2GQCA

Solution structure of the n-terminal domain of rhomboid intramembrane protease from p. aeruginosa
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
MSAVQVLKFPLSVDLAGFVGLLRRLNVPHRVSEESGQQVLWVPDERLAEQVRELYRRYPEGDPQATLEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rhomboid Intramembrane Protease
publication title Solution structure and dynamics of the N-terminal cytosolic domain of rhomboid intramembrane protease from Pseudomonas aeruginosa: insights into a functional role in intramembrane proteolysis.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 10
structure length 70
sequence length 70
ec nomenclature ec 3.4.21.105: Rhomboid protease.
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16733 NRho Rhomboid N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2080 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gqcA01
2GQCA
chains in the Genus database with same CATH superfamily
3TQ1A 1YRUA 4OV1A 2M0GB 3JTNA 2KG1A 2VG7B 1LNQA 4DL7A 5LM7E 3BN7A 3D7SB 5SUHA 1SIWB 5JVHQ 4ZA1A 1MN7A 3I56S 5HI7A 2LU2A 3DNCA 1IBKF 2OPSB 5L38A 1F5BA 2J6SA 4ZLPA 1VIXA 1HNIA 5DQGA 1F5AA 1WOOA 2HFVA 3MM5A 2JC1A 3GLJA 1BGXT 4HHUA 2MMYA 2OD4A 3D1QA 2E5LJ 4WIQA 3HHEA 1R8PA 1X5PA 3ZTSA 2LXUA 2UUTA 3K58A 4U7UD 4QZVB 1XMOJ 2AWZA 2VPYB 4OZ1A 2ZH2A 1EP4B 4YB6A 3X1LB 4LFBF 2PGCA 4KKOB 2CNLB 2XBPA 3I82A 2UXDF 2A2CA 1YSJA 1HI8A 3TP2A 1WI8A 4FYXB 4GKKF 2E44A 4DV2F 1LKZA 1YBUA 4WP3A 3NNCA 4GRSA 2ALZA 4ZP8A 1G6BA 1MWQA 2L41A 3R1LA 3S7RA 5LJ3Y 4NCGA 3NEKA 2DTJA 3PO4A 1O0PA 1VQ5S 2IBKA 3HHLB 4P7VA 3D1OA 2ALYB 3MECA 8AT1B 3NL0A 3TEHB 4I69A 1UA0A 4NXNJ 1FF2A 1VRUB 1FWKA 4A8KA 1IKYB 3P6YC 1V3SA 3KLGB 5K20B 2RRBA 4RW9A 2L3MA 1S1XB 1FFGB 1HBMA 3PYDA 3PXGa 5CA5A 4OYIA 2MXYA 3K5LA 1S99A 2NR0A 1HARA 2OPRA 4M94A 2BRKA 3LH2S 1Q8IA 5L1JA 3B8HA 4NI2B 5B7WA 1WC0A 3DFEA 3EGVA 1NM2A 1MROB 2KJWA 4OHVA 3OHBA 1M5SA 2UU9F 3LO3A 1L3UA 4QIGA 2Z58B 4C8KA 5DM7Q 2HHPA 3TARA 4ZOSA 3RB0A 4FYVB 2H9ZA 3U1LA 5EWGA 1Q0NA 4IO9Q 2X1AA 3JTOA 1BXNA 4JV0A 1UWBB 1A9NB 3FRYA 2BXJA 5HQMA 1OY8A 4FBTA 3NCQA 4KHPJ 3NMAA 1PYOB 4EU0A 2XMMA 3C6TA 3DM2A 3MFHA 4I2QA 4LF5J 1D3WA 2O66A 1JNRB 3OD2A 3QLHB 1WUUA 4ETXA 2VPZB 2ZBCA 4WYLA 1NB2A 4KH0B 1AB8A 2ZBRA 3JSBA 3MMBA 4IR1A 5DETA 1G7CB 3SFGA 4UZCA 1YBAA 3DU5A 2CVEA 4DR7J 4NLDA 3D0HE 2HAFA 3NP5A 1H73A 1MMNA 1TQLA 2M8DB 2E1AA 4B3OA 1ZZNA 1TL3B 1IKXA 4JYAF 1N8RT 4PQUA 2L9DA 3MZIA 4NMLA 1RT7B 2WCXA 5KFHA 2OPQB 1RHJB 1LQ9A 1Z4UA 2VFVA 3ENVA 4C11B 4NYOA 3W9HA 1PC5A 3D28A 3QSYB 3FVYA 3CJ5A 4IRDA 1UMJA 4ZPAA 3K57A 1I6JA 3ENAA 2E5IA 2KO1A 1TU0B 3OXFA 1HBNB 1VK8A 3CUNA 5B0AA 4WYWA 4DZDA 3GJSB 5LOQA 3NWRA 2VG6A 2JZ5A 2WONA 2XNQA 1QJHA 3DRSA 1TL7B 2VBZA 1UFKA 5KTQA 3AQOA 2MKYA 2QA4S 4JI4J 2Z57B 3HLUA 2RDJA 4ZVUB 4LFBJ 2HYIB 1KQGB 5FJ4A 1OPIA 1LXNA 2NCKL 4KJIA 3F0NA 3OLBA 2UXDJ 2RKIB 1N34F 4N77A 3VCDA 3DLLQ 3OL6A 1YVFA 4RNNA 2Y8WA 4L75A 2PA8D 4EK2A 2ZDPA 2DJWA 1FKPB 2DXFA 3FEYB 3OFGA 2FZGB 5HROA 3GFZA 2W8LA 3T1AA 3H5SA 3K59A 4WBFA 1Q78A 2J0WA 3M8WA 3VZIA 1IKVA 2YVSA 2Y1JA 4HYKA 3TVYA 4Q7AA 4NLSA 5EDWA 4O44B 5HK4A 4Z2XA 1KRPA 2LQ9A 1WNEA 2AD9A 4YHHF 3ZXWA 4N8NA 4QYRA 1SH0A 3GYGA 3M30A 4P52A 4CTAA 1OSDA 1JLEB 4FNIA 4G1QB 1FDBA 1ZYQA 3PW2A 1VI7A 3DLGB 3O5TB 5JVGQ 4CWBA 4EBCA 