2GQCA

Solution structure of the n-terminal domain of rhomboid intramembrane protease from p. aeruginosa
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
MSAVQVLKFPLSVDLAGFVGLLRRLNVPHRVSEESGQQVLWVPDERLAEQVRELYRRYPEGDPQATLEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rhomboid Intramembrane Protease
publication title Solution structure and dynamics of the N-terminal cytosolic domain of rhomboid intramembrane protease from Pseudomonas aeruginosa: insights into a functional role in intramembrane proteolysis.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 10
structure length 70
sequence length 70
ec nomenclature ec 3.4.21.105: Rhomboid protease.
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16733 NRho Rhomboid N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2080 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gqcA01
2GQCA
chains in the Genus database with same CATH superfamily
1TL5A 4OYBA 3MM5A 4G65A 5MLCV 2FJWA 4YR2A 2QGFB 3Q2TC 2RS8A 2WSEC 2JWNA 2CJQA 2RJZA 2UXCJ 4ZVRB 2PEHA 2F4VJ 2D3OR 1QVGR 2BRLA 3B6BA 1Z2ZA 4I4BA 1FX2A 4GO5X 1TKZA 2CPYA 5E7OB 3CIZA 3NNAA 1CULB 1JKHA 4X66J 1JLBA 4P72A 4X4NA 2HSEB 4DV5J 1QUVA 2QC3A 1SJFA 2UUCJ 1W2IA 3BN4A 2B6AA 1YJRA 1BE4A 4M63A 1YHQS 2BX6A 3WIVA 3V6DA 4KFBA 5HBMB 5DGBA 4YR0A 3Q8SB 4DQIA 1T11A 5ETMA 1UJ5A 3CT9A 1VQMS 1S0VA 3AQPA 1P9QC 3OFGA 1YWXA 4DX8H 2JC1A 1TU0B 4OYPA 1XNRF 2Z2ZA 1JNZB 1DQ9A 2AGPA 1FXDA 4DN0A 2CG8A 5L8RC 2KHDA 2HIYA 2IJNA 3KMSA 4JI2J 2NREA 1EETA 3T5LA 1RKIA 2ZH9A 3ITHB 3I4PA 4G1IA 1X9WA 5ETKA 2DIVA 4B9SA 2BJEA 5EX3A 3OLBA 2ZH2A 1GQEA 4QU7A 3UPFA 5J2MB 1FNMA 3LPYA 2XY7A 1Q79A 2DNKA 2DT9A 3MAQA 3G2XA 3MPDA 4I7FB 4A8OA 2V8GA 1XMQJ 5M2RA 1HFEL 1TL3A 5THWA 2E1MC 5CYJA 1X4BA 4WZQA 2X7IA 1PBAA 2BA9A 2I8EA 2X1GA 4BCAA 1RTJA 5GADI 3PX0A 1RZMA 2IC3A 2KG0A 4DV3J 4OJGA 4ZPCA 1KNZA 1K8AT 1GXTA 2GJ2A 5C7PA 5B0EA 5C2GA 2OTLS 5GMEA 1X60A 1KVKA 2HVIA 1VI7A 3FNNA 1ZYQA 1GX5A 2OH2A 1SH0A 2K3KA 1HIYA 1U1PA 1J5OA 1RTDA 5KFUA 2HQ3A 2UUAJ 2BKPA 5KG6A 2V4JB 3D6FB 4CLZA 1MG7A 1RUSA 4EUVA 2YWFA 1V3ZA 4ZPWR 4K50A 4PQUB 4KH1B 1S1WB 3QNWB 2CA9A 2AJ2A 3SXLA 3WIUA 4J7CA 2B5JA 2RB7A 1RAEB 1RT1A 2A6OA 2VG7B 3CF5Q 3RU0A 3N6LA 3ZZUA 3M32A 5DQGA 3ZZTA 3HULA 3G6XA 1P6TA 2W1BA 5GMKa 3SQGB 4LRAA 3HT3A 4OX9J 4GKKF 2XQCA 2HGMA 3MM9B 3WHIA 3MAAA 5CAAA 2KXNB 4PXDA 1S0NA 3NLCA 1X7VA 2COLA 1SUQB 1XC9A 4FBTA 3EPIA 1Y7PA 3EXCX 2WW8A 4ZCKA 1F9EB 1HD1A 3BREA 3Q83A 2DRBA 1Y9OA 4FP9A 2WCXA 5AJ3J 1NO8A 3MM8B 2HHHF 2NPFA 3SIPB 1AB8A 4ILRA 4NLOA 4MK7A 1SC4B 2N7CA 2PFDA 4I67A 3JSRA 4DQQA 2HBZB 3BEGB 2UUWA 3Q0AA 3I5BA 3W9JA 2I2YA 4F4XA 1AUSL 2BVZA 5BYRA 1IKYA 4DX7A 1JLFA 1X4GA 2YKMA 3EM1A 2KDOA 3L09A 2AV5A 4QYZK 2FTRA 2ZH6A 1T05A 3UI3A 5CZVA 1H0HB 5K8OA 1U09A 2QV6A 3VGTA 5SUHA 5ETLA 2OPSB 2OMLA 3M2UA 1H7WA 1NHUA 4ECWA 1P27B 1HQUA 2XWXA 4BWMA 2M7SA 3KLIB 3H40A 4OHZA 1CBKA 1NPRA 1HBUB 5IC6B 3OLAA 1SKWA 8ATCB 3POTA 3D0HE 1WC1A 1XNQF 3I32A 2P8IA 2MHEA 3BR9A 1VQLS 1EQMA 4LF6J 1UPPA 5B0CA 3L4BC 3CMQA 4H4OB 1UKUA 4OZ1A 2A0FB 5GVQA 1DLOB 4ES1A 3JAMU 1MSWD 1N48A 4M5GA 3LAKA 2HMIB 1VQOS 2NZ4A 3RBEA 1I5OB 2XB2D 2BJ7A 2FJDB 3G71S 3ETMA 4UOFA 1HI1A 1UA0A 1U48A 1SCJB 3OTDA 3CD6S 4KPYA 2CG4A 1NXIA 2HHWA 4DV3F 1FVQA 4OI4A 4DL4A 3Q8PB 3I82A 2GVDA 2DNZA 3AOAA 3ZZ0A 2OPPA 2DNGA 2QA1A 2JX2A 4EZ6A 5H1SV 2F5GA 2J0WA 5C2CA 1BUXA 4NZ0A 3K5LA 2RHSB 1R31A 1YJUA 2UUAF 3U02A 2F40A 5KFFA 1X4FA 4U95A 1U1KA 3RRGA 2E9TA 4OYIA 4R0EA 3I5AA 2K8GA 3N5BA 3D68A 3MFHA 4LUBA 3IG1A 1RU2A 1U24A 2FVCA 3PHEA 4GVLA 2DGTA 1U0SA 2ADBA 1TQLA 1U1NA 2UZAA 1K9MT 3BYPA 4OX9F 3IA0A 4Q0BB 3A4TA 3OFEA 4MIWA 3DRRB 1LXNA 1JB0C 3V5RA 1RA6A 3FJ2A 2G2OA 2Q79A 4CT8A 4GRSA 3G9CA 2MSTA 4P75A 4R25A 1T7PA 5HROA 1RACB 3TAPA 3PW5A 3ISZA 5IOLA 4DV1F 2LKZA 2GX8A 5I42B 3PVXA 4I69A 3RB6A 4OFZA 1ZM9A 5AJ3F 4L73A 4NMLA 3PJXA 1PO6A 4F3QA 4OI3A 4CCHA 1YJWS 3BPDA 2UUBJ 3VGSA 1F3VA 2MSSA 4Y0FA 3EE3A 1H6KX 9RUBA 2HNZA 3M2RB 2NLWA 3ICLA 3Q22A 3IGVA 1TL4A 4C3KA 1KLNA 2GVZB 4CLKA 3R1HA 4LFCJ 1DTTB 1FFWB 3A3OB 2HS4A 3R6GB 4H4KC 1RAOA 2OO4A 3O5TB 4NA3A 4DFJA 1S48A 3PFOA 2I1RA 3OUYB 2ZBIA 1MWZA 2BANA 3HHLC 1UVJA 4TYBA 2JVOA 4PG5A 4U7CA 4LR8A 3KK2B 3UCUP 2G13A 4ZIWA 2XMWA 3ONQA 4WYLA 1F0XA 1U02A 3ZTOA 1SKSA 3MPVA 2IM3A 4CO1A 2BBEA 4AFFA 4TKTA 1C0UA 4LF6F 2W2NP 4LF8J 2K1RA 2MY7A 5L38A 4HH1A 1IKXB 4OV1A 1PILA 4HYKA 3HFKA 5H9EJ 5K9FA 1OIAA 4UY85 1D8YA 2CQGA 3LAMA 1EX8A 5BXIA 4X64J 4O4GA 5AXMA 2CPJA 5U47A 4C48A 5RUBA 4DSKA 1UZHA 1Q78A 2PFFB 3OV7A 3NWGA 1RWOB 1YVFA 4TU9A 1UVNA 3R5DA 3GTYX 2AEMA 2CQ2A 1R8PA 1GXLA 3MOJB 1S72S 5K20B 2LEBA 4JI4J 1ZM2A 3NL0A 4OLOA 3U1NA 1SL2A 3TRGA 1UAWA 7FD1A 1SIZA 2HQFA 3QWUA 3UD3P 4OX8A 1SJ4P 4CI0B 4HLBA 3OTCA 1M5SA 1FCAA 2D3UA 4PKDB 1S10A 5KFAA 2A2CA 3JQJA 4JI1J 3MURP 3M1VB 1JLAB 5JMNA 1FRHA 1WTBA 4U9RA 4NLYA 4IUFA 4J5OA 5B09A 3QIDA 1UCNA 1SJ3P 3RGIA 4IO9Q 3MR3A 4DV2F 2RU3A 4PG4A 2AX1A 4KJIA 4KHPJ 2DPJA 2E66A 4NRUA 2A3JA 3N28A 2PI4A 3GILA 1FRLA 3GWCA 3W61A 2RDIA 4ICLB 2BE2A 4J9PA 1TAUA 2V34A 4OQJA 3IP0A 1VC0A 5CZXA 3O1LA 1UWAA 4WTYA 3IN5A 2WB1D 4DFPA 5HAOA 2IJRA 4MYUA 3MMBA 4DR5F 3C19A 2DO0A 4ED0A 