDOA 3NAIA 2YNGB 5A8KA 4A46A 5A8WA 4QWEA 2DPIA 1KTQA 2Z8QA 4P6QA 2WBRA 5M2UA 2V4JA 3BM7A 2DBBA 2LQJA 2VD3A 5C24A 5EN1A 3NCRA 5C25A 4XAKA 3V6DB 3OVAA 1ZAWA 1VQ4S 3IG1B 2KT2A 2ZKTA 2IJNA 4C8LA 4JV0A 1D8ZA 1QSYA 5D78A 4MFBB 4J9LA 1WI6A 1JIHA 1DTTB 4NLGA 2JFDA 1FRKA 1XNQF 2VODA 5LXYA 2YKQA 4CO4A 3CSKA 1FRMA 3KK3B 1TKZB 1H2VZ 5E3QA 1SBRA 5GAHI 3KLFA 5DRKA 4OX9F 4KGKA 3J7Z5 3NMAA 2ROEA 2C3OA 1VIOA 3H5YA 3FZBA 1NZAA 2ZHOA 5KFWA 2CYYA 1ZAVA 4DR1F 1HD1A 4PR6A 3DXBA 2DHXA 2JZ5A 5F3ZA 5DETA 4QW8A 4B3TF 3JSBA 3D2WA 3O44A 4M8LA 1F5AA 3KLGA 4CO3A 1IKWA 1KS2A 3WBZA 2DISA 2GHWA 3QIDA 1S1UA 1HWKA 2F8EX 3C8YA 4DDFA 3DLBA 4YOEA 1FDAA 1RA7A 3IA0A 3Q0AA 2XY7A 2E1RA 1P6TA 4DSJA 3GG1A 3MPYA 3CJ2A 1VK8A 3TP2A 5L1LA 1UJ6A 2GMJA 2L3MA 4NLSA 2B4UA 3KJVB 4MKAA 1NH7A 4NLXA 4WXWA 4FYDA 1S1WB 3S01A 4IDKB 3A1YG 1REVA 4IKAA 4MAKA 1KQSR 2KTQA 4P2SA 1JXEA 2IRUA 2E9TA 3DLEA 1S6QA 2RVJA 2VG7B 3BN7A 3SDEB 2V9WA 3DRRB 1SV5A 2B51A 4FBTA 1JLEB 1P8GA 4R25A 2AJ0A 2A18A 4RW9B 2W9BB 4RNFA 2I1RA 1VQ8S 3OUYB 2UVUA 3LGNA 2ZNYA 4I7FA 1WNEA 2R8JA 4ZCLA 5SZTA 3PW4A 3R1HA 5A8KB 4F4KA 5A8WB 2V4JB 4QWCA 3ZZOA 2N7CA 1U47A 1C2PA 4DSLA 2L41A 2IM0A 5AE2A 5C24B 3BQ2A 3OTDA 5C25B 2YH1A 2FD2A 2LXUA 3HHEA 3CD0A 3PM9A 5GAEI 3T9ZA 4C3KA 1RYSA 2ADBA 2UVVA 2N3LA 2ZBIA 3I31A 2LXFA 1VGYA 4X4SA 1RWUA 3I32A 3OTEA 3CCQS 2UP1A 4R5PA 2MQQA 1R8CA 5IM0A 3MURP 2W24A 2DGWA 2ZUGA 4I6AA 5DGBA 3KLFB 1X9MA 3HVAA 2NZ4A 3B8HA 1GTEA 4X84A 1S9GA 2O5DA 4NOHA 4OI4A 5KT3A 5DLGA 4H4OA 4QOTA 2YX7A 5LSRA 4ICLA 1FE0A 3Q2SC 1AUDA 4F26A 4RNNA 1P27B 3MEGA 1Q81T 1TKXA 2MXYA 3KLHA 4RBVA 1FJEB 1LKZA 6FD1A 4DV3F 4QIWD 4Q43A 2KT5A 2VASA 2XMKA 4FZVA 3P3DA 1M5OC 3KLGB 3T5KA 4J9KA 1Q78A 2RD5C 2JC0A 2FHOB 1SJQA 5E3AA 1IKWB 3PHEA 3GFZA 1O0PA 1S1UB 3CWJA 4XK8C 3PV8A 3W2WA 1QM9A 4HLBA 4A8FA 1XK8A 3MUMP 2IC3A 3GV8B 4W92B 4K5RA 2EKYA 4ID5A 4JI3F 3H2UB 1S49A 3Q24A 1L3KA 1D8YA 3ZFVA 4F02A 4JBCA 5E3RA 2EG2A 3O3LA 4N5SA 2CQ0A 4YDXA 1REVB 1HFEL 4ZP8A 3MI7X 3VTIA 1FTRA 3M9NB 1H7XA 4A8MP 4LT6A 2HHPA 3DLEB 3MR6A 2BM0A 1S6QB 2J9DE 4Y65A 4DUZF 1P1LA 1SV5B 3FNNA 2W7AA 3I0SA 5HROA 4PXEA 1RISA 4OJ1A 4PG4A 3NL0A 1UMJA 1FRLA 2KXHA 4ED7A 4DV4F 3CCVS 2CQ1A 5J1EA 3Q22A 4DFKA 3QWPA 4OQJA 3C46A 3NNAA 5GADI 2R7TA 2QSFA 1VQOS 5E3CA 5IT4A 4LIRA 4I7FB 4B9TA 4KFBA 4X62F 2R8IA 1Y5NB 5FLXY 5CXTA 1FEEA 4C98A 2VZ9A 4OZ5A 2JEGA 4ECVA 2YQ3A 2JVRA 3MMAA 3MMCA 3IR6B 5KFKA 3PRBA 3J7A1 5AXMA 3BZQA 3QJJA 3CULA 1KFDA 5KFUA 1TAUA 4KKOA 2J76E 2PI4A 4O3QA 1Y00A 2QZ8A 2AYBA 1X4AA 4X4RA 1GXLA 1Q79A 3DLLQ 2MQNA 4DL0C 1KD1T 3L3CA 2M88A 2B3TB 3CCJS 4KV8A 1S97A 1S1XA 2BRKA 3GB0A 3FQLA 2V2KA 1U1OA 3MM5A 1FE4A 4R5PB 3W2VA 1Z1ZA 2FC8A 4QIFA 5IM0B 3DHWC 4IRDA 2EC0A 2GX8A 2XULA 4WFBQ 3CCWA 3KHGA 3O2IA 1HBNA 5EX3A 1S9GB 1VQPS 3IGNA 3NKYA 2QA1A 4QPXA 4H4OB 5K14A 1FXLA 5BJRA 1JXLA 5KFQA 4ICLB 3KK2A 2E5GA 2IFXA 4DQIA 4FN5A 4NZ0A 4ZPTR 4JI0F 4WTYA 3MEGB 1VBZA 2BRLA 4HT5A 2R7VA 1TKXB 3KLHB 3G6ES 2CFXA 5KFHA 2BA9A 4X64F 5ITHA 2ZH1A 1V3SA 3EGZA 3T5JA 1X4GA 4WFAQ 1U2RA 1VQYA 3LO3A 4OI6A 1FJGF 4MJKA 3G6YA 2BQUA 1G1XA 3W2WB 2YTCA 5KFBA 2M5YA 2ZH8A 2X51A 1ZPWX