1ZAXA 1KFSA 1TKDA 4USTA 2NXUA 3CTRA 5CH7B 1R31A 2FHKA 2KZMA 3UD5A 4DQQA 3I9ZA 4H4OB 4OYXA 1NDKA 2QSWA 1NAQA 3BH7B 4DEZA 1DTTB 1N5YA 3NBPB 1MWYA 5ETMA 2XHCA 4DV5J 3HHDA 2UU9J 5HSPA 2JEJA 4A8OA 1VDHA 4DL2A 1NNDA 3BKTA 4ENOA 4LSLB 2RB7A 1PG5B 4ANDA 3M1VB 2WVCA 1F9FA 1GMWD 3MM8B 1GK8A 4DQRA 5J1NA 5F0UA 2LKZA 4QU7A 3R7BB 3RB3A 1FDAA 4M63A 4O4RA 3IS9A 2OI2A 4Y2IA 2ZBPA 2HFOA 1DLOA 4A46A 3SFUA 3KFWX 4LJMA 5L46A 4CO4A 2KU7A 5L1LA 3TI0A 4QWDA 1JJ4A 2VKRA 4M5IA 3G87A 4JI6J 2ASYA 1NU4A 5IT0A 1S1UB 2UXBF 1Q82T 2CPFA 1QAJA 4NEYA 2XYHB 3BSOA 5CQGA 1HNWJ 1CULB 4QWCA 2HEKA 3DOMB 1U49A 3QAEA 4LQ9A 2VQEJ 1S97A 4LBPA 3PYGA 1GTEA 1JWWA 1K0VA 5A76A 3W9JA 2KFNA 4EO6A 2B9EA 3E3XA 1S9GB 3FUYA 4JI2F 2W7AA 1R0BG 1RP5A 3GYXB 4R5PA 5F3TA 1Y9OA 4RZRA 3POTA 3D0IE 2IYGA 1N5SA 4L3KA 3T1HJ 1FRMA 1AUDA 2AT1B 3OUYA 3RJMB 1RT1B 4QU6A 1U7LA 1U1RA 3NG8A 1VGYA 3G82A 5A2QY 4TY8B 1KSPA 2HAIA 3QGHA 2UUBF 4B3RF 3KK3B 4AFFA 4RL1A 1AXQA 1TP7A 2M7SA 3SYZA 4C8NA 2XMVA 2GJ2A 4WZQA 1OQ6A 4RW6A 1S9FA 1RAGB 2ZOMA 4ELUA 4ILLA 3K8WA 2HMIB 5ETLA 1W2BR 4ZP7A 1IR1A 1NB7A 2V4RA 1MW7A 4CH1A 2CG4A 1LWEA 5IT4A 4DOZA 1SH3A 3PX6A 2VASA 4P6QA 3V81A 2YNGB 1S1WA 3E51A 1ZM2A 4MKAA 1R89A 2VC0A 1AROP 2WBRA 3A8KA 2BVZA 5F8GA 2GVDB 2HFSA 4IG3B 4DPWA 1SKWA 1TL1B 2ZD1B 4L76A 3A8JA 4AXIA 4ZLJA 1PYSB 4K4TA 1TUGB 3UR3C 1QY7A 2EG2A 2BABA 1IVZA 3BGUA 3BO4A 3BDPA 2HQ3A 1KOHA 1FHTA 5D4NA 1RHUB 4IOCQ 3EMTA 1RT5B 3RAQA 1C1BB 1ROFA 1XTZA 2YWHA 3KK1A 2CQGA 4PABA 1VQKS 4UUWA 5B0CA 4OHXA 4C8ZA 5FLXY 1UVIA 4PWDA 2W9CB 2AW0A 2VA3A 2KXFA 4Y2CA 2HGMA 1OS5A 3G2XA 1S1VA 1X7VA 2DNMA 1KLMA 3DRRB 4I6AA 3GILA 2QLWA 3EX7B 2RSQA 4WF9Q 2XSJA 2L08A 1VQ6S 3ULHA 1VQSA 4JI3J 1E6VA 5KG2A 3Q0AA 1HPZA 3MXHP 2D41A 3NCRA 4L74A 2RMLA 4YOEA 2BQUA 1Q79A 3U27A 2OO4A 1QUVA 2IFXA 3G6ES 4M5KA 3OXLA 1IKWA 3R7NB 2CNOB 2Q79A 3BR9A 5AE3A 2OLWA 4TLRA 2VKZG 5LL6d 2VV5A 5L1KA 2CQ2A 2ZE2B 4B9LA 1NKBA 3IRXB 2V8HA 2YX4A 2ILZA 2XCPA 1KHVA 4W92B 4Y2MA 1MU2B 3GSDA 4OZ0A 2DNPA 2DIVA 3LP1A 4ZCKA 3CO9A 3H5YA 5I42B 3HPOA 2VH7A 2D7SA 2OJ3A 1BQNA 3CIZA 1QVFR 1JKHA 4P9SA 2CVIA 2W4PA 3GV5B 4BCAA 4LRDA 1U0HA 3FCWA 2OKQA 2I38A 2YWWA 5A0YB 4IG0A 1RLCL 5I3UB 2DGXA 1OSCA 1EQ0A 1SKRA 2X7IA 4UOFA 2AP6A 2AV5A 3FCVA 4HHHA 4PG7A 1HI0P 4MK8A 3H4DA 3VZHA 4F4YA 4DV7J 2I5JB 8RUCA 4PUOA 3CGIA 5DQIA 5L9XA 3MR6A 2MQNA 4DX8H 2DNRA 2GX8A 2W8KA 2XY5A 5AJ3J 3HZGA 4RUAA 2DKOB 4PXEA 3Q86A 1GX5A 4H4KA 2R8HA 1SL1A 4UOGA 1FJGJ 1Q1KA 3D9BA 3HFKA 3KNGA 3W61A 2OIHA 4FPRA 5F9NA 1CBKA 1WC1A 1RT6A 4FXVA 1TELA 2AJ4A 4LBIA 2RQKA 4TNOA 2GGPA 2JC0A 2LQBA 1VOMA 1UJ4A 2KM8B 3HX9A 2HS3A 4ALZA 3J80U 4ZJQA 5HP1A 3FSYA 1KQKA 2VPWB 4Z37A 2KB2A 2J8AA 1S77D 3VAMA 3EWGA 4QOTA 4DV6F 2K2PA 5KFCA 4YB5A 1WEXA 1YQHA 2E29A 4UY85 4NPOA 2F8EX 2J9DA 2MLZA 3MOJB 3H90A 2E7XA 4ECXA 3LF0A 4RNHA 4IOAQ 2HSEB 3MPYA 4W4MA 1XERA 1OY9A 1Q53A 1RWOB 1VIOA 1VLOA 4LF8F 5ETOA 1TL4A 2F7VA 1J2VA 2U2FA 2M88A 2J8SA 2QFJA 3H25A 2HQCA 3G86A 3V6DA 4DR4F 4LF6J 2K8GA 3HJFA 2HFZA 2QMXA 4DL0C 1VFJA 3PCOB 1HW8A 2CNKB 4M5NA 3WX8A 2ZM6F 5HN0A 4LSNA 4B17A 2DRDA 1NRKA 1RXOB 2YKPA 1RAFB 2E9TA 4RW4A 3G4SS 4NRUA 2DNNA 3AD8C 2B5JA 2LEPA 2CJ9A 4KT0C 3T3FA 4PXCA 1WKLA 1RAOA 2V69A 2ZBQA 3ENQA 1HI1A 2N3LA 3GE9A 3UR0A 5BYRA 1HNVB 3WIUA 4E0DA 2QGFB 5KOXA 4ES3A 3T5HA 4Q2LA 5IT9U 