1EB0A 2XC9A 1ZAXA 4FZVA 4X4RA 5HMXA 5D4LA 5IXUA 5J2QA 3CCTA 2VUGA 1HNZF 2P9CA 2CQ0A 4MKYA 1WDTA 2CVIA 1VISA 1XK8A 4LFAF 2QMUB 3OVSA 2XS2A 2AEFA 1VRTA 1N34J 3PHTA 2UV8G 1FJ7A 1U8SA 4JUZA 4P7TA 4DCPB 1VC6A 3C15A 2QO3A 1SV5A 2Q66A 4NZ6A 3QJJA 4IH7A 2IRXA 3LUYA 3L95X 3BGRB 3GLJA 3DN9A 1RAFB 1KEKA 4XK8C 1AT1B 1RWUA 3HD1A 1TV6A 2L48A 2LP4A 1GMWA 3TUZC 2XCAA 3KHGA 4R0JA 2XZWA 1RTZA 4L6V3 4K4XA 1A0OB 1K1QA 4B02A 3CC7S 2E9RX 2AMCB 1T03A 2VPWB 2OHDA 4RW8B 5GAEU 4JI6F 4NI2A 2YKQA 2E1PA 3AHPA 1HWJA 1N6QB 4GMKA 1N54B 4DDFA 3W5XA 4JI4F 4ITSA 3A3NB 3VQSA 1Q5YA 5SZTA 4LF5F 2VASA 3CCVS 1Y3JA 3DI6B 4FNIA 2F8MA 2IAJA 4ETZA 4LFBF 1JLEB 2CJKA 2F3JA 2D1CA 2WRMA 2XYGB 1S6QA 2RRNA 1WUUA 4MIAA 3TA2A 1JNRB 4Q5VA 1FE0A 2HBQB 2J0QD 3IWLA 4ZMMA 3RAMA 3GCXP 2ASLA 2P5VA 2CPIA 1G4CA 3KUEA 2C3YA 2GAGC 4WP9A 4DL0C 3CW2C 1UTAA 4F4WA 4C0BA 3M4XA 4DR2J 3W2VA 1TMJA 2IY5B 3T5HA 1WKJA 2WZ1A 3QPIA 2CQ1A 1OPZA 3JYTB 1M1HA 4AXJA 3U1LA 1V5IB 2WOMA 1CJUA 1IKWB 1WKLA 4ECYA 5HQLA 1P9YA 1RHKB 3MEDB 1Y00A 5HANA 2DY1A 3JTNA 4QIEA 1VIXA 1HQ2A 3JSMB 5C5JA 1TAQA 2HZCA 3BKFA 1DHMA 2XO6A 2DKOB 1FFSB 3LOUA 1IVZA 1QY7A 1NSPA 5LMNF 3Q8QB 4KV8A 1W26A 2DR7A 2ZNYA 4KGVB 4WF9Q 1U1LA 3GSDA 2B56A 4ZN3A 4LT6A 3MR6A 2FJAB 5DDOC 2HHQA 1D9FA 3H5UA 1LOUA 1NEEA 1NDKA 1QE1A 3I55S 4IFYB 2C2EA 1AFIA 2AYEA 1ZAVA 4W4MA 4FKYA 4ZS6A 2F1FA 5HP1A 3PNIA 3VQTA 3MCMA 2YX7A 3GV8B 3KJVB 4G3IA 1S0MA 2CPFA 3KLEB 5CH7B 1X0FA 2LEAA 1CJVA 4O3QA 2QMXA 3PRDA 1N33F 3HKWA 4B3OB 1J27A 4JV5F 3SCIE 3M8QB 1RT7A 1VR6A 1RP5A 5HJYA 1G3OA 1CC8A 4DR7J 4DWIA 4ES2A 2VBYA 4RWWA 2GV1A 4NXMJ 1FA0A 4JYAF 3GZ7A 3BZQA 1N32J 4KHMA 3SI8A 4ELUA 2PA3A 1MROB 4C8NA 2J9CA 4OJHA 2DNNA 4CM2A 1T9YA 2IDLA 3FZBA 1VK8A 4H4MA 3H25A 5DRKA 1SI9A 3D3CJ 3KDNA 3W9IA 3ZO7A 3SFUA 3Q8RB 2UU9J 3DYAA 1VQ9S 3VVTA 5CHCB 3PCOB 2NXCA 1TUVA 2I5JB 3TVZA 4YR3A 3HLUA 2ZBRA 3CJ0A 2XZDB 2FY1A 2DGVA 2KL8A 2K3IA 2PDAA 2NYHA 4ED4A 3AQOA 2Y1IA 3H5SA 7AT1B 5L1KA 3CJ3A 2YNFB 4ECUA 1XR7A 3Q24A 1CULA 2YXLA 4IRKA 2DJWA 1EIYB 3GIKA 3MTKA 4DR2F 3DXSX 4LSLB 4AUKA 1RKJA 4USWA 1QVFR 5M2UA 2NR0A 2AWZA 4EWTA 2P6TA 1EKSA 4DF4A 2QA4S 3SDEB 5HBMA 1SH2A 1VRUB 1U7LA 3FRZA 4RUCA 1TKDA 4FPIA 3KK1B 4ECTA 5G4DA 3N79A 3HHDA 3ENQA 1GX6A 3BGFA 1WI8A 1HLWA 2GAHC 4YB5A 3DCAA 1X9SA 4J9KA 3K17A 1I1GA 1VS3A 2VZ9A 1OO0B 1S9EA 3RW6A 4M5NA 2HYIB 1XMOF 5HLFB 1CJKA 2VODA 1F5CA 1CLFA 1KS2A 1S1TB 3TUPA 2WVDA 1J2VA 2RUSA 2OJ3A 1T8EA 2XY6A 1O51A 3P4UB 1Z4UA 2IM0A 1BD6A 1VJQA 2W01A 3UDLA 4TNOA 2V4QA 4BC7A 4FF2A 3MPUB 2V67A 2OFHX 5KG1A 4YMEA 3LQVA 2W9BB 1PJ7A 1HHSA 3BGLA 2YX1A 2BACA 5KFZA 1BMQB 3MECB 1N5VA 4I7FA 3WQPA 1ZS6A 3R2DJ 1ITPA 2HBRB 2AJFE 3V4IA 3W5YA 4IG3B 5HL7Q 4RNNA 4DR7F 2VBXA 1I3OB 1GT8A 4F67A 4EMDA 3PW4A 5C42A 2BJ3A 3VWSA 1NB2A 3AD8C 1BHNA 1VK3A 4URGA 1EQ0A 3SFGA 1ELOA 2OSRA 4RJVA 5IWAF 5BR8J 2AIRB 2XZTB 1NJYA 1JLGB 2V4JA 3N6MA 2UU9F 3U27A 3H59A 1FKOB 2FHJD 5K14B 3R27A 2PO4A 3H90A 4IR1A 1SL1A 2FC9A 4HHHA 1MU2B 5LMUJ 4W90B 3I0RB 3HZGA 1VBKA 4UOGA 4WXOA 3TX0A 2AX0A 4ZVGA 3EXYA 5KOXA 1TL7B 4NLGA 1WF0A 1RAGB 1NM2A 2LA6A 3B78A 3MM9A 4A8FA 2XBPA 5J2PB 5C24B 2XLJA 2CPZA 2MPUA 4O44A 4LF4J 2CQBA 2V2ZA 2R7OA 1RCXB 4M5LA 2ZWOA 4JV1A 1FI4A 1KC8T 3A8KA 2LFVA 4R8UA 2Z8QA 3MM8A 4ERDA 1N5YB 2KXFA 2CJXB 3B4DA 5DLFA 2W8LA 2XMKA 5LOQA 4NEYA 3CJKA 1NH8A 3MR2A 1LK5A 4ZIVA 4DL7A 1GNKA 1LWCB 3HVWA 1S4EA 3DNCA 3FCHA 3HJFA 4C98A 5JUMA 3BQ0A 4EU0A 3T9ZA 3GV7B 3EGWB 2CXEA 2ZITA 3T1YF 4KT0C 4C8MA 2GHPA 1JLQA 2RMLA 3FBFA 2CYYA 4CT9A 3RR8A 2VB6A 3GFHA 5CA5A 1RWMB 1E6YA 5IQ6A 4KKOB 1RBLA 3W9HA 4X62F 3OJUA 2HW3A 1N0UA 2IHR1 2XGQA 1DLOA 1SQEA 2QL5B 3IR6B 4C8YA 4IG0A 1B7YB 2NZCA 2LVWA 1Q7LB 2HVZA 3GB0A 1VLYA 1OWXA 4KIAA 4LIWA 4YS2A 3NOGA 1S6OA 3DLKB 3TI0A 1URNA 1HHTP 2HEKA 1U49A 1RT4B 4CO3A 2OMOA 3G8SA 2YKAA 4E0DA 1L5UA 2L9DA 4CNYA 1QAYA 1NSQA 3CWJA 2YWEA 4Y2KA 4DPYA 4BDPA 1LW2A 2BEFA 3UN3A 5T7LB 2BJ1A 1AA1B 2FVRA 2HFZA 4ED3A 3J7ZT 1T3OA 1MMNA 2EXUA 4DPUA 4HTIA 2KVQE 1U6BA 2DR6A 3T1AA 2W24A 1Q1KA 1HR0J 3D6HB 3KNGA 1KQFB 2PEBA 1W7WA 2WVBA 2Q43A 4ZDNA 3M8PA 5F8HA 1PYSB 1QAIA 4UZCA 3CGIA 5KG4A 4FNHA 2HNDB 3BR8A 4Y2MA 3K7RA 1B0PA 5ITHA 1EZZB 1BQNB 2CJYB 1KHWA 2VA3A 1Q8BA 2VOPA 4HHJA 4DV0F 2RSQA 2VL1A 3CJ5A 1I94J 4PXEA 1LQ9A 1N36J 2IBKA 4OI6A 2VH7A 3IRXB 3MDFA 2E9ZA 3TQ1A 2Q6BA 2VOOA 1W2BR 1NRKA 3W7BA 2M0GB 1OSDA 3H42A 4NYPA 3PG9A 5E41A 3DRRA 1T9XA 3CJ2A 3R2CJ 4KPCA 3CCZA 1HWUA 2O66A 1LWEA 2VFRA 5ETOA 3IR7B 2V8PA 4LF4F 3M8WA 3MHYA 1VDHA 5J2NB 4NCAA 4Q45A 2LU1A 2XMVA 3GIMA 2HAFA 3MAHA 5A0YA 2DGSA 4DS4A 3J7AN 5A8RA 1UVIA 1SKUB 3VHQA 3QGHA 2ZBCA 3LALA 2APOA 1TUWA 3F41A 1QM9A 4WKRA 1VCTA 4ZVEA 1WC5A 3M2RA 5B0FA 2BQRA 2MLYA 5KFHA 4CQ1A 2QX0A 3TO8A 2J7KA 2V8DA 3H8YA 5I3UB 3J80U 4EBEA 2QLBB 1IBMF 4FPRA 2FJXA 4ZA1A 3DU6A 1N5SA 4OJ3A 4NEZA 3OUYA 2XLIA 3M8ZA 4KAIA 4XDDA 2V5HG 4ZVHA 2DYAA 1WC4A 3T5KA 3NGUA 5CYMA 3CMAS 5B0GA 2F8EX 4J91A 1EP4A 2D9OA 1FJGJ 1HBOA 2WBMA 2GGPB 4N47A 3CCMS 1TVRB 5T14A 2Q6CA 1KTQA 1CG2A 3MEEA 3ZNUA 3I0SB 1OQ3A 1E6VB 2WK4A 2WONB 3BS9A 3PKYA 2B0GA 4HDGA 3CDAA 2NUUG 3MUVP 4K8RA 1D09B 2W4PA 3CCQS 3PO4A 4FYDA 3DGVA 1Q86T 3NCRA 4F4AA 2X3GA 4DUZJ 3VAMA 1CJTA 1HMVB 2EK6A 1H72C 3M05A 3H4BA 3LF0A 2J9EA 5J1EA 5EWEA 4CLUA 1UFWA 2RS2A 1GEHA 1OSCA 1F9FA 4DSJA 1AYEA 1K1SA 3QIPB 5DG8A 1R0BG 2C2ZB 3N9UC 4O3NA 2M8DB 3NS5A 1ZAWA 3KJFB 2G1HA 1S9FA 1HR0F 4M5DB 4YFUA 4ZCIA 2ZJQQ 4OZNA 1BQMB 4Q2LA 3IMQJ 1JLAA 3CIMA 4FXDA 1C1BB 1NKEA 5L39A 2ATCB 5D78A 2DISA 3N6NA 2DY9A 3ETOA 1N5TA 4FS2A 1YZ6A 3G4SS 1WEZA 3E01A 4QYZJ 1I94F 3UDCA 4TXSA 2B9XA 3TARA 1N36F 2AGQA 2VQFJ 4QIWD 1RT2B 2E5HA 2JJ4D 3GCWP 2PN6A 4IR9A 5HVHA 2XTJP 1AXQA 4HEA9 4PG6A 3EGNA 3B8HA 1L3KA 4ECXA 1IUJA 3OR1B 1JJCB 4UZBA 3W2WB 4J9NA 1HYSB 4LMZA 2NPIA 1RI7A 2Y1LB 3THPA 4WFXA 5EN1A 2IA0A 1XBWA 3HP6A 5KFPA 2DITA 4DQRA 5A6PA 3ZTRA 3EJMA 3VALA 4DLEA 1UVKA 3DOKB 4C8KA 2I0XA 3DM2A 3QLHB 3QATA 1XWLA 3HI9A 1N8RT 1UVLA 1YJ9S 4TLRA 5GAGU 4I2PA 2H4WB 5HK4A 4F25A 2QFIA 3P3DA 4OHYA 3L7PA 4RX6A 1LW0B 3IC1A 4ENOA 3W8GA 3GPAA 1K47A 3M8RA 1XIQA 4Z37A 2UXBF 1C0TB 1S1UA 4ANDA 1C1CB 3EPGA 4U7UD 1DFDA 2DHSA 2OKQA 3C6UA 3FCVA 3W8PA 3GFXA 4QBUA 4ZCLA 3BGOP 4DSFA 1NZAA 3ENVA 1MN9A 3DGPB 2GJIA 2XMMA 2M52A 5K8NA 2C2DA 1RTHA 1TTHB 1FJGF 1LEOA 1X5TA 3A8IA 2V9WA 1UW9A 1HA1A 1HL6A 3THTA 3D0IE 4OZ5A 5KT3A 4TY8A 1HNWJ 2ZKUA 3GONA 4C11B 1TKTB 4RU9A 1SKRA 2J9DA 1TK5A 1WELA 2VBWA 2K06A 2AHOB 2VJUA 2VF3A 3ILIA 4BBYA 2VPYB 2XNQA 5D4PA 2PT0A 4YB6A 4WIIA 3QYYA 4RW8A 3EVOA 2XI3A 2BM0A 2MKJA 4HI1A 1V5VA 4UOCA 5A8WA 2ZDPA 3C14A 2OPQB 2XYHB 2YKNB 4DMZA 2ZM6F 1MWQA 1VQPS 3PX4A 4KYZA 1VJWA 2KKHA 4NLXA 4DV7J 3MD1A 3ZTQA 1NK0A 5I4MA 1A7GE 2ZD1A 4O3OA 2I9SA 1N4LA 3H2UB 4DSIA 4AQYF 1JLEA 1M5VC 3KLFA 2WVCA 2BJDA 3IR5B 2JEGA 1SB6A 2NQPA 3PV8A 4USTA 2RQMA 4FYVB 3O8WA 1ZM4A 5E5NA 1KRPA 5KFCA 2ZDOA 1S9GB 4CLPA 3MUMP 4NLSA 4ER8A 4OYZA 2FVQA 5F8IA 5KFEA 2W7OA 2DGQA 4CM0A 1NK8A 4RNFA 2PIIA 1X4AA 4FXVA 5I3PA 1ZTTA 2H51B 1ZA2B 4NCGB 1R8BA 1FX4A 3US5A 1NJWA 2CQCA 2OEKA 3HVAA 4HVZA 3ZZYA 4RW6B 3MR5A 3G87A 4YY3J 3MMAB 3W66A 2MKCA 2ZNZA 4QPXA 1PG5B 3MM6B 1UA1A 3OTBA 3KLGA 2B9WA 1IKWA 2E5IA 4CRJA 4K4SA 3PM9A 3FEXB 3PFEA 3MEDA 3OTOF 3C66A 1R27B 5DDRC 3KDOA 4LR9A 3EZ5A 1WHXA 3RW7A 4A8KA 1HNIB 1U0HA 4AL6A 2XCPA 4Y2AA 3ZZRA 3EWGA 4OYOA 4FBUA 4UQGA 1YKWA 2C1EB 4A4JA 4GKJF 1WHWA 2JEIA 2IM1A 4M8LA 5ETQA 4DCJB 2IMOA 5HMZA 4MH8A 3OXLA 1RYSA 4ZVTB 4CLSA 1L3UA 4MFBA 4DQSA 5KTQA 4TLQA 2EKNA 3CC2S 3MCOA 2EFOA 4NA1A 1KOHA 2O3DA 2GO8A 1B4SA 2HFVA 2PE8A 2OPRA 1KVJA 4DR1J 4KBIA 4O23A 4DQPA 5CABA 2ROGA 3KJVA 1UWBB 2CVEA 3R5JB 4OJ1A 3CD5A 1IXKA 5FD1A 2YBVA 3HCXA 4Q2MA 2H65B 5KOWA 4B3RF 4CYUB 4A48A 4NLVA 2OTJS 4MKVA 2CRLA 4NRTA 4B3OA 4RBVA 1FF2A 3EYZA 2YWKA 4EGLA 1JXVA 4L74A 3M8QA 4JI5J 3M30A 1YQHA 3BBBA 1YJ7A 2M9KA 4KSEB 4J90A 2ZUAA 2WSFC 3QRQA 4DF8A 2HKEA 2HQDA 5LXYA 1KTVA 1J5EF 4DV7F 1WSVA 2GA7A 3FBCA 2PMHA 3LWMA 1Q8KA 4CO0A 3AB4B 2DK2A 1X4CA 3TA1A 1HQEB 6FD1A 4WP3A 4CO4A 4MYTA 2R7UA 4UTGA 5L46A 4EFAC 2BKOA 2CQIA 3BJYA 2B43A 2JL9A 1S1VB 1JMTA 3NOCA 4PYDA 4P7VA 1JLCB 2HZVA 3FGVA 3TR5A 1UEKA 4RNMA 2IM2A 3E51A 3NBPB 2FHMA 3NRBA 3FSYA 1MMLA 1Y0HA 1Y4ZB 2B8QA 3UVJB 3C2PA 2XSJA 1KBRA 2YNFA 3TVYA 2E5GA 1NUEA 3FKBA 4Z2XA 5E3RA 3C3LA 4JI3J 2R2SA 3LP2B 3TAMB 4YY3F 1H74A 2YPYA 2ILZA 2HNYB 3DLHA 1R8CA 2KFYA 1X4DA 3D2WA 1T9UA 2RE1A 4G1QB 3LGHA 2JEFA 6AT1B 2MQ8A 4LSNA 2HQIA 2M2BA 1UMJA 4DEZA 3CCUS 3KK1A 4DR3J 5LSOA 1YIJS 3FFIB 1NB7A 2YY3A 1S6PB 1RWWB 1VBZA 3QAEA 3D5MA 3EUNA 3TVKA 1HHQA 4Z7CA 1FNXH 1RHQB 2ZH7A 1H38A 1RTIA 2VD3A 4ZKAA 3J81Y 3AJ1A 1ZM3A 3H5XA 1PBUA 1FRXA 3JTPA 3PR5B 4PEOA 2VIHA 1YZ7A 4E2FB 3K8WA 5KG0A 3V2UC 2VKRA 5DDPC 2VPZB 4JI8F 2DHGA 1XNRJ 4UT4A 4ZP7A 4WIQA 2L41A 2JSXA 5G0RB 4WE1A 5FIIA 3QGPA 1SIWB 1GFWB 1G1XA 2RRAA 3MM5B 1XERA 4USIA 3NS6A 1LWFB 4I56A 4IG3A 2MZSA 2D7SA 2EFNA 3QFHA 2YQ1A 1TKXA 4ES3A 2ZJRQ 2PA8D 1BC6A 3KG4A 2MXYA 2HPUA 4PAAA 4LF9F 2POKA 3MM7B 3DMJA 1RYRA 1IKVA 2PI5A 2Z30B 2CNNB 1NPPA 1JKHB 3BN7A 1JLBB 1DTQA 2FQQB 4Q43A 3VGVA 2GQQA 4B9UA 1JLGA 1VLOA 1X5OA 4IQMA 3V6DB 1O8BA 7FDRA 1FKOA 5A8KA 3M8YA 4CO2A 5JVHQ 1OQ6A 3PYFA 1WKKA 3J81U 4LF2A 3OD2A 4OZLA 4ZLJA 1CC7A 3I0RA 2PGCA 2O5DA 2ZH8A 2HIQA 4HACA 5ADZA 3ZZOA 1LWXA 5D3GA 4LQ9A 5KFIA 4L3NA 4NE9C 1OPIA 2J0XA 2FC8A 5A2QY 3F44A 4KGZB 2QA4G 1M5KC 2GS8A 1EETB 1DQAA 5J2PA 2WVFA 2G2YA 1Y11A 4YP3A 1FXLA 4QOTA 5IC4B 1D0EA 2IVYA 2ZZNA 4ZHRA 1WSRA 5CYQB 2ALZA 2JLEA 4DR3F 1BLUA 2R7VA 2XI2A 1C4AA 3VAFA 4K5RA 2KT3A 1T9TA 1PAEX 2IFXA 2QMWA 4J9VA 4DN9A 3DLEB 2PMZD 3LPEA 3UE2A 4C97A 2A10A 1RAAB 3MZIA 5IT9Y 3TZXA 2XSFA 1LWCA 5JVGQ 3ZXWA 3N4WA 3T5JA 1RB0A 2B8PA 4WJBA 4GKKJ 2CPDA 2QLXA 3OXFA 4YB1P 2BYCA 3AH6A 3AA8A 3DLGB 4UY8T 2DH9A 1Q53A 5F0UA 1VHFA 2CPHA 3KK3A 1RTJB 2RT3A 3OBIA 4PWUA 2C2NA 2IC3B 3DOLA 5BJRA 3MEGA 5FDLA 4AD6A 2B51A 4N8OA 3W64A 2QL9B 4QPTA 3ET6B 3TEHB 1RLCL 4PCQA 3TQEA 3EICA 2QLFB 3B54A 2HHHJ 4RW9A 4HKQA 3H20A 1NK6A 1J5OB 1RTDB 4B9LA 2HFNA 2JDJA 2EK1A 2HBYB 2MQNA 3NGTA 4IRDA 3GG1A 4ED1A 3AXKA 2I6WA 4F7VA 3KJNB 3DRSA 5M2PA 2GFFA 4Y28C 1QSLA 2R7TA 2YNHA 2V69A 1X4HA 3ULHA 5C25A 1RT4A 1KR4A 1TELA 1YBUA 2V9KA 1ICEB 2B5JB 1YITS 3UN5A 1RT1B 5DM6Q 1ULRA 5LL6d 1TK8A 3DRPA 4WWSA 1UJ6A 4TYAA 2AD9A 3CULA 1LFPA 3M7VA 3WDOA 3D4JA 1XNQJ 4ZOSA 4ZK7M 3MOZA 2RHQB 2AGOA 3MAAB 3CCWA 4ZPAA 3W1YC 5IT9U 2AQ4A 2GJFA 5L1LA 4UW2A 3R7NB 1TUGB 