3CCRS 5LMUJ 1S1TB 1RBAA 5ETKA 5KFVA 3FBBA 2YQ3A 3NGTA 2YNHB 1F0XA 2FHOB 4PEOA 4O3OA 3UN3A 4CDIA 4FF4A 1ITPA 4IYQA 2BR0A 2A3JA 2LMIA 2GQ2A 2Z8QA 3I87A 4Z7YA 1H74A 2V0NA 5H9EJ 4DUYJ 1WELA 4FVCA 5D4PA 4KC5A 2CQ1A 2V2ZA 4X2BA 2IJNA 5GVQA 2GO9A 3EZOA 4GC7A 4C6AA 3CCMS 5E7OB 4RBVA 2DHHA 2YQ0A 2E5HA 5FD1A 1S48A 1DZ5A 3UI3A 3FBCA 3H5XA 1RHMB 2O5DA 3N5FA 2XNRA 1NJXA 2BZ2A 3HO1A 2I9SA 2BKNA 4HR2A 3L7PA 1QTNB 5KFIA 1HNIB 3S8SA 2UXCJ 2QMWA 3K7RA 3MM5B 3T5JA 2H4YB 2R2TA 3ZTPA 3MR3A 2LEBA 3N6NA 1UVNA 4OHWA 2DHXA 2CQBA 1TFYA 3M8RA 1V9OA 4DPXA 4L6V3 1SC1B 1NDPA 4PG4A 3CMQA 2XWYA 3R97A 2FY1A 1DRZA 2LECA 3A8IA 4MIAA 1IBLF 1PJ7A 3NNHA 4LFCF 5DDRC 4IRCA 5KG1A 4DR2F 1NK8A 3DCAA 5HMXA 2DBBA 2XMWA 4USWA 3KJFB 3NMRA 3KYLA 1NK5A 4TYAA 4NCGB 2FZCB 4DV6J 4G6VB 1Z2ZA 2F63A 5DLGA 4YR3A 1U2CA 3IGVA 2IVMA 3BS9A 3MECB 2Y1IA 3MPUB 5M2UA 2NS1B 3SV3A 3KLHA 3CJKA 4J91A 4RBTA 2RHSB 3QJJA 4OJ3A 2ZNZA 4DJBA 3TA1A 4RW9B 2XHWA 1I94J 1HBMB 4JI8J 4C8LA 4J9NA 2XMAA 3EM1A 2OPRB 5E2QA 1HQEA 2VFUA 1Z1ZA 1X9MA 4F3OA 1SL0A 3KG0A 3U1NA 2C42A 1CQMA 1RQ0A 5AXMA 2FQQB 1IQTA 4PG8A 4OJHA 2HW3A 4ZPCA 2H48B 1MWZA 1KD1T 2KT5A 4OJGA 1NMEB 1L5UA 3MURP 3H42A 1EETA 2HIYA 1HQUA 4ELTA 1CJVA 1NUEA 4I6YA 4Q44A 1KWMA 3W63A 3U02A 4RU9A 3C2PA 3QPIA 2ASLA 2FYXA 2MY8A 4X64J 4C0BA 2N4DA 1TUVA 3LGHA 3J81Y 1VQOS 5HBMA 3DLKA 4KAIA 4GKJF 2IM3A 2DH9A 3IP0A 2PC6A 3GIKA 5KFXA 1B70B 1FRXA 2GMJA 1FEEA 1OPZA 2AJ0A 4RKUC 3DM2B 4OYPA 1MG7A 4LIRA 4I2QB 3LWLA 2FGCA 4QIFA 2KFZA 2YNFA 4HH0A 3TANA 2IM1A 3AOAA 4CNYA 1QAYA 3TJ8A 2R7UA 4P72A 3MMBB 5I3QA 5IQ6A 2HQFA 3BEGB 3AT1B 4CLPA 1RTHB 3UQSA 3PJWA 3IXQA 2VFSA 2AYGA 3SCJE 2PMWA 3CJ0A 4ZJLA 2W7PA 3RZAA 3N28A 4B3OB 3KLEA 4NWBA 2R8KA 1IKXB 4LR7A 1X4DA 1K1QA 4PQUB 1SH2A 2ZNYA 4RUHA 5IOLA 2N7YA 1J5EF 4NYZA 2MLXA 1TFWA 2MKJA 4WCEQ 4DU8A 1FDDA 2W7OA 1MLAA 4V19X 2AEJA 3E8OA 3CULA 2HBZB 3M8ZA 1VCTA 4QJVA 3ZTRA 1JLGA 4IKAA 3QO9A 5B0BA 2IRUA 2AZ3A 3VAKA 2VG6B 2WONB 1NJZA 1PBAA 1U8SA 2R2RA 1FNMA 1CVJA 4KTQA 3DRSB 4ED0A 1X31C 3EE3A 1HQ2A 4P2MA 3CMAS 4ECWA 5J2MA 3T9NA 1T9TA 4K4YA 3RW7A 2KFYA 4ED8A 4KKOA 3Q24A 5C25A 1QSYA 4C8MA 2GV1A 4P2FA 3I4HX 1JLCB 3BPDA 3AQPA 3V4IA 4AUKA 3OFEA 1N5QA 2W9BA 4FF1A 3R5BA 1ZM4A 2HVEA 1U4BA 4DPYA 3KJVA 2XMJA 4DV1F 3HVWA 2RS2A 5HROB 2FVPA 1H7WA 2QA2A 5GMKa 3HVRA 1IKVB 2JEFA 2WHOA 3EICA 1HHTP 2CQCA 3IM8A 2RU3A 3AB2B 2CJBA 1VISA 3BN4A 3THTA 2UUCF 4LIWA 3RYLA 3MM7A 1HHSA 3TVKA 3V6JA 3M30B 1U1LA 3IBCB 4CTAB 2M52A 1URRA 4R0JA 4HHJA 2VOPA 3CDUA 4ED6A 1FXLA 2HIQA 3IA0A 1Y3KA 2NPFA 5F8NA 2J5AA 2V9WA 2GAHC 2FD2A 3D6FB 4DCPB 4OI1A 1N5YB 2RF2A 1P1LA 3FMWA 2P6TA 4PQAA 4OLPA 1H38A 4C3LA 4EWTA 2AEMA 4UTGA 1U1NA 2OMOA 2RE1A 4DFMA 2ZFHA 1FE0A 2MZJA 2ZJQQ 1UW9A 4K8RA 2CG8A 2OEKA 4MK9A 2R7XA 4PPDA 3DLBA 4F3MA 1UVMA 3VGSA 3FFIA 3CJRA 2EFVA 2R7TA 1P8GA 1YRTA 4FPIA 5KFRA 4DFPA 1M90T 2KT2A 5E3CA 1A6LA 4J9RA 2F4VF 1ELOA 1JLFA 5IV4A 4GKJJ 3IS9B 4O3SA 2QE5A 2G0CA 1DLOB 4NZ7A 4CH7A 4CZCA 4M5JA 2PI4A 3Q22A 3L3CA 3NGSA 3L95X 3OR1A 1IQZA 4X66J 1U1MA 4ZPBA 5LMNJ 3D0GE 2W1BA 4RNOA 1HW9A 1S6PB 2J6UA 3A13A 1UVKA 2XTJP 4DFJA 2W4CA 4C8OA 3MPDA 3PM9A 3RBDA 1H7XA 5E3RA 4P74A 2J7KA 1SVDA 3QMQA 1UEUA 1C4AA 4CO2A 3OL9A 3OLAA 2MSTA 3RBEA 2XY6A 2KXHA 2CPEA 1XMQF 2JEIA 1IBMJ 1EX8A 1TL3A 3IG1A 1YZ7A 2DHAA 3TWZA 2DXDA 