4OX7A 5ETTA 1SC1B 1B0VA 3Q23A 1PIEA 4YDDB 2Z2LA 2AYGA 2KJVA 5KFWA 3DRYA 5HO4A 1FKAF 2VQEF 2KM8C 2R7SA 1JLFB 2YKMB 4QW9A 1H3DA 5KT6A 1APSA 2LDIA 1T05B 4HR2A 4QU6A 5B0BA 3HM9A 3OR2A 2ZE2B 3ILJA 4EYIB 1HQUB 5J2NA 5L9XA 4C8LA 5CQGA 3RZAA 4ALZA 2UVWA 4ID5A 3AA9A 2IVMA 2VG5A 5ETVA 4L75A 2LQJA 1D8ZA 1YGYA 2DGWA 2GIFA 3A1YG 4DSLA 4ZP9A 1RU1A 1MMDA 1YI2S 3I6PA 3LP0A 1WC0A 4MMOA 1SJ1A 4EK2A 4QCLA 3T1HJ 3S6EA 4F4ZA 3V6JA 4DPXA 2KYZA 2H9ZA 4YHHJ 4DOZA 4DUYF 2RILA 2KRBA 3F0NA 2ASDA 2GHVC 3JB9k 1XR6A 4URSA 4DV1J 2N3OA 2MGZB 5KT5A 3TAQA 4K4WA 1TVRA 4N56A 1U6ZA 2OPPB 1HKAA 2BOPA 1N88A 2OIHA 3CD0A 3VAIA 2W9AA 5F8JA 5L1JA 2K7KA 1E6VA 3KTQA 2WONA 3JSYA 4P9SA 1VQ5S 4P6QA 3W60A 1IBLF 3HHLD 3KHHA 2RIJA 3A12A 2XLKA 4KO0A 3H7HB 2F9DA 4JI7F 1H98A 2G0IA 1VHIA 4XIUA 2HRTA 1R0AB 1JX4A 1PKUA 3ISNC 4MAKA 2JOQA 3ELHA 3NMRA 2HHVA 3PRVA 4MTPA 3IG1B 4IKAA 3R5BA 4DV6F 2QEXS 5HVFA 5E3AA 4LSZB 4DX6A 2NCKL 2EVZA 3QIPA 4XPCA 1FESA 4ECRA 3HVTA 5LJ3Y 1F2GA 1CPZA 1X4EA 1V6HA 5D4OA 4N7TA 4WFAQ 3PW2A 3LGNA 3CCJS 5HROB 2ZH3A 4JP8A 1R0CB 2EEYA 3ENAA 4L76A 2ACYA 2ZBPA 3NGDA 3U7JA 1C1BA 4HT5A 1NMEB 3LP1A 4L3KA 3HKZD 2G0JA 2MQMA 3CDWA 1NHVA 3NNHA 2SXLA 2W7PA 4MT1A 1FDBA 2MJUA 5D77A 1NAQA 2F7VA 4I64A 5KFOA 2HNZB 2MDAA 5E3CA 1RCOB 4FF1A 3TZZA 3V6KA 4CLWA 2GMJA 3DOMB 2W2OP 2DHHA 2J5AA 2CQ3A 4RUHA 4QIVA 3BO2A 3OFHA 1KQKA 1YJTA 2BANB 2YTCA 1HYSA 3P6YC 5K8PA 4X4QA 3FBBA 3WC0A 3D1HA 3KG0A 2W8KA 3DOKA 3QLHA 1V3RA 4CLFA 3R7BB 4QR2A 4MIBA 2V8VA 3NCQA 2J6TA 1C0UB 5AE1A 4DV2J 2K1RB 5F9NA 1KD1T 4WP8A 1Z1ZA 1NJXA 3QZ8A 2RF2B 3N01A 4M94A 4WXWA 1C0TA 1C1CA 4O4GB 1TL1B 3T1HF 3BSAA 5E0OA 1QSYA 2HHUA 2JLGA 2OLWA 4YHHF 1P8GA 1FTRA 3MXHP 1FEEA 3AXMA 3B4MA 1AZSA 1G6BA 3TX8A 5D6GA 4Z7YA 3DHWC 3OPKA 2J6SA 4B3SF 2QFJA 3PX6A 4F0KA 2X1FA 1FK9A 5B7WA 4TY9A 1HI0P 4DR5J 2PC6A 1RAHB 2LQ5A 3EZOA 2OEJA 3OL6A 3SZ2A 4C11A 3IAS9 4ZITA 4J9LA 2RQKA 1HNVA 1HNZJ 3KUGA 1U2CA 3CO9A 4LFAJ 4HH0A 3OXGA 2HWHA 4PR6A 3UN2A 5F8MA 4A47A 4RUAA 1R6YA 2DGXA 4JB8B 2FHKA 2RH3A 2M70A 4IFVA 2L9WA 3EX7B 2Y0SD 1QAXA 4U8VA 3AOBA 3D28A 2NXJA 2FDNA 4LF7J 1Y5IB 2R7WA 3WX8A 3AODA 5KFRA 1CEZA 2H1YA 1KFDA 1L3SA 1BQXA 2VA2A 4FDFA 2G4BA 2KG1A 1SC3B 3RTVA 3ZNJ1 3TJ8A 2J8SA 4USVA 2FVSA 3MMBB 2YQ3A 3NCPA 3MCNA 2HAIA 4JI6J 3FQLA 2JZ5A 2FHJA 1Y3KA 3E8OA 1R8AA 1YG0A 2NXEA 4ZCMA 1RA7A 4FYYB 5J2QB 5AE3A 4DI6A 3C16A 1NKBA 5IM0A 1PYOB 4NCGA 4LF5J 3HFZB 1Y10A 2VFTA 4PG8A 5DGAA 2P2CB 3NAHA 1KHVA 1VRTB 4QIFA 2VICA 1FRKA 3EGVA 4LFBJ 3MF5A 3C15B 1TP7A 4ED2A 1Q16B 1IR0A 1RLDA 5J1NA 4X4OA 2HRUA 4NOHA 3U1MA 1T94A 1VBXA 1T0TV 3IM8A 1GMUA 1AUDA 1TV6B 1VQKS 4E98A 1RDRA 3E2EA 5IT4A 2QLWA 1BWVA 4YN3B 1VGYA 2ZUGA 1SH3A 5KG7A 2IYGA 2DO4A 2A6MA 2Z2MA 3CCES 2BZ2A 1DRZA 1YDLA 2ROPA 4EO6A 4ZLPA 5L9NA 3ILLA 4FVMA 5DG7A 4YEAA 4Y3CA 3T19A 3F73A 2CIMA 1WF2A 3WX4A 4NI2B 2QZ8A 1XMBA 3E3XA 5DQHA 4BLGA 3FUYA 4DPOA 4C6AA 3S1TA 2MTLA 2UUTA 4I0WA 4MK8A 2DR8A 1REVB 5EGYA 3MUTP 5E2QA 5GAEI 2RRBA 4I1TA 3OVBA 3VF0B 3MI7X 1M1KT 2IAJB 1R43A 4DG1A 4LVNP 3AJDA 4PWDA 3WC2A 4CYUA 2CNKB 3HD2A 2BKNA 5LMNJ 4WK3A 1GH8A 2AF6A 1XQIA 2YVSA 4F8RA 3G82A 4M5MA 3NNCA 2BMBA 2WTFA 2YNIA 3QO9B 3BDPA 5EX0A 1IJFB 3IFEA 4IO1A 3MEKA 4DUTA 2CPEA 4K0KJ 4BWJA 2DD8S 1DZ5A 1RHJB 2ATLA 3UFCX 4TQRA 4CWBA 1TFWA 4LF7F 4DPTA 5H9FK 2ABYA 3I31A 2M3DA 2ZEJA 2VG6A 1HQEA 3FEZA 2XULA 5KFXA 4MJKA 3W2VB 4I2QB 5CD4A 3HMJG 4RO0A 4DS5A 3PXGa 4Y2CA 1N33J 3OHBA 1FJCA 1RADB 3GIIA 2MZRA 1B0TA 2ASJA 2WOMB 5FLXY 4JV5J 2BE9B 3OVAA 4N5SA 1BWEA 5DM7Q 2O67A 3R3TA 2YH0A 2Z0GA 1SXLA 3HHEA 1WC6A 2OELA 2FHOB 4LBIA 1LV5A 5J1PA 4JYAJ 4U96A 1FRJA 2BM1A 2XMTA 3IBCB 2DNLA 3K5MA 4IRCA 5AXKA 1F2HA 3UNGC 4J9RA 2ERRA 3DLLQ 3LP2A 1ZPWX 3T9NA 1KP6A 2HFUA 1RXOB 3ILOA 4DV4F 2DBBA 1QE1B 1DURA 1URRA 4N41A 4EEYA 1G7CB 2VFVA 3FFIA 1NPKA 4DFMA 4IH6A 4CNZA 2ZHOA 5ETSA 4N8NA 5HSPA 2HURA 4OI2A 3CD7A 4GC6A 4J37A 4J9MA 1CJVB 3AD7C 4A8SA 1ZZNA 2V2VA 1T02A 3IXQA 1H2TZ 1QSSA 2KFNA 1YRUA 1EJ7L 2B7CB 2ZJPQ 4K4YA 3PY8A 1ZBTA 3M6WA 2DB1A 4J9OA 2ZC4A 1HARA 2RQCA 4P10A 1B64A 2OFGX 5FLXU 1KOOA 2KHCA 2FY8A 3N0VA 3CCSS 2HWIA 3PKMA 3I9ZA 3BH7B 2HHTA 2Z57B 1FXRA 4B9VA 2KB2A 1KWMA 2VV5A 5HQMA 4V19X 2D3O1 2U2FA 2MZTA 1LWFA 3DYAB 5KG2A 3NEKA 1XMOJ 2BDPA 2VFUA 1R3NA 3HHLB 4ZVFA 1SC6A 2AW0A 1X31C 3BM7A 3GJSB 2DVIA 3J7YU 4DR6F 2LDYA 3NGSA 4K0KF 3AB2B 4B3MJ 3R5AA 3MM7A 1OY6A 4X65F 2LYVA 3CDUA 2HFOA 2FUG9 4PUOA 5IQQA 3H5YA 2QSWA 4AT1B 3G8TA 2R9LA 1MNEA 1HPZA 2CZ4A 2IRYA 3DC2A 5KFTA 2XY5A 1OMSA 1YTYA 5DDQC 4ED5A 3OL9A 4Y6IA 2C22A 2H5JB 4LF1A 1F60B 2E5JA 1CSJA 1S0OA 4B3TJ 3HT0A 2XMAA 3W62A 1HWIA 5K5MA 3CJRA 2EI5A 1MWYA 4USMA 3CO0P 4AYBD 1YRTA 2DGUA 1HBNB 2LXIA 1IWGA 1UETA 3K59A 3PW0A 1VIOA 2RUGA 3WBZA 1S9EB 2EC0A 2Y8YA 1RT6B 3KG1A 1CJKB 1XR5A 3SSRA 5IWAJ 3C46A 4PYAA 2KJWA 5IS2A 3I87A 3GJTB 4J9UE 5D0RA 4OIXA 1FVSA 1U2RA 2Q3PA 3QT7A 2DCLA 5CYQA 3UNYA 4C3MA 2ROEA 1RWKB 3RBZA 1FD2A 1Q8IA 3MMCB 4NLDA 1TZ0A 3EDQB 1M0SA 3SCLE 3K8VA 3DLEA 5EWGA 4GVBB 2VU5A 1DQ8A 1IBKJ 3OJSA 3S01A 4NXNF 3BO4A 3HZEA 3ZTSA 2J76E 2MLZA 4RWXA 3V4IB 5HVGA 5B08A 1KONA 2B9YA 2LQBA 1VQSA 3VR1A 4RPFA 1K0TA 5DZ6A 3DLGA 1RABB 5CCMA 2E5LF 4OYMA 2VBZA 2W4DA 3GFYA 4OHWA 3LA0A 3P5BP 5C42B 1VC5A 3ET6A 4ECZA 2EFGA 3DU5A 2BE7D 2FJVA 4PPDA 1PC5A 3QT5A 2EKYA 3OL7A 2L08A 1FNOA 2HQGA 4KRWA 4F26A 1NBEB 3VZHA 3HFVA 2IVFB 1RSCA 2KT2A 4H54A 3ZFVA 4CDIA 4LRDA 1BGXT 1S77D 4ZLNA 5DO2A 4QWCA 2GO9A 3G86A 2EWHA 1VQ8S 3ZC4A 4DL6A 5KG3A 2FGOA 3ITHA 2UXCF 2FIUA 2AJQA 3T1YJ 4B3MF 2AU0A 1H2UX 4DFKA 3KHRA 1T9VA 2F4VF 3V4MA 3Q2SC 3LWLA 2F65A 5KFGA 3JAMY 1JJ4A 2MYFA 1RT3B 4FYWB 1RAJA 3FZ2A 1R8HA 2B4UA 3O3LA 2IBOA 3FSIA 2XEXA 5KFLA 3L7UA 1CVJA 1XN9A 4D3GA 5J2MA 4X66F 1S7HA 2DTJA 5ETRA 1G2EA 2V63A 4P2MA 1OS5A 2LXFA 4DV5F 4M5HA 4X62J 2RDDA 3CCLS 3MCSA 5GADU 2UUCF 3D54A 2OSQA 2XGPA 4O44B 4RBTA 3SCKE 1ZETA 2DEIA 1JWWA 4B3TF 1Q81T 4B9MA 2D69A 2RVJA 1AW0A 4R8UB 2NXUA 3KWMA 2X1BA 3CJKB 4QQBA 3RB3A 1PAUB 4YQWA 4F0MA 1YBTA 2ACMA 3PDNA 4BS2A 2H4YB 4Q8EA 3GG0A 3RRKA 5BYQA 1VBYA 4RW4B 4RUBA 5ETNA 3HHNB 4TQSA 4JI2F 3D3BJ 5E3QA 1S12A 1B70B 4Y2IA 2DIUA 2ZE2A 1PJ5A 3R6LB 2GZOA 2HVEA 2H3EB 1JLQB 2C28A 3QZ7A 1UJ4A 4PQUA 2VJVA 2GCFA 1S1WA 1NLKL 1T9WA 1E6YB 2QSFA 1B7FA 1QDUB 4F0HA 4DV0J 3HSZA 4WCEQ 4F36A 3GIRA 2W2PP 4P2SA 2VG7A 4EYHB 1IBKF 2VC0A 2HHSA 3UO0A 3Q8VA 2BW2A 4IG0B 3PYDA 1XMQF 3SQGA 3KLHB 1L3TA 5GMDA 2YX4A 4OHXA 2UVUA 1UL3A 1FFGB 1WORA 5KFDA 1SUQA 3X1LB 2BV3A 3N5FA 3CUNA 1KLMB 2MGZA 2HK3A 4WFYA 3GQCA 1LW2B 3G6VA 3CB4A 2UXDJ 4NASA 3VZIA 4PXCA 2W4CA 4CLLA 2XMUA 1EARA 1ACMB 1BXNA 4P52A 2GNKA 1WOOA 4RL1A 1RJJA 4RBUA 1UEUA 3SMZA 1RE1B 2R8IA 4DSEA 2LU2A 3M8PB 3R97A 2C3MA 2EBEA 2WSCC 5EDWA 3SCJE 2CUYA 1IBMJ 2ZZMA 5KFJA 3KJQB 2VC1A 3FK4A 5KAKA 2CADA 2OPSA 3PIPQ 1R0AA 5B0DA 1WEXA 2DHXA 3ADAC 2FJEB 2JFKA 2MHNA 2B3TB 3DHXA 2QIFA 3KLIA 2Y0BB 4NLWA 5F41A 3PACA 1HBUA 2OD6A 1YBAA 4F2RA 2AZ3A 2Z56B 2CNOB 1OYEA 2VKZG 4DL3A 3VTIA 4ZN1A 4XTTA 4WKYA 2DNHA 4YOEA 3TANA 3FQKA 2QL7B 2AJ0A 3P49B 3CE8A 2X3DA 1UEVA 2VHGA 1LWEB 2CJ9A 4WZMA 4H4OA 2IDEA 3DRXA 3OQ2A 1LXJA 2DHAA 2CQ4A 1FE4A 4I6YA 2HMIA 5A0YB 3CJQA 3AFGA 3HK2A 4ZVPB 1IWAA 3AT1B 5A8RB 1IN0A 2CAJA 1U25A 2ALYB 2PSZA 5LJ5Y 2IYIA 1U1RA 3EVMA 5IT0A 4CZCA 1FJEB 3FBEA 1HW9A 5DJBA 4WBFA 2E44A 2W2MP 3M2VB 2EFQA 2HRYA 3O2IA 2OGUA 3DOMA 2WW4A 3QGGA 3D6TB 3B82A 1NSAA 1IBCB 3D1OA 2B4PA 2MMYA 4IDKB 3CJ4A 4UF4A 4X4TA 3RR7A 5CYMB 2MKYA 4CTAB 1EP4B 2YNGB 2KVIA 1F6TA 1HBOB 4G6VB 2U1AA 3T6JA 1VRQC 3D9BA 2EC2A 4A8WA 4E8UA 1YJVA 4JV2A 2HZAA 3O44A 3VAKA 3MEEB 5KFQA 1VQ7S 3UD4P 3RB4A 3RAQA 4NYOA 4ANEA 4RW7B 1QTNB 2RF2A 3EZUA 1F3FA 2DXDA 4QJVA 1UP1A 1EHWA 4Q0BA 3T6BA 4DL5A 1TL1A 2XM3A 4RR5A 4ANCA 2LCWA 1U1OA 3MTJA 4M5IA 4AL7A 4ILMA 1CJTB 2FZGB 2KZZA 3DLJA 2IMWP 5J1EB 5I42A 5CXTA 4NLPA 2RNEA 2UXDF 2Z4PA 4DCOB 2RKIB 4KR0B 3HSJA 2D3ZA 1TR0A 2J6UA 4KY3A 1T95A 2H54B 3C6TB 1D9AA 5E3PA 2G0CA 3OSPA 3D0GE 2GVZA 5LXRA 4OI1A 4V1Ak 3GU0A 2UXBJ 1DTTA 3QT6A 4O4RA 2DEJA 2MZJA 1FEHA 2MZQA 4X4VA 1K0VA 3HSDA 3E01B 3MFIA 1A9NB 5IZHA 4K4TA 4A8MP 3JS9A 3KK2A 1FKPB 5BYSA 3W63A 3GP9A 3WZ0A 1SJQA 3K89A 1X5SA 3OTEA 2HG4A 3BF4A 5EHHA 1IKXA 4QZVB 2G1DA 1R89A 4ECSA 1NNDA 1H7XA 4B08A 3QAUA 3K57A 3K2YA 1YK9A 2HWTA 3K58A 2MEWA 2F63A 3DM2B 5AT1B 2RU9A 4FYXB 2UUBF 1WACA 2MKKA 2HHPA 3MPWA 2J7WA 2FLNA 4O0NA 4UOHA 2MLXA 3HHKA 4I2PB 2HQCA 2WHOA 3DDKA 2ZM6J 1M5HA 4CH7A 3QJLA 2W25A 2FZCB 1M5PC 1WEYA 2CQHA 5LT5A 3CVKA 4LFCF 2R42A 1S1UB 3W5ZA 3LTOA 3C6UB 1WOPA 4QR0A 5GAGI 4AQYJ 3HDSA 4TN2A 2R8HA 1TMMA 4C2MA 3KKFA 1FRMA 3M1VA 2V2KA 2X51A 3CJSA 1D1UA 1FRIA 3UR0A 2CPXA 1RTHB 2AP6A 2G2ZA 1RWXB 1VFJA 4KGMA 3W65A 4TY8B 2W9CB 2VONA 1Q7YT 4LF8F 2KO1A 1F5AA 4DU8A 2R7RA 3A8JA 3RG6A 3HXMA 1NDLA 3A8EA 1HNXJ 1Q4RA 5DETA 1EKRA 4KQZA 3BKTA 4X64F 3J7A1 2E1AA 4NLTA 4ICLA 3RRHA 4CH1A 3EMTA 4O3SA 1WHYA 5A8WB 4OYAA 3C14B 2XWYA 3GFZA 4DZ6A 4IH5A 3UW1A 1REVA 4NYZA 3M8SA 1Y5NB 3OTOJ 1NU4A 4ETXA 1VQNS 2DRDA 2ZD1B 4R5PB 5JXSA 3I4HX 3PIOQ 3KLFB 4JI1F 2E7XA 1FERA 3HO1A 2ZH5A 4KTQA 2V0NA 2MKSA 5KT4A 3PJWA 2Q1LA 3QO9A 2B4VA 4GKJJ 1RK8A 2LEPA 3TJAA 2F4FA 1WI6A 4U7UK 4QWAA 1KN6A 3BGRA 2QT7A 5D4NA 1CS4B 4X4SA 2C3PA 4KHPF 2JC0A 3KLVA 3QRRA 2GQCA 3AOCA 2FLOA 3Q8UA 3VAGA 3A13A 2HK2A 2DNOA 5F0WA 4I2QA 1P1TA 4B3RJ 1KDNA 2V4RA 1SVDA 4F4YA 3HX9A 1X9MA 4EBCA 3GJQB 1YX2A 1Y5LB 5DQIA 2V50A 1NCLA 1RBAA 5LM7E 3KLGB 2Y3YA 3CCRS 2CDRB 3G6ES 2DNQA 2B4OA 2R4FA 1NJIT 2HVHA 1S1XB 3O6QA 5DZ7A 2Y8WA 3FVYA 4FXWA 4X2BA 4DLGA 4LJMA 1N6QA 1U0HB 3ZTPA 3GV5B 1GK8A 3DFEA 1VQ6S 4IOAQ 3MD3A 3SBMA 4CLYA 1S57A 1O6XA 1J5EJ 4USHA 3DI6A 1KFSA 1U26A 1S7IA 1N34F 4CLTA 1QUPA 5HJXA 4ZJOA 1BY9A 2YKPA 4MFBB 1F5BA 2VDIA 1ZOTA 2MB0B 3D66A 2OPRB 1K44A 2XS7A 1UPMB 2R7QA 3Q8YA 4KE5A 2ZH4A 2M88A 1IR1A 1HNXF 2LMIA 4PABA 3LW5C 1FDAA 4Q7AA 2JFDA 4HT7A 8RUCA 3M30B 3AD9C 5HATA 4C3LA 4I6WA 4FF4A 1OYDA 3THVA 3JYTA 3TUIC 5KFKA 2E7WA 1C2PA 4UUXA 4RU2A 3BGUA 2ZOFA 4EBDA 2CDQA 4Y00A 2EFPA 1NK7A 4LRCA 4X4UA 3JSMA 2E7VA 1JJ2R 1HBMB 3Q89A 2NSCA 2DNPA 1Z2LA 2JNJA 3R9LA 1QD1A 5F3TA 1FTCA 2DH7A 4ZLLA 4NZ7A 4H4KA 3VV2B 1OY9A 3I96A 3R1LA 4QWBA 1O5JA 1S99A 3HHLA 4DHVA 1DARA 5KFMA 3PW7A 2CWKA 1EAYC 2Z58B 4IFYA 5F8GA 3SSSA 3K5PA 2R8JA 6FDRA 2HS0A 3KHLA 2QRRA 2XSJB 4ZPVR 2FVPA 1JQGA 3P8BB 5KT2A 3SSQA 1TFYA 2F9JA 2XMJA 4JI8J 3KLEA 4W92B 4U8YA 2GW8A 2DPIA 2AEJA 1U47A 2N7YA 4X4PA 4LSNB 1SQGA 1LNQA 2NXNA 4OL8A 2AYBA 