1R0AB 1J5EJ 4R5PB 3POTB 4WXWA 1BE4A 3H0PA 4ZN1A 1KN6A 2CWXA 2KI2A 2K3IA 4ZJOA 1YHQS 1WG4A 3G82B 3HKZD 4O4GA 3DXBA 3PW0A 4JI1F 3OTCA 3BQ1A 3H7HB 2MB0B 3PFOA 1OMSA 2DR6A 2OGUA 2LQ8A 4PXBA 1QSLA 3OV7A 3ILLA 4CLKA 5ITHA 3WC2A 2EEYA 4RW6B 1LWFA 2LU1A 4IH5A 4TXSA 1XC9A 1T95A 4KPYA 2CJYB 3W8GA 2HFNA 1LWEB 2DYAA 2IA0A 2IA6A 3DMJA 4KFBA 1RAAB 3Q8PB 3V81B 2Z2YB 1S1WB 2FJVA 1Y10A 3TZYA 1VR6A 2V2KA 1L3SA 4DV1J 2DGWA 2QL9B 2XB2D 4XTTA 4ZVOB 3LQVA 1WSVA 2ZOFA 3MCSA 2RQMA 4LF4F 3N6MA 3MM9A 4ZVSB 3NXZA 4ER8A 3MUMP 3SSSA 3I6PA 3RRHA 1WTBA 3WIVA 3NAHA 1RACB 2EK1A 4YB7A 3T19A 1WF2A 3N79A 3M4XA 1B4SA 1WEZA 3KK1B 1WC5A 1VHFA 4NA2A 2CDQA 4BWMA 2AEFA 4DUZJ 4BBYA 3ET6A 3LPEA 2F9JA 4DX5A 4WP9A 4K2JA 4B9TA 4JI0J 3BJYA 3QQCD 2OFHX 4PWDB 3TAPA 2W25A 3PX4A 5KT2A 5KFDA 4FXDA 3KUGA 4U67Q 2ZH7A 1S1VB 1HHQA 2PT0A 2YTCA 1Q8BA 1KLMB 1T9XA 2FVRA 4B9VA 2YKMA 3EJMA 4W90B 2DY9A 1HNZJ 3UCZP 2Q1LA 3PTWA 4RNMA 5CXTA 2XSJB 1V3ZA 1E6VB 1HPZB 3DI6A 2Y1RI 3DYAA 1DURA 4PWWA 2EWHA 4F36A 4R0EA 2BV3A 1LW0A 1HBOB 4IOBA 1H6KX 2B6AA 4DL6A 2ACMA 4JV5J 5F0WA 1QAXA 1R3NA 1NSAA 1IKWB 3QGGA 1Y11A 5G4DA 3Q8RB 1RTJA 3NGKA 1BQMA 2B4PA 3PR5B 2BE2A 5D6GA 5A8KA 2EPIA 5BJRA 1F60B 3JTPA 5IC4B 1DTQA 1SKSA 2I2YA 2GW8A 3HF5A 1NSKL 1KBRA 4LF7F 4J9QA 5D0RA 1U2RA 1FXDA 2L9WA 4DV3J 4FN5A 3DOMA 2JRSA 1F2HA 2F3JA 5A6WA 3NOGA 2HVDA 1WDTA 3LP1B 4X4UA 1XMQJ 3CCES 1B7FA 2D3ZA 5DRKA 1HR0F 1BLUA 1VJWA 3DLEA 1BQNB 1XIQA 1JKHB 5DG7A 1BWEA 2AHOB 1U0HB 1UW4A 1NK0A 3QWUA 1NPKA 4IG0B 4Q5VA 1OJ4A 3F56A 3UCUP 5GADI 4JI1J 1O8BA 2G13A 1NH7A 4LRFA 5DZ7A 1HD1A 3W5XA 4YS2A 1HWIA 4OV6A 5A2QU 1SXLA 4HKQA 2KHCA 1VMBA 1SBRA 3VQSA 2QEXS 4FNHA 4I7FA 1G3OA 2IRYA 3BBFA 1RT6B 3PW4A 1NDCA 1VQLS 3S1TA 5J2QA 1T9UA 4IDKA 2GGPB 3TZZA 2XZDB 4MT1A 4USKA 4G1IA 2FGOA 1R8BA 5CYJA 2AMCB 1UP1A 2YKQA 4DN9A 2LDYA 2CRLA 5HP1B 1U47A 3IM9A 5AXKA 4U96A 4LFAF 3WX4A 4QW8A 3AAWB 1WKKA 4IG3A 5HMZA 4RW7A 3TQEA 2HPUA 4N7TA 4C0OC 1I5OB 4B08A 4F8RA 2LQ5A 1DAXA 1FK9A 2FZKB 1KVJA 2WRMA 3W8PA 2KL8A 4IR9A 4A8QA 1WF0A 1RWXB 3MMCA 4C97A 1CC7A 1H3DA 3V6HA 3R6GB 2ERRA 3V6DB 1D9FA 2DPJA 1JXVA 4OFZA 2VU5A 4PWUA 4U8YA 3O8WA 5HL7Q 1REGX 4A8WA 4DU7A 2PN6A 2UUAF 1R8HA 1TR0A 3M32A 3MEDA 4LSNB 1WC4A 2HNZA 4OIXA 4USHA 3KMSA 1XNQF 3DN9A 2VG5A 2Z2LA 2JFKA 4OZ3A 5AXNA 3OVSA 2QA1A 1SJ1A 5B0GA 4RW4B 1RAJA 1RWNB 5FLXU 2ZWOA 2B5JB 3I0RA 4YY3F 1YJUA 2WB1D 2WTFA 4C2MA 1KP6A 2BKOA 3UDEA 1NSPA 4DI6A 3T1YF 3MMAA 2JH3A 4KBIA 4EEYA 4N56A 3UNGC 4K4XA 4A8XA 1N6QA 2DGOA 3LGNA 3CJ8A 4FXWA 4GVLA 1OWXA 3HSJA 4PYDA 4LF7J 2ZE2A 5KFZA 3VF0B 3AXMA 4ZVGA 3OTOF 3CB4A 3ZTQA 4NE9C 1IXKA 1OQ3A 1J5OA 1YX2A 1C0TB 3VGTA 3VHQA 5IZHA 3A8EA 1N33J 1AW0A 3JYTA 4X62F 2ZZNA 3M8YA 3UN5A 2WAQD 1WORA 3CD6S 4RU2A 3NGUA 3IWLA 2BJ9A 4IQXA 1YG0A 1YKWA 4I6WA 4RUCA 4ATNA 3M2RB 1ZA1B 2DITA 4WU2A 4QWEA 5EX0A 1F9HA 3SCKE 3KHRA 2IM2A 4FYDA 2MJUA 2HHSA 3DLJA 4DX6A 4ZPWR 3PYFA 1WD6A 3DOLA 2RU9A 1FE4A 1U25A 3AHPA 3HSZA 1YZ6A 2KDOA 2BJEA 3K5NA 2XS2A 2Z2MA 4CO5A 4AL6A 1P6TA 1F2GA 3GQCA 1RJJA 4GMKA 5F9LA 4DL4A 3GJQB 2OAUA 5LSRA 1IM4A 1S76D 2XC9A 3BGFA 1B64A 4NYPA 4ZHRA 2XSFA 1S0VA 4E2FB 1RB0A 5DO2A 2CKWA 3CCSS 4OX6A 3KUHA 1C1CA 1N36F 2IIHA 2B51A 1FFWB 3AB4B 2GAGC 3KLHB 1XN9A 3FJ2A 3W1YC 4KPCA 3HI9A 1NBEB 2HNYA 4USIA 1QE1A 2BOAA 4OZ5A 2HHHJ 4FKYA 3ETMA 1DQ9A 3GR1A 4DSJA 4CI0B 2PSZA 1VS3A 9RUBA 4K4SA 2LCWA 5DZ6A 1HQEB 3SQGA 1EAYC 4AXJA 4O3PA 5HQ8A 2DNYA 3OR2A 1RBOB 1C0UA 5C7PA 1RLDA 4LRCA 1U0SA 3K5MA 2Y0BB 2BA9A 4KSEB 1Y7PA 2HVIA 2C2DA 2J7WA 2MYFA 4J7CA 1I51B 2X3GA 1EETB 1HQUB 2XMKA 1KVIA 3GR0A 5HLFA 1OYDA 3TA2A 1Q5YA 1CJVB 4MYUA 2H4WB 1OY6A 3OSNA 3FK4A 3MCNA 2UP1A 2FHJA 2GMHA 3OVAA 1RBLA 5HBMB 3LANA 3G6VA 3MR5A 3G8TA 3IR6B 1Y4ZB 2QRRA 4KB7A 3DGPA 2I8EA 1FNXH 4AD6A 1WG5A 2YNFB 3H98A 2V8PA 3WBZA 1LFWA 4TU7A 4I67A 1U2FA 3P4UB 2GIRA 1BUXA 1UL3A 1RWKB 2M5YA 1CJUA 3M2VA 1X5SA 2AGPA 2Q6BA 5JJBA 4B3SJ 2ATCB 1D9DA 3DDNA 3MTJA 3FKBA 3LPYA 4S0MA 2B8PA 3BKFA 9ATCB 4AL7A 1SPBP 4QYZK 4MTPA 1ZOTA 2K3KA 4CNZA 3FGVA 4F0MA 3PW7A 4NASA 3KLEB 2QT7A 5LXRA 3RB4A 1EJ7L 4ZVPB 3WZ0A 4B3TF 2J9CA 4DPUA 2C2RA 1HWUA 3BR8A 3THVA 2W24A 4HDGA 1JMTA 3CJSA 4A47A 1FT8A 4EZ9A 1EZZB 2XO7A 3ISZA 5M2RA 2QYGA 2FHJD 3BV8A 1JLGB 3QO9B 2E1CA 1NO8A 1TVRA 2C3MA 5G0RA 2MDAA 1LW2A 2MEWA 5HMWA 5KFQA 3NS7B 4TVAB 2YH1A 2Q43A 4XAKA 3QAUA 2MZSA 2XWXA 4WXOA 3EGZA 1AZSA 1B99A 5J2MB 1RUSA 2VBXA 5C25B 1CJKA 1L3KA 3ZZRA 3HHKA 3KWMA 2H5JB 3V4IB 1B0VA 4I4BA 1U24A 2GNKA 3QZ7A 3W65A 4LF9F 5HJXA 2MKIA 2W9BB 2VHGA 1FKAF 2ZH9A 3TW0A 1LK5A 3BSCA 3WHIA 2MHNA 1VQ4S 5ETTA 4FZVA 1IR0A 2B8QA 2DK2A 2YKNA 3KJVB 4U6PA 1D8ZA 3BF4A 1B3TA 1RAEB 4TU8A 4CLZA 3D5MA 2C3UA 3ZZPA 3FZ2A 3N0VA 1XK8A 2HVHA 2GQQA 2LP4A 5C2CA 2RUGA 4GVBB 4ZVQB 3CT9A 2W2NP 2U1AA 5J1PA 5ADZA 3JSRA 1S0OA 1U09A 1HNXF 3R5JB 1IN0A 3MM7B 2A6MA 2F8MA 4X4VA 2BBEA 2FDNA 4K7QA 3KLVA 3AOCA 3TJAA 3J7YI 5EWFA 3VGVA 3TUIC 2FVCA 1XMBA 3PX0A 3BDEA 1S0NA 2CJAA 1BQXA 4JV1A 3CCTA 1ZZFA 5FDLA 5ETQA 2DCLA 1DFDA 2CWKA 4FF3A 4DV4F 4JI7J 2RF2B 4YR0A 2XZWA 1X5OA 4O3RA 4B3MJ 3JSMA 5HMYA 2DGSA 3T6BA 1QTMA 3AA8A 1M1HA 2WSEC 3GCWP 2OD6A 2QL7B 2ADBA 4UF4A 2D69A 4X4OA 1RCXB 1TAQA 1GAOA 3FFIB 4Q45A 4F26A 5EN1A 2JEGA 1GXUA 3ZNJ1 1B7YB 2AU0A 1K47A 1DQ8A 1YJNS 1FVSA 5J1EA 2VBWA 1JLFB 3HT0A 3K5PA 4O3QA 1HA1A 1IBCB 4U7UK 2X3DA 2FPHX 4CLTA 5HQLA 3JXOA 5KFKA 2EFOA 2L9NA 2J0XA 4QPXA 1YJ7A 3J81U 3OR1B 2ADCA 2W2OP 4OQJA 3FQKA 3GG1A 2EC2A 3UNYA 2VQFJ 2KYZA 4LRAA 1S79A 3KTQA 1F6TA 1RTHA 1VBZA 3K17A 5HVGA 3IMQJ 2YQ1A 2Y8YA 4IRKA 2YNIA 4ZKAA 5EUHA 1RGVA 2GZOA 4ECQA 4BHQA 1BD6A 5DG8A 4B9UA 4H4KC 1JQGA 3AXKA 2O1PA 4DZ6A 4F2SA 2ZZTA 1E6YA 1Z2LA 1WTFA 3DRXA 2ASJA 2H5EA 1D8YA 2WW8A 3IG1B 3MDFA 1SL2A 2KN4A 5J2PA 1PAUB 4CYUA 1FFSB 1PJ6A 3GMGA 3HULA 1SC4B 2D74B 2D9PA 4HH1A 2RRNA 4ANEA 1IBKJ 2XLKA 1VQNS 3I5BA 6AT1B 3I9V9 4C48A 2MQMA 2F5GA 3BSAA 4O4GB 1FI4A 2HRYA 5IC6B 1FO1A 2XGQA 1SQEA 1CEZA 3QIDA 1TL5A 4JUZA 5B08A 3W2WA 2DISA 1T9WA 3OL7A 1UVLA 1MMLA 1U8WA 1OIAA 1X4BA 2JOQA 5GMDA 3M9OB 1LWFB 4N41A 2DHGA 3PRVA 3FCHA 4C3MA 2C2EA 4O3NA 3O6QA 1JLCA 3AODA 4LSZB 3OVBA 4GKKJ 4DV2J 5GADU 4KHRA 4G65A 3AFGA 3ITHA 4ICLA 1GMWA 2XZTB 3CCZA 3B82A 2BJ7A 3DMJB 2ROPA 3ETOA 4KFBB 4F02A 5KG3A 4RBUA 5DGBA 3R7SB 2X51A 5KFFA 4LREA 2IM0A 2HS0A 3BZQA 3NOCA 5L9NA 3CCLS 1WEYA 4K5SA 4PZVA 2G2YA 1NKEA 3MM9B 4F0HA 3CWJA 2MLYA 3MM6A 3IO1A 3F41A 3AD7C 2XS7A 3SDEA 2QX0A 3CSKA 3OPKA 2P9EA 1V3RA 2UV8G 4ZPTR 3O2IA 2IRXA 1H72C 5CYMA 5H9EK 5DJBA 1K0TA 2ZH3A 3QBCA 2ZKTA 3V5RA 4GO7X 2E1MC 2PMZD 3QZ8A 1GNKA 2Y9HA 1XBWA 3PYEA 2GHWA 3ET6B 3JQJA 2HFUA 2EG1A 4EZ6A 2P9GA 3TO8A 3T5KA 1PGZA 3KK2B 4M5DA 