2DR5A 5AE2A 3CPWR 4Y65A 4QW8A 4EZ9A 4N77A 1HBNA 8AT1B 4LF9J 2MQLA 3KUHA 4OI0A 1JJHA 2N4DA 3QQCD 3V81B 1DAXA 4XPEA 2J9DE 4CP5A 3EDRB 1MROA 1RTIB 5A6WA 1RT6A 4WYWA 4FKXA 3P5TL 5I3QA 3V6HA 2Z2YB 2DGOA 4GO7X 1RHRB 1F9HA 3DLBA 1GAOA 2W7AA 1WOSA 3L3CA 2A2DA 1U1MA 3BSNA 3R5GA 3MPYA 2IIHA 2GC8A 2KRRA 2LLZA 1KQSR 4IQXA 3MMCA 1GMVA 2QG9B 2I5JA 4JBCA 1LKZA 1FO1A 2QTWA 2BR0A 1X5PA 1O0PA 2AT1B 4GVBA 3K0JA 2UV8A 4WE1B 3S8SA 4FN5A 1JXLA 4U6PA 4K2JA 2DRAA 1B99A 1T3NA 4NLQA 1WTFA 2JVRA 4U67Q 1WNEA 1RT5B 4RZRA 1TKXB 4LSLA 1NK5A 2NSBA 1WC3A 5FJ4A 2AKWB 2E1CA 4YDXA 3IM9A 3JSBA 1B3TA 1PC4A 5H9FJ 4USKA 4PZVA 3SDEA 3DMJB 4NXMF 4K2XA 1VRUA 1REGX 5T41A 3BBFA 3HJVA 3IS9B 4LRBA 1IKVB 2C42A 3RUBL 1N32F 4AL5A 2KZMA 1XTZA 1NDPA 2HGNA 1WF1A 1FD8A 1R7IA 1DTQB 3CJ8A 3X3UA 4K7QA 1OJ4A 3RBXA 2XHCA 1QLNA 4OYWA 3MGJA 2H48B 2KI2A 4RNHA 1FWLA 3MWBA 2IA6A 5D0GA 2K2PA 5HLFA 3T3FA 1W25A 2FPHX 5A8KB 3GR0A 2FB0A 2BXJA 3NWRA 3BYRA 1S1TA 1PJ6A 4WU2A 4HACB 2BJ9A 3BSCA 1RT3A 4OZ3A 5D3GB 2QE5A 2M5YA 4KHRA 1XEZA 2OEMA 2W9BA 1SPBP 5ETPA 3NS7B 3TA0A 3UWTA 3M9MB 3MECA 3FMWA 2VFSA 2OD4A 1JXEA 3BDEA 3JQKA 1LFWA 3BQ1A 5D0HA 5D0EA 1GTEA 4O3RA 4ZHRB 3VGUA 4A8YA 2V68A 4USJC 3D6MB 2UVRA 4LR7A 4URQU 3C8YA 5A76A 4NPOA 3T41A 1NK4A 2NS1B 2DCUB 2WVEA 2L9NA 5LSRA 5KFYA 3M6VA 2E1RA 1XJWB 1TKZB 4RW4A 1PSDA 3MMJA 2UP1A 1DY3A 3UR3C 3PYEA 5JJBA 3PO5A 3OFFA 1OY8A 2CZVC 3PEJA 1ZH5A 1NK9A 2B6AB 3KK3B 3DOLB 2CZ9A 3MEGB 5FDLB 4KFBB 3VAJA 4CO5A 1A6LA 4AE5A 5K14A 2DXEA 1ROFA 4W98A 4WFZA 3PZPA 2EG1A 4LRFA 4RW9B 1QTMA 1MU2A 2ZVIA 3PJ9A 2KTQA 4P73A 3I56S 4JOUA 3IRWP 3PEHA 4K5SA 2VQEJ 1FDNA 2RD5C 4F2SA 4G1PA 3KYLA 1TL7A 3KLHA 1JK9B 3DRSB 3RJMB 4IOBA 2YNHB 1GXUA 2DXFA 4DU7A 5F9LA 4NLRA 5C25B 2CQDA 5C24A 4TVAB 2QLJB 4XAKA 3LO3A 1U2FA 1KLMA 4RKUC 3DRPB 1N5YA 1PYTA 1GMWD 3J80Y 1N52B 3SEOA 1IQTA 4K4UA 3GYNA 4ZPTR 4F4KA 5BR8F 2R2RA 3UCGA 4NA2A 4YB7A 4A46A 1JIHA 1S59A 1TL3B 4OX6A 2R2UA 1S76D 2ZHBA 2QA2A 1YRXA 2JLFA 3UDEA 3CJTA 4LIRA 5IV4A 4FF3A 5LMUF 2BW7A 1SBRA 4DUYJ 3RAXA 4EO8A 5KT7A 2QN6B 2VDHA 1FT8A 2AZ1A 2EG2A 4KKOA 2FLPA 4NCBA 3H4DA 3W3SA 2ILYA 2XNRA 3HPOA 4ZPBA 3L7OA 4P2XA 3DDIA 5KFSA 4D3HA 4ZVSB 3OR2B 4DJBA 3H98A 4CIOA 4K4ZA 4A8XA 4MKAA 3ISND 2C3UA 3IAM9 1IBLJ 5F3ZA 3OHAA 4QYRA 3KMQA 2DH8A 2FZKB 4IYQA 5A2QU 2HHXA 3H2LA 3DLKA 4ID5B 1L3VA 4JI7J 4N76A 3HF5A 3TJ9A 1RHUB 2J8AA 4DX5A 5H9EK 4LQ3A 2VG5B 3F56A 1H73A 3Q86A 4Q8FA 4DV6J 4WPAA 5HN0A 3M32B 3M2VA 1IJEB 2ZWPA 4OV6A 3TOQA 5T7LA 4LREA 4HHUA 3HVRA 2J7UA 3IO1A 3LP0B 3AY0A 1LK7A 1WG4A 4IDKA 3NP5A 3TZYA 2FJBB 4CTAA 2HNDA 2YNGA 4IOCQ 1BQNA 1U4BA 1ZA1B 2R7XA 4PG7A 3OL8A 2JHEA 3IWNC 3IRXA 4ZJLA 3UQSA 3UDVA 4RW7A 1IKYB 2ZH1A 3K5OA 4ILLA 4JI0J 4LBPA 3GMGA 2ZHAA 2ASYA 3GIJA 4WTOB 4Y34A 4KO0B 2A18A 2GMLA 2E29A 2F8HA 5DG9A 1HW8A 3M2UB 4ATNA 2OP5A 4KGXB 3BQ2A 3KXDA 2QJ3A 2K7JA 2OUGA 3IWXA 1HWLA 3POTB 2LA4A 2V6AA 3GYXB 1R6VA 2RKIA 2EFVA 2HLUA 3HVTB 1YLXA 3QBCA 1UFLA 4DR4J 3C6TA 1QAJA 2HVDA 3SV3A 3ZZZA 4DZDA 3J81j 2NYIA 4PPZA 4C9DA 3TW0A 3TWZA 4OZ0A 4B9NA 5I3UA 2VPXB 4WFNQ 5MAOA 3LP1B 4C8OA 4NLUA 2ZKTA 1FWPA 5D8HB 3PYGA 3QMQA 4A8QA 3CDBA 4JV0A 3D7SB 1RAIB 2YH1A 3VCDA 2Y1JA 4QWEA 1S79A 2RDJA 2JRSA 1U1QA 1FKPA 3NXZA 2KYXA 4B3SJ 3JXOA 1N56A 2GGPA 2GVDB 2C2RA 3NGRA 3IGNA 3A3PB 1I6JA 3I0SA 4PRFA 2YWWA 4DPWA 1K73T 3BV8A 3DDNA 3AAWB 2FYXA 4DL2A 1YSJA 2KT5A 3QJPA 2CJBA 2J0SD 2YKOA 3IBWA 2P9GA 1HMVA 1SQFA 4M5KA 1RWNB 2BABA 1S5ZA 3CSKA 2MQQA 1WJ9A 3I9V9 4X84A 4M5JA 4XO0A 4KB7A 1UZDA 2H5EA 1M5OC 4ZVUB 3MR7A 2B7BB 2CKWA 1X0PA 1VOMA 2JEJA 4M5DA 4O3PA 1AZSB 2WB4A 1BQMA 4BHQA 2LQ9A 1I51B 4ECQA 3BB5A 3BO3A 1YJNS 4OHVA 1FK9B 3I5CA 3QFWA 1KKHA 2W9CA 5AXLA 1HNVB 1Q5VA 2NUHA 2L3MA 4NWBA 1NZ8A 4C8ZA 1RT2A 1KQGB 4ZVQB 3S7RA 4JI0F 4UQTA 4OZJA 4O0IA 2V2QA 4C0OC 3EVWA 4KGKA 3NGKA 2CFXA 3CNQP 4DUZF 1UW4A 3OR1A 3QGIA 4UUWA 1KSPA 2GIRA 3W2WA 3OW2R 5K8MA 4NL5A 2G9OA 3G8QA 3OT9A 1N5QA 2XYPB 4OLPA 5KFBA 5AXNA 4IFVB 1X8DA 2HLTA 2QYCA 4WFBQ 2P9EA 1RWVB 4PXBA 4NMXA 1RWPB 4R5PA 1UVMA 4DR4F 2ZC3A 1VQYA 2DNRA 2P6SA 5HI7A 5B0AA 3QRPA 1HI8A 1LW0A 5F8NA 1P1LA 3LH2S 4DXLA 2CWXA 2GMHA 2C2MB 2OI2A 4FVCA 3VAHA 3BH6B 2ZBQA 2XO7A 5CD4H 2ZOGA 2R2TA 2CJAA 1V9OA 3UCZP 4QWDA 2MKIA 3NAIA 2YQ0A 1U8WA 3DGPA 2BQUA 1MW7A 2R3VA 1CS4A 5LSLA 2VQFF 3C16B 3K5NA 1D9DA 5IM0B 4HL9A 1SJRA 1FHTA 4MKBA 1CQMA 3QSIA 4AXIA 5KFNA 2EW9A 2MKHA 5IV3A 1TKTA 4ID8A 2KXHA 1IM6A 3GYGA 4M95A 4K59A 3NKYA 1IR2A 2C3OA 3CXCR 4EI2A 3FMBA 1GTHA 1PCAA 5D15A 5EUHA 4C7QA 3ENWA 3ZZPA 4RNOA 5HQ8A 3KOAA 4B17A 1D3WA 3UD5A 1S1XA 3NY0A 2OPQA 2YKNA 3D1QA 3LGMA 1U6FA 3J7Z5 3CEDA 4NX9A 5GAHI 2FGCA 1KVIA 3EGZA 4PWWA 4J9SA 2M8HA 1WG1A 5KG5A 3TYTA 2YPZA 4DBQA 3M6UA 2BE2B 4K4VA 2A1BA 4ED8A 4C4WA 2MQOA 1TK0A 4ED6A 2W2QP 4WU3A 2HGLA 3NMAA 5KFVA 3TNVA 3TZWA 1SL0A 2M4MA 1RHMB 2RQ4A 2D9PA 3FC9A 1S9GA 2UVVA 2BUNA 2ZZTA 1HNWF 2MQPA 5CCLA 4DG1B 2V8HA 4C0HA 2KM8B 4GC7A 1NH7A 4PWDB 2LXUA 3FRYA 4ELTA 4RLEA 2X1AA 2B9EA 3G82B 5HMYA 1PGZA 2YNIB 2N82B 1Q0NA 4MK9A 4RW6A 3PTWA 3MMAA 2DR9A 2LECA 4OZ2A 2KH9A 4LVOP 1SV5B 1F1BB 1VMBA 2QYGA 3OSNA 5GAHU 4DV4J 3MM6A 1VYAA 2I38A 2FLLA 3AJ2A 2XHWA 4L72B 1N0VC 3M9OB 1DBDA 2RAQA 1CQNA 3SQOP 