2ZH4A 2DO4A 1G2EA 4J90A 3D66A 1RABB 4ED7A 4RWWA 1U1PA 2YKMB 3OQ2A 1HLWA 1ICEB 3B4DA 4DR3F 3D6TB 4J9MA 3MEGA 4OZJA 3DI6B 4WFNQ 3DYAB 5BXIA 2MGZA 3H2UB 3N01A 4J9UE 3PFEA 1LW0B 2KG0A 2V50A 2A2DA 4YMEA 2B6AB 4X4RA 2HWIA 4K59A 1RAHB 5KFUA 2HLTA 3FEXB 1IR2A 2AJ2A 4OYOA 5KAKA 4M5LA 4ES2A 5D3GA 4OI2A 1UEKA 4NLUA 1VQYA 1V5IB 1RTJB 1FJEB 4K4ZA 1BQMB 3E01A 1U1QA 1JLQA 1S6PA 2BE2B 3MR7A 5M2PA 5D4OA 4DQPA 4F4AA 5A8KB 1HKAA 1DTQB 2C3YA 1FRKA 4I2PA 2GO8A 5F8JA 1X4AA 1UA1A 1X4FA 1KOOA 4OZNA 1FEHA 2ZHBA 3GFXA 4NOHA 4DSEA 1FKOA 3O44A 4I68A 4NX9A 4C98A 3BM7A 5BYQA 3MOZA 4OI0A 2KRRA 4D3HA 3N4WA 4JYAJ 4OI6A 3DLEB 2EKNA 4R8UA 1WI6A 3ILIA 1R0AA 5L39A 1GMUA 1T0TV 4AE5A 4DPOA 3MEEA 4JI5F 4P73A 4DF4A 4FS1A 1Q8KA 2Z56B 2Y0SD 1HIYA 3OT9A 1G1XA 4OX9F 2V4QA 2EBGA 3UD4P 1U48A 4A4JA 3KNAA 1H2TZ 1KDNA 4TY9A 4OJ1A 3LW5C 1AFJA 3F44A 1P9QC 1FA0A 4WE1A 1FESA 1X9SA 2Z30B 3LTOA 3DLHA 2DY1A 2AJ1A 1YJVA 1BWVA 2WVFA 4ZPDA 3DGVA 3P5BP 3PKYA 4CT8A 5E3AA 2MZ1A 1SJ3P 1N34J 4I7FB 5BR8F 1TAUA 4H4MA 4USVA 4NLPA 4DR5F 4JB8B 2RQ4A 4F4KA 5J2QB 4IDKB 3UO0A 1M5VC 3LA0A 5DGAA 2DNLA 4QYZJ 4F67A 4CLWA 1RWUA 5IS2A 3PNIA 3HD1A 4FKXA 1WWHA 2VD3A 2R3VA 5KOWA 3SEOA 3I55S 4RW7B 2F9DA 1R0CB 2V8DA 4BC7A 1RT3A 5E0OA 1Y00A 1QSSA 3NKYA 1A7GE 3CF5Q 1FK9B 4YHHJ 4TLQA 2VB6A 3H8YA 4D3GA 4EO8A 3C16A 3ONQA 1VRQC 1ZBTA 5D0EA 4WKYA 4KGVB 3JB9k 4OHZA 1VQ7S 3HDSA 4Z7CA 1U6BA 3H2LA 3MMCB 2OELA 4CO1A 3TAMA 4Q0BA 4B9MA 2R8JA 1S6OA 1QVGR 1VC5A 4QW9A 2QC3A 2DD8S 2EI5A 3KHGA 2AX1A 4U95A 2M70A 2QLFB 1KONA 1R8CA 4FDFA 4P2SA 4CLUA 3GP9A 3D68A 3G8SA 3M32B 3MEDB 1QM9A 1S7HA 2HNZB 3AD9C 4ZP9A 2VG5B 1LWCA 4RNFA 4E98A 4ECRA 3CJ2A 4ILMA 2CQHA 2E5LF 5KFMA 1F9EB 3I0RB 1T02A 3Q2TC 1HBOA 4DSFA 1XMOF 2V8VA 4CCHA 3MMAB 4M5MA 3A1YG 4ZVTB 3IBFB 4FF2A 2QLJB 1YK9A 4JBCA 1RI7A 4YFUA 1N6QB 3OFHA 2UXBJ 3DRYA 4DBQA 1EKRA 4TQRA 2AIRB 3AJ2A 4AQYF 3OW2R 1Q95G 3G8QA 4KIAA 4DSIA 1RU2A 2JNJA 3Q8VA 2KT3A 3Q8UA 4Y65A 4DSLA 2GS8A 1VK3A 1UAWA 2BEFA 3QT5A 8ATCB 2G1HA 1N54B 3CJQA 1J5OB 3UDVA 2PMHA 3GWCA 4MH8A 2ZVSA 2HBQB 3P3DA 2Q6CA 1JLBA 3JYTB 2KVIA 4NMXA 5D77A 4J9PA 4JI2J 1S57A 2XYPB 1QUPA 2B4UA 1RYSA 4DLEA 4KV8A 3CDBA 4JI5J 2LLZA 3AJ1A 3P5TL 4KGXB 3LP2A 5D8HB 1AT1B 4A8FA 1YDLA 4Y34A 2QN6B 1YJ9S 3HHLC 1HFEL 5F41A 3TJ9A 3I31A 2GC8A 4MFBA 3RTVA 3RBZA 4QPTA 2UUBJ 4B3RJ 4NA3A 4ZMMA 1RDRA 1JX4A 1H98A 4UQTA 5L8RC 4DUTA 3DOLB 5H1SV 3US5A 1X4CA 1RE1B 2NXCA 4DXLA 1JJCB 5CZXA 2P2CB 4KGMA 4CLSA 3G9CA 4KH1B 5E41A 3O1LA 5BR8J 3QNWB 4HL9A 3MUTP 4KGZB 2JSXA 2JDJA 3FNNA 5SZTA 2K1RA 1DY3A 3MD3A 5CD4H 4NA1A 4KHPF 4BWJA 3T5LA 2WVBA 3R27A 1S49A 3BO3A 1FDNA 5F8HA 2B9WA 4LF5F 4DHVA 2DNOA 4ZHRB 2KXNB 3GIIA 4CO3A 3HM9A 1C1CB 3MCOA 2GIFA 1X8DA 2X1FA 2PO4A 1Q16B 3GFYA 4G3IA 4ERDA 3KLFA 2RUSA 4ZVEA 2WK4A 2QJ3A 2EFQA 5HATA 4DR7F 3I0SA 1VQ8S 3B6BA 2IMWP 3CJ3A 2HNYB 4V19J 1CJTA 1QE1B 2F4FA 3IC1A 3PEHA 2W01A 4HTJA 4CIOA 5B09A 1M1GA 1FVQA 2NQPA 1H2VZ 3SQGB 2YH0A 2DVIA 5KFEA 4C0HA 1PYTA 3CJ4A 3I32A 2FJWA 3IN5A 3C3LA 3K5OA 3KMQA 3EYZA 3OR2B 1C0UB 4AL5A 3ZZUA 2WVDA 3PACA 3ZC4A 1YI2S 3BGRA 3GIJA 1N5VA 4X4TA 1S4FA 5CYQA 1HBUA 3BB5A 3ILJA 1F3FA 1WF1A 2IYIA 5KFWA 5HLFB 2MQQA 1WC3A 1UFLA 2W2MP 2IC3A 3J7YU 4WWSA 2NUUG 3KJQB 2R7SA 4ZCLA 4JI4F 2D1CA 2G2ZA 2R7QA 4ZVHA 4K0KF 1FD8A 1VYAA 4F0KA 4Q43A 2VDHA 1WHXA 2LEAA 3DGPB 5ETNA 2FLPA 3C8YA 1R8AA 2JLGA 3UDCA 2VJUA 4ZIWA 2JVRA 3R9LA 2LA4A 2BQ3A 4AQYJ 4LR9A 1GEHA 1KKHA 4I56A 1CJUB 3M2VB 4QIWD 4ZK7M 1KEKA 1EARA 4HTIA 5KFLA 2HS4A 2XI3A 3MTKA 1RKIA 2X1BA 1C0TA 3KJNB 1T9VA 3VALA 2AGQA 2G1DA 5JUMA 4EYHB 1SUQA 2CQ0A 4KR0B 2J76E 3TX0A 1RWWB 5KT3A 1O5JA 4RPFA 3PHEA 1JXEA 3T9ZA 4A8YA 3SCLE 2E7VA 2AF6A 3RBXA 1ZM9A 2M3DA 2FJAB 3M2RA 1TK8A 3VAGA 3DHWC 3ZZTA 3MAAA 4I0WA 2GHVC 3TZWA 3CCWA 2DH8A 1D9AA 1UZDA 5MLCV 4PR6A 1F3VA 4DV5F 2KJVA 3SZ2A 1LK7A 1TVRB 1CSJA 5G0RB 3EVWA 5JMNA 1LW2B 2DR9A 1BHNA 1TMJA 4UW2A 4LBHA 2RS8A 4NLXA 3VV2B 4J9KA 2GJIA 3C6UA 2RILA 1AZSB 5EWEA 4YQWA 4OLOA 4L3NA 1K9MT 1CJKB 3K89A 3LOUA 3UE2A 1RTDB 1Y3JA 2JHEA 4EMDA 1B0TA 2HK2A 3R2CJ 2CZVC 2FJBB 3EGNA 3HCXA 2J9EA 1HWJA 1GH8A 4NLRA 2XM3A 2JLEA 2V8GA 1S6QA 2YKNB 3VAIA 5F8MA 4C7QA 5C24A 2FJDB 4KO0A 2I6WA 4JI6F 3P8BB 1P9YA 4ECVA 4UQGA 2ZEJA 4F4WA 4ANCA 4WTOB 2ZH8A 3T6JA 2BOPA 2B3TB 4MMOA 2PE8A 7FD1A 1HNWF 2EW9A 2GIQA 5E33A 4CM0A 2VQEF 4LF8J 4TYBA 4CLYA 3G6YA 2POKA 2OPPA 1X4EA 4DR4J 2GVZA 2BM0A 4EYIB 5ETRA 2A10A 4DLGA 3Q2SC 5IM0A 1FTRA 5FDLB 1HWKA 2JX2A 5HO4A 4Y6IA 3B78A 3T1HF 5GAGI 2HHQA 2ZM6J 2IVFB 2QYCA 1APSA 4DX7A 3BGLA 3JSYA 3BYRA 2HZVA 4CO0A 3PRBA 3JSMB 2NPIA 4F04B 3V2UC 3E2EA 3UW1A 2RVJA 5K14A 2NYIA 2H1YA 4OI3A 1P1TA 4X84A 1U45A 3H59A 1XR6A 1UFWA 4ELVA 4URQU 5RUBA 1A0OB 1NK9A 1S10A 5J1EB 1T8EA 4LMZA 3D1HA 4K0KJ 2WBMA 3PJXA 4WKRA 3CJTA 2MTLA 2YBVA 3MAHA 4B9SA 2HHWA 1SKUB 2FLNA 2VZ9A 2DRAA 1R6VA 3CDEA 6FDRA 2CPJA 5H9FJ 3BSNA 3GTYX 3IAM9 2FUG9 3D3CJ 2DNQA 3LAKA 3O3LA 4OX8A 2OUGA 3C15A 3C19A 1UCNA 3QIPA 2I0XA 1TUWA 2YNIB 3ZZ0A 3L4BC 2HK3A 2OHDA 2ZBIA 3KDOA 2RNEA 3DU6A 2C2KB 1E6YB 2BANA 3C46A 2BE9B 5J2PB 3V4MA 4OX7A 4CYUB 4ZIVA 1CPZA 3QGPA 2ZUAA 1KQSR 2GHPA 3RB6A 4QIEA 1PJ5A 1S9EA 3FEZA 3CPWR 1GMVA 3HK2A 1EQMA 3M05A 1WOSA 2BJDA 4M1KA 2VF3A 2HHXA 3PZPA 1SC3B 1HD0A 1S5ZA 5KG6A 3W2WB 4DV0F 1R43A 1X4HA 1ZPVA 3RR7A 4FP9A 3PY8A 1RA6A 2MKHA 2PEHA 3M7VA 2CYYA 4O0NA 5DLFA 3ISNC 2VOOA 3B4MA 1IBLJ 5GAHU 4E8UA 3HZEA 4LFCJ 2EK6A 2IBOA 2ZUGA 1FWLA 4JI3F 2BACA 2OSQA 4U9RA 5E3QA 2VICA 4DR2J 3FBFA 3KG4A 1DQAA 3RAXA 3ITHB 4ICLB 5IFMA 5D0HA 5GAEI 3T41A 4ZLLA 4ED2A 4ED5A 4EFAC 4PKDB 1X9WA 3M2UA 1IM6A 2CFXA 2E9ZA 2QG9B 3VQTA 1SQGA 3BBBA 2YWKA 2B9YA 3BREA 2CUYA 4NLVA 3M8QA 2NXJA 4GVBA 3MFIA 3KOAA 4K5RA 3MM6B 2EFNA 3D6HB 2FB0A 3SDEB 1AA1B 4WTYA 4IUFA 2BQRA 4IFVA 1X0FA 1JLAB 1CS4B 2K7KA 1AYEA 4QIVA 1SB6A 4QWAA 2RAQA 1U6FA 3FRZA 4I1TA 2FHMA 5CYMB 4YEAA 2R7RA 3SI8A 1EHWA 3KHLA 2H54B 3JS9A 3W2VA 4HVZA 1SC6A 3L09A 3VWSA 5DQHA 2EC0A 3GIRA 2BYCA 3DOKA 2AGOA 3ZNUA 4O23A 3JAMU 5K8MA 3IFEA 4IQMA 4BC9A 3R2DJ 3KLIA 2DO0A 2XYGB 2UVVA 4M5DB 3DKDA 2VONA 4MIWA 4EBEA 3EXCX 1JB0C 2MQ8A 4DV7F 4LVNP 3QRPA 3LP0B 4U7CA 1U1OA 1T7PA 1QD1A 2CAJA 3M6VA 5BYSA 2O01C 4J9VA 1W7WA 3MEGB 2G0JA 4KE5A 2BDPA 5AJ3F 2ZVIA 5CAAA 2MGZB 3HMJG 2UUWA 3PJ9A 2R7OA 1FJGF 2P8IA 3MPVA 4DMZA 3I96A 3CW2C 5D3GB 2HRUA 3Q8YA 3VAHA 3WC0A 3E01B 1JLQB 1S7IA 1FRIA 3J7A1 1NZ8A 4CRJA 4I2PB 5C2GA 5T14A 4J37A 3ZTOA 2I1RA 3PEJA 2OEJA 1FKOB 4OI4A 2FJEB 1KS2A 2E1PA 1VC6A 1O6XA 2OFGX 4N47A 1SJ4P 2VPXB 2WB4A 2HRTA 2FC9A 2BMBA 3Q23A 4R8UB 3ZZZA 1W26A 1RT2A 3HSGA 2IHR1 2MKCA 2CQPA 1NZAA 2HG4A 2YWGA 1NHUA 2KM8C 4YN3B 3MEEB 5LXYA 1V6HA 3H20A 5A8RA 