3BKUA 3KNAA 4ELVA 2V94A 2KFZA 1HBMA 3P45B 1HNIA 1M1GA 2VG6B 2EBGA 4F50A 4ECVA 5E33A 2GIQA 3QWPA 2IRUA 2AJ1A 2CNLB 3D67A 4I6AA 1NDCA 4ZP8A 4HDHA 3BPSP 2ADCA 3M6XA 4P2FA 4YUDA 3RYLA 2WBRA 2LQ8A 5F8LA 1T03B 1S6UA 4XDCA 2BOAA 2EPIA 2YWGA 9ATCB 2GQ2A 2HS3A 2PD1A 2XG8A 1NSKL 1WG5A 1WWHA 3QT8A 4USUA 2D74B 4F3MA 4QR1A 1AFJA 3GR1A 3JTOA 3SYZA 4ZP6A 4F3OA 2AJ4A 3H0PA 1UWBA 3QSYB 2ZOMA 1S97A 2ZVSA 2YWHA 2FD2A 4M1KA 3PRBA 1S6QB 4OYXA 2KN4A 3R8YA 4ZJQA 4CH0S 4ZVOB 2PMWA 4DR6J 1ZTWA 3CTRA 1V3SA 3FDSA 3PR4A 2DNMA 4X65J 5EWFA 1FDDA 3V81A 2C2OB 1S49A 4KC5A 1Q95G 4B9TA 3DXBA 3JQMA 2H5IB 1FWKA 1H2VZ 2R8GA 2KU7A 1ZZFA 4OMFG 4BC9A 3TEGA 2N4CA 2AYMA 3P96A 3TP2A 3GE9A 2HFSA 1S1VA 5IFMA 2MZ1A 1CJUB 2DNYA 2ZFHA 1JLCA 1WDDA 4DR1F 4LBHA 3GSIA 3NBPA 4ZPDA 3L9ZA 1AROP 1IQZA 3SV4A 4P71A 3CC4S 1UFKA 3UVJA 1VQ4S 1Q82T 1MN7A 1NJZA 3RBDA 3TUJC 5DLGA 2MJNA 4KV8B 2IJFA 1WD6A 3KFWX 2N3LA 1S4FA 2OAUA 1RT5A 4JI5F 3TAMA 3RB0A 2HNYA 3BSOA 4HI2A 1HWKA 1WHVA 3CDEA 4G1QA 4FS1A 4J9QA 2O01C 3IS9A 4PUOB 5HP1B 2WAQD 4F02A 4ED7A 2GHWA 2IPOB 1S6PA 3VVUA 4PQAA 4S0MA 1HPZB 2Y9HA 2CQPA 3J7YI 4KH0B 1RGVA 1RBOB 2JH3A 2R8KA 1MLAA 3FCWA 2O1PA 3FSXA 3CMES 4Q44A 4NXNJ 3H2VE 4TU8A 1Q8LA 1M90T 3DKDA 2XS5A 1IM4A 5DS7A 1NKCA 2D41A 1U45A 3GJRB 1RT7B 3FEYB 3G6YA 3IBFB 2E5LJ 5HMWA 3R5CA 1HD0A 3HSGA 4F04B 1RISA 4P74A 3LANA 1DJ0A 3G96A 5L1IA 2MY8A 2BRKA 3M9NB 3BBCA 2BJ8A 4HTJA 4WK1A 1RQ0A 1NHKL 2BQ3A 1ZPVA 3R7SB 2Y1RI 2C2KB 4TU7A 4V19J 1QJHA 1C4CA 4QIGA 4JI3F 4I68A 4H4MB 5G0RA 3NG8A
chains in the Genus database with same CATH topology
4O4GB 1QUPA 1TL1B 2LVWA 1TL5A 1Q7LB 3T1HF 2HVZA 3BSAA 3MM5A 3GB0A 1BY9A 5E0OA 1QSYA 1VLYA 2HHUA 1OWXA 5MLCV 4KIAA 4LIWA 2JLGA 2FJWA 1S6OA 2OLWA 2YKPA 3DLKB 4MFBB 1P8GA 4YHHF 3TI0A 1URNA 1FTRA 1F5BA 3MXHP 1HHTP 1FEEA 3B4MA 1U49A 1RT4B 4YR2A 1ZOTA 4CO3A 1G6BA 3TX8A 2OMOA 3G8SA 2YKAA 2RS8A 2MB0B 4E0DA 3Q2TC 1L5UA 2L9DA 5D6GA 2WSEC 2JWNA 4CNYA 1QAYA 2CJQA 2YWEA 2OPRB 3CWJA 2RJZA 3DHWC 3OPKA 2QFJA 3PX6A 2J6SA 4B3SF 2XS7A 2R7QA 2X1FA 1FK9A 4Y2KA 5B7WA 4TY9A 4BDPA 1HI0P 2PEHA 1LW2A 2PC6A 4KE5A 2ZH4A 4JYAF 2D3OR 5T7LB 2LQ5A 1QVGR 2M88A 3OL6A 2BRLA 3SZ2A 2FVRA 1Z2ZA 4C11A 2HFZA 4I4BA 3J7ZT 4ED3A 3IAS9 1T3OA 1MMNA 4GO5X 1TKZA 2CPYA 4J9LA 5E7OB 3CIZA 2RQKA 3NNAA 4HTIA 1U6BA 1JKHA 1HNXF 1HNVA 2LMIA 3T1AA 1JLBA 4X4NA 3LW5C 3CO9A 1FDAA 2W24A 1Q1KA 4HH0A 4Q7AA 3KNGA 1KQFB 1QUVA 1SJFA 2Q43A 4ZDNA 2JFDA 1W2IA 3BN4A 3M8PA 2HWHA 3OXGA 2B6AA 4PR6A 4HT7A 5F8HA 3M30B 1YJRA 1QAIA 5F8MA 3CGIA 4M63A 1YHQS 5KG4A 4FNHA 2HNDB 3BR8A 4Y2MA 4A47A 3K7RA 4C3LA 2ZH8A 3V6DA 4I6WA 4FF4A 4KFBA 5HBMB 5DGBA 4RUAA 1B0PA 3THVA 4YR0A 5ITHA 3JYTA 3TUIC 1BQNB 1R6YA 5KFKA 1KHWA 3Q8SB 2DGXA 2VA3A 4DQIA 1Q8BA 2VOPA 2E7WA 1C2PA 1UJ5A 3CT9A 4HHJA 4UUXA 1VQMS 1S0VA 4DV0F 2FHKA 2RSQA 2VL1A 4RU2A 3CJ5A 3BGUA 2RH3A 2ZOFA 4EBDA 2M70A 3AQPA 4IFVA 2CDQA 1P9QC 2L9WA 3OFGA 3EX7B 1YWXA 4PXEA 1LQ9A 2JC1A 4DX8H 2Y0SD 1QAXA 2IBKA 4OI6A 4Y00A 2VH7A 3IRXB 1XNRF 3MDFA 2E9ZA 2EFPA 3D28A 3TQ1A 1NK7A 4X4UA 2Q6BA 1JNZB 1W2BR 2VOOA 3JSMA 1DQ9A 1NRKA 1JJ2R 2FDNA 1Y5IB 2R7WA 2AGPA 1HBMB 3W7BA 2NSCA 1FXDA 2M0GB 2DNPA 1Z2LA 1OSDA 5KFRA 4DN0A 4NYPA 5E41A 5F3TA 1CEZA 1FTCA 2DH7A 3DRRA 4NZ7A 5L8RC 1KFDA 1L3SA 3CJ2A 1BQXA 2KHDA 2IJNA 3CCZA 1HWUA 4H4KA 2VA2A 2O66A 3KMSA 1LWEA 2VFRA 2G4BA 3IR7B 2KG1A 3I96A 3R1LA 4LF4F 3MHYA 4QWBA 3RTVA 2NREA 1EETA 1O5JA 1RKIA 1S99A 2ZH9A 3T5LA 3ITHB 3HHLA 5J2NB 4NCAA 3I4PA 4Q45A 4G1IA 2LU1A 4DHVA 1X9WA 1DARA 2FVSA 2XMVA 2DIVA 3GIMA 5KFMA 4B9SA 2BJEA 3MMBB 2YQ3A 3MAHA 3NCPA 3PW7A 5A0YA 2HAIA 5EX3A 3OLBA 3FQLA 2JZ5A 2DGSA 4DS4A 2FHJA 4IFYA 5F8GA 5A8RA 3SSSA 1UVIA 2ZH2A 1GQEA 3QGHA 1Y3KA 3K5PA 3E8OA 1R8AA 2ZBCA 3LALA 2APOA 2R8JA 1YG0A 4ZCMA 6FDRA 3F41A 2HS0A 1QM9A 1RA7A 3KHLA 4QU7A 2QRRA 4WKRA 3UPFA 2XSJB 4ZPVR 5J2QB 5J2MB 5AE3A 4ZVEA 2FVPA 1FNMA 3LPYA 2XY7A 1Q79A 2DNKA 2DT9A 3M2RA 5B0FA 3MAQA 2BQRA 1NKBA 5IM0A 5KT2A 3SSQA 5KFHA 1TFYA 4NCGA 4CQ1A 3TO8A 2XMJA 2F9JA 3KLEA 2J7KA 4I7FB 2V8DA 3H8YA 4W92B 4A8OA 2VFTA 4PG8A 5DGAA 2GW8A 2DPIA 3NAHA 1KHVA 1VRTB 2V8GA 5I3UB 4EBEA 4QIFA 1U47A 2N7YA 5M2RA 1FRKA 1HFEL 1IBMF 1TL3A 5THWA 3MF5A 4FPRA 2FJXA 1TP7A 4ED2A 1Q16B 4ZA1A 1IR0A 4X4PA 3DU6A 2E1MC 1N5SA 5CYJA 4OJ3A 4LSNB 3OUYA 2XLIA 1X4BA 4WZQA 5J1NA 4KAIA 4XDDA 2V5HG 2I8EA 2BA9A 4ZVHA 4X4OA 4OL8A 2HRUA 2X1GA 2AYBA 3T5KA 4BCAA 1RTJA 5GADI 4NOHA 5CYMA 2DR5A 3U1MA 3PX0A 3CMAS 1T94A 2IC3A 2KG0A 1VBXA 5AE2A 5B0GA 3CPWR 2F8EX 4Y65A 4OJGA 4ZPCA 4QW8A 4EZ9A 1KNZA 1K8AT 4N77A 1GXTA 2GJ2A 1EP4A 1AUDA 2D9OA 1TV6B 1HBNA 1HBOA 2WBMA 1VQKS 2GGPB 1RDRA 4E98A 2MQLA 5B0EA 4N47A 1TVRB 3CCMS 4OI0A 5T14A 2OTLS 1JJHA 2N4DA 3E2EA 2Q6CA 1KTQA 3V81B 5IT4A 1CG2A 2QLWA 1DAXA 4XPEA 2HVIA 1VGYA 2ZUGA 3MEEA 1SH3A 1VI7A 2J9DE 3FNNA 5KG7A 1ZYQA 1GX5A 3I0SB 2OH2A 2IYGA 2DO4A 1MROA 1OQ3A 1SH0A 1E6VB 1RTIB 2K3KA 5A6WA 1U1PA 2Z2MA 3CCES 1J5OA 1RT6A 4WYWA 2WK4A 1RTDA 2WONB 3P5TL 2BZ2A 3BS9A 3PKYA 1DRZA 2B0GA 4HDGA 5I3QA 3CDAA 2ROPA 4EO6A 2NUUG 5KFUA 3V6HA 2HQ3A 4ZLPA 5L9NA 3MUVP 2DGOA 2W4PA 4FVMA 5DG7A 4GO7X 4YEAA 4Y3CA 3T19A 3DLBA 3CCQS 1GAOA 3F73A 2CIMA 2W7AA 5KG6A 3PO4A 4FYDA 1WF2A 2V4JB 3L3CA 2A2DA 1U1MA 3WX4A 3BSNA 4EUVA 1Q86T 3NCRA 2YWFA 2QZ8A 1V3ZA 4ZPWR 1XMBA 2X3GA 3E3XA 4K50A 4PQUB 3MPYA 1S1WB 2GC8A 3VAMA 5DQHA 2KRRA 2LLZA 1HMVB 2EK6A 1KQSR 4IQXA 3MMCA 4DPOA 3M05A 3SXLA 3S1TA 2UUTA 3H4BA 4I0WA 3LF0A 2I5JA 4MK8A 2B5JA 2RB7A 2J9EA 4JBCA 5J1EA 5EWEA 2DR8A 1REVB 1LKZA 1FO1A 2RS2A 1UFWA 5EGYA 3MUTP 2BR0A 1X5PA 1RT1A 1O0PA 1OSCA 2VG7B 1F9FA 5E2QA 5GAEI 3RU0A 3CF5Q 4DSJA 2RRBA 3N6LA 3ZZUA 3M32A 4I1TA 3OVBA 1K1SA 5DQGA 3VF0B 3ZZTA 3QIPB 3MI7X 1M1KT 3K0JA 2UV8A 3G6XA 2IAJB 1P6TA 1R43A 4DG1A 4LVNP 4WE1B 5DG8A 3S8SA 5GMKa 3SQGB 3HT3A 4FN5A 1JXLA 4PWDA 4U6PA 3WC2A 2DRAA 3N9UC 4GKKF 4O3NA 2HGMA 2M8DB 3NS5A 1ZAWA 1T3NA 3MM9B 4NLQA 1WTFA 1S9FA 1HR0F 2JVRA 4M5DB 4YFUA 4WK3A 1GH8A 4ZCIA 2AF6A 2YVSA 2KXNB 4PXDA 1S0NA 4U67Q 2ZJQQ 4F8RA 4OZNA 1WNEA 1RT5B 1BQMB 4Q2LA 4RZRA 3NLCA 1X7VA 1TKXB 4LSLA 1JLAA 3NNCA 3CIMA 1NK5A 2WTFA 4FXDA 1C1BB 2YNIA 2NSBA 3QO9B 1NKEA 3BDPA 5FJ4A 5EX0A 2COLA 1SUQB 1XC9A 2E1CA 5L39A 4YDXA 3EPIA 1Y7PA 5D78A 2DISA 4FBTA 1IJFB 3IFEA 3JSBA 3EXCX 3N6NA 3MEKA 4IO1A 2WW8A 1N5TA 3ETOA 4ZCKA 4FS2A 1PC4A 5H9FJ 3G4SS 1HD1A 3BREA 1WEZA 3SDEA 2DRBA 2CPEA 3DMJB 4NXMF 1Y9OA 4K2XA 4FP9A 2WCXA 4BWJA 1VRUA 2DD8S 1NO8A 1DZ5A 5T41A 3IS9B 3MM8B 3E01A 1IKVB 2C42A 2HHHF 2NPFA 4QYZJ 1I94F 1N32F 3UDCA 4TXSA 2ATLA 4AL5A 3UFCX 4TQRA 2KZMA 1XTZA 2HGNA 2B9XA 1WF1A 4ILRA 4NLOA 4MK7A 3TARA 1N36F 2N7CA 1TFWA 1FD8A 4I67A 3JSRA 4DQQA 1R7IA 2AGQA 1DTQB 4QIWD 3X3UA 3BEGB 2UUWA 3Q0AA 4LF7F 3I5BA 1RT2B 2E5HA 2ABYA 2JJ4D 2I2YA 3I31A 4F4XA 2BVZA 5BYRA 2PN6A 4IR9A 2M3DA 1IKYA 1AXQA 2VG6A 1HQEA 1JLFA 3FEZA 4HEA9 1X4GA 2YKMA 3L09A 2KDOA 1QLNA 4PG6A 2AV5A 2XULA 5KFXA 3MGJA 4MJKA 4I2QB 3W2VB 3EGNA 3B8HA 3HMJG 2FTRA 1L3KA 4ECXA 2KI2A 1IUJA 4RNHA 2ZH6A 4DS5A 1T05A 3MWBA 2IA6A 3PXGa 3UI3A 4Y2CA 5CZVA 1H0HB 5K8OA 1U09A 2K2PA 3OR1B 3OHBA 2QV6A 5HLFA 1FJCA 3T3FA 1W25A 5SUHA 2FPHX 5A8KB 3GR0A 3W2WB 2MZRA 2FB0A 2OPSB 1B0TA 3GIIA 2OMLA 3M2UA 4J9NA 1HYSB 4LMZA 1H7WA 1NHUA 1RI7A 2NPIA 4ECWA 2ASJA 2WOMB 1P27B 3THPA 2BXJA 1HQUA 1S1TA 4WFXA 5FLXY 2XWXA 5EN1A 2IA0A 1XBWA 4BWMA 3HP6A 3OVAA 2M7SA 5KFPA 2DITA 4N5SA 3KLIB 4WU2A 3H40A 1BWEA 4DQRA 4OHZA 5A6PA 2O67A 5DM7Q 1HBUB 3R3TA 3OLAA 1UVKA 3DOKB 3VALA 2I0XA 4DLEA 1SKWA 3DM2A 2YH0A 4C8KA 3QLHB 2Z0GA 1XWLA 3HI9A 1N8RT 1SXLA 3HHEA 3POTA 3D0HE 1UVLA 3BSCA 1YJ9S 1RT3A 4TLRA 2FHOB 5GAGU 1XNQF 4I2PA 5D3GB 1LV5A 3I32A 2QE5A 4F25A 5J1PA 2M5YA 4KHRA 3P3DA 1XEZA 4OHYA 2MHEA 2W9BA 3BR9A 3TA0A 1VQLS 1FRJA 2BM1A 2XMTA 3L7PA 3UWTA 4RX6A 3M9MB 2DNLA 3K5MA 1LW0B 3IC1A 4IRCA 5AXKA 3MECA 5B0CA 4H4OB 1UKUA 3FMWA 4OZ1A 3UNGC 5GVQA 1DLOB 3M8RA 4J9RA 4ES1A 2VFSA 4Z37A 2UXBF 1C0TB 2OD4A 1S1UA 2ERRA 1N48A 3DLLQ 1C1CB 1JXEA 1MSWD 3LP2A 3BDEA 1ZPWX 3T9NA 3EPGA 1LFWA 1DFDA 3BQ1A 2DHSA 2OKQA 3C6UA 3LAKA 3GFXA 4QBUA 2HMIB 1VQOS 2NZ4A 3RBEA 4ZCLA 1GTEA 4DSFA 2XB2D 1NZAA 4O3RA 4DV4F 4ZHRB 2DBBA 4A8YA 1QE1B 1DURA 4USJC 2FJDB 3ENVA 1URRA 3G71S 2UVRA 2GJIA 1HI1A 1UA0A 1U48A 3OTDA 2XMMA 3CD6S 4KPYA 2CG4A 4N41A 2M52A 4EEYA 2HHWA 1G7CB 4DV3F 4URQU 3C8YA 1FVQA 2VFVA 3FFIA 5K8NA 4OI4A 2C2DA 4NPOA 1NK4A 1RTHA 2NS1B 4DFMA 1FJGF 4IH6A 4CNZA 4DL4A 1X5TA 2DCUB 3Q8PB 2ZHOA 2V9WA 1HA1A 1HL6A 3THTA 3I82A 2L9NA 5LSRA 4N8NA 3D0IE 5KFYA 4OI2A 2DNZA 3CD7A 4OZ5A 5KT3A 4TY8A 4GC6A 3M6VA 2ZKUA 3ZZ0A 4J37A 4C11B 1TKTB 2OPPA 2E1RA 4RU9A 4J9MA 2J9DA 1SKRA 2DNGA 2QA1A 2JX2A 1TK5A 1TKZB 1WELA 2VBWA 5H1SV 4EZ6A 4RW4A 4A8SA 1ZZNA 2J0WA 1PSDA 3MMJA 2UP1A 1T02A 4BBYA 3IXQA 4NZ0A 2VPYB 3UR3C 3K5LA 1R31A 1YJUA 1H2TZ 5JJBA 1QSSA 2UUAF 2KFNA 2XNQA 3OFFA 3PO5A 5D4PA 2CZVC 2PT0A 3PEJA 4YB6A 3U02A 1ZH5A 2F40A 1YRUA 4WIIA 1NK9A 2B6AB 5KFFA 3KK3B 1X4FA 3QYYA 4RW8A 1U1KA 2XI3A 2BM0A 3DOLB 3RRGA 2B7CB 2ZJPQ 4K4YA 2MKJA 3MEGB 5FDLB 2E9TA 4R0EA 4HI1A 4KFBB 3VAJA 4UOCA 3I5AA 4CO5A 3PY8A 1ZBTA 3M6WA 2DB1A 1A6LA 4AE5A 5K14A 5A8WA 2ZDPA 2OPQB 2K8GA 1ROFA 4WFZA 2YKNB 3N5BA 4J9OA 3PZPA 2ZC4A 4DMZA 1HARA 2ZM6F 2RQCA 3MFHA 1B64A 2OFGX 2EG1A 4LUBA 4RW9B 1QTMA 1MU2A 3IG1A 1VQPS 3PX4A 1KOOA 2KHCA 2KTQA 1VJWA 2KKHA 4NLXA 1U24A 3N0VA 2FVCA 3PHEA 3MD1A 3I56S 4JOUA 3CCSS 3IRWP 2DGTA 3PEHA 2ADBA 1TQLA 4K5SA 2HWIA 3PKMA 1U1NA 2UZAA 3I9ZA 1NK0A 1K9MT 2HHTA 1FDNA 5I4MA 1A7GE 2ZD1A 4O3OA 2I9SA 1N4LA 2RD5C 3H2UB 4OX9F 3IA0A 4G1PA 4F2SA 4Q0BB 4DSIA 1FXRA 3KYLA 4AQYF 4B9VA 2KB2A 3KLHA 3OFEA 1JLEA 4MIWA 2VV5A 1M5VC 1JK9B 3DRRB 3KLFA 3DRSB 1LXNA 2BJDA 4V19X 1JB0C 3V5RA 1RA6A 3FJ2A 3IR5B 2JEGA 1SB6A 2NQPA 2Q79A 4IOBA 3PV8A 2U2FA 4CT8A 2YNHB 1GXUA 2MZTA 1LWFA 3DYAB 3G9CA 2MSTA 2RQMA 4R25A 1T7PA 5HROA 5KG2A 5F9LA 4NLRA 5C25B 3O8WA 1ZM4A 3TAPA 3PW5A 2CQDA 3ISZA 2VFUA 1R3NA 5C24A 2BDPA 3HHLB 5E5NA 4ZVFA 1SC6A 2AW0A 4DV1F 2LKZA 3BM7A 2DVIA 1KRPA 4XAKA 2GX8A 5KFCA 3LO3A 5I42B 3PVXA 4I69A 1U2FA 3J7YU 4DR6F 3RB6A 2LDYA 1S9GB 2ZDOA 4OFZA 3MUMP 1ZM9A 4NLSA 4K0KF 3AB2B 5AJ3F 1KLMA 4NMLA 3PJXA 2FVQA 3R5AA 4RKUC 3MM7A 1PO6A 4F3QA 4OI3A 5F8IA 5KFEA 3DRPB 4X65F 2W7OA 1YJWS 2DGQA 2LYVA 3CDUA 2HFOA 1NK8A 2FUG9 1N5YA 4RNFA 4PUOA 2PIIA 5IQQA 3H5YA 1X4AA 3J80Y 1N52B 2MSSA 4FXVA 2QSWA 4Y0FA 5I3PA 3SEOA 3G8TA 1IQTA 1H6KX 2R9LA 4K4UA 3GYNA 2HNZA 3M2RB 4ZPTR 1ZTTA 1MNEA 2NLWA 3ICLA 3Q22A 1HPZA