2QLXA 4LF6F 3WDOA 4NLGA 4WK3A 4LVOP 1LOUA 1REVA 2XMTA 4URSA 4DFKA 4EGLA 3FBEA 4WE1B 2BM1A 2QFIA 4J5OA 4DV0J 3HVTA 5DDOC 3C66A 3EGWB 3W66A 2PI5A 2WZ1A 2NSBA 1QLNA 1NPRA 2YPZA 3NS5A 2UVRA 2E7WA 4PAAA 2BX6A 2O3DA 4H4MB 3UVJA 1S6UA 5B0FA 4KY3A 4P75A 5A8WA 3R5DA 2W2PP 2CPZA 4HACA 2WOMB 2C22A 1UKUA 2A0FB 2ABYA 2F8HA 3OJSA 1W2IA 2XLJA 1L3TA 2RJZA 2B4OA 5K8PA 5LMUF 5CABA 4NXMF 4FBUA 2CZ9A 4MJKA 5CD4A 1T03A 1TV6A 4ID5A 7AT1B 1IUJA 2Z0GA 3M9MB 1RZMA 1IJFB 4BDPA 4NLTA 4A8MP 3J81j 1TKTA 1Y0HA 4NLQA 1RT3B 4MK7A 4DL3A 2A18A 2E66A 3R8YA 1PKUA 5KFOA 1K1SA 1HMVA 4DUYF 1NHVA 2UUCJ 2E1RA 1KC8T 3KKFA 3D3BJ 3M8PA 3C16B 3J7Z5 5K8OA 3D67A 5AE2A 1RHKB 5DG9A 1EB0A 1N56A 4G1PA 5HAOA 3AH6A 4HT7A 1S59A 1VRTA 3TAMB 4Q0BB 1TK0A 4KGKA 4QBUA 2ZH5A 4M5HA 3DRPA 4NZ6A 3K2YA 2DH7A 4EI2A 1M1KT 5J2NB 3D2WA 4ZPVR 4FYWB 3EDRB 4YP3A 4C4WA 1XEZA 2V6AA 2R4FA 3KK2A 2C2ZB 5KT5A 3GV8B 1M0SA 3ZO7A 4USUA 2DCUB 2V4JA 3SXLA 3D4JA 4WIIA 1NSQA 2UXCF 1LWCB 1IWGA 4ECSA 1ACMB 3IAS9 3KHHA 4Y00A 1NPPA 4N76A 3GZ7A 2CPYA 2CA9A 3QJPA 2JL9A 3DXSX 4OYWA 4JV2A 5D15A 2F4VJ 2RHQB 2HBYB 2A6OA 2HNDA 4DDFA 1X0PA 3R5GA 4Q8EA 2DEJA 2R42A 3EDQB 4TU9A 2XI2A 1FX2A 1T05A 5EGYA 1GXTA 1NLKL 4YDXA 2MPUA 3A3NB 1FJ7A 5T41A 4MKVA 1T11A 3IWNC 3B54A 1XR7A 4RJVA 3PV8A 2R7VA 4DQIA 1DJ0A 4PG6A 3EUNA 1HYSA 3TNVA 3C14B 3KG1A 1VQ9S 4F7VA 1RHQB 1U1KA 2XULA 4X65F 1SCJB 2DR8A 4IO1A 1JLBB 4BS2A 2AZ1A 1C4CA 2GFFA 4UUXA 1JIHA 3EPIA 2CPXA 2ZC3A 3IR7B 1GTHA 4F25A 2G4BA 1YTYA 1PBUA 1SJQA 4B9NA 1I94F 4XO0A 4O0IA 4KV8B 4JI8F 4CP5A 3NGDA 3KUEA 2QL5B 1KFDA 1RWPB 2NREA 2VDIA 3LP2B 3RGIA 3NLCA 3PDNA 1TKXA 2HHVA 2APOA 3HXMA 4MFBB 4USMA 1Q86T 1CLFA 2DNGA 2C2OB 1KHWA 3AOBA 2K06A 2XY7A 5KFSA 1SV5A 2UV8A 4M5GA 1FRHA 1ZA2B 1LV5A 3BKUA 3GV7B 5LJ5Y 3VAJA 5KG0A 1UEVA 1ZH5A 4X64F 1TMMA 1JJ2R 3GU0A 3IWXA 4LUBA 2M9KA 1Q7LB 2K1RB 1FX4A 3L7OA 2HZCA 4IFYA 3SBMA 2HKEA 5ETSA 2PD1A 4NXMJ 5C42B 3OJUA 1RT4A 2D9OA 2D3O1 1KVKA 1GT8A 4HEA9 1UTAA 2FC8A 3PIPQ 3D6MB 4F2RA 1T9YA 3L7UA 2XCAA 1Y5NB 4LF4J 2CPHA 4KYZA 4OZ2A 4YR2A 1YRXA 3OSPA 4ZVFA 3PHTA 2NZCA 1XNRF 1N4LA 3KLFB 5KFTA 1PIEA 3HKWA 2DIUA 3RR8A 3I0SB 2HURA 3QT7A 1CJTB 2JVOA 4ECZA 2BE7D 4J9LA 3R6LB 2Z2ZA 2V94A 4Q2MA 2HBRB 2IAJA 3FDSA 3TVZA 5EHHA 3MMJA 1RA7A 3K0JA 3G71S 2MQOA 4KRWA 3M8SA 1DBDA 2GJFA 1BY9A 3CD7A 2J9DE 1RTZA 4CLLA 3BGRB 1UJ6A 1RADB 2BJ1A 1RTIA 1UZHA 2ZDOA 5CYQB 1UJ5A 1HBUB 1AFIA 3OHAA 4H54A 3U7JA 1VBKA 3Q83A 1K8AT 2IC3B 3BBCA 1WC6A 4UT4A 3J7AN 2LQJA 4LF1A 5T7LA 5IWAF 4GC6A 3GCXP 2HQGA 3FZBA 1NCLA 2EFPA 4ZS6A 5K9FA 4NLYA 5GAGU 5DDPC 1Q8LA 2LXFA 1U26A 3EZ5A 2J7UA 1ZAVA 7FDRA 1NJIT 1U6ZA 2WW4A 3QRRA 3QGIA 1HL6A 5D0GA 2ATLA 1IWAA 1M5HA 3OTDA 4DCJB 1YJWS 3TOQA 3CDAA 3MD1A 3L9ZA 4OYAA 2HQDA 3Q89A 2FVSA 3RAMA 2XLIA 3PKMA 2Q3PA 1TK5A 3ADAC 3GIMA 2EBEA 3MWBA 5KG5A 4X65J 1CG2A 1HR0J 4ZCMA 1SUQB 4DG1A 2RD5C 3ILOA 2PIIA 2HLUA 2ROEA 4TQSA 2GA7A 4DF8A 3WQPA 3AY0A 2LVWA 1LFPA 2GMLA 3UD3P 3RG6A 1K73T 2B0GA 2B9XA 4AT1B 3GONA 5AT1B 3MAAB 1FRJA 2P6SA 4DPTA 4JOUA 2IDLA 4WJBA 3I5CA 4RLEA 3W3SA 2YWEA 1ZAWA 5HVFA 2UVWA 2V2QA 3NS6A 4NRTA 3TUZC 2ZHAA 1ZETA 2CIMA 2FIUA 2HQIA 1WG1A 4C3KA 5JXSA 2XEXA 4PCQA 3C6UB 3LWMA 3DC2A 4L72B 4RW8A 1X5TA 1LEOA 1I1GA 1R27B 1VJQA 2XQCA 2DGQA 1FRLA 2QA4G 1ZTTA 2QMUB 2HVZA 3IRWP 2CQ3A 4OYZA 2QO3A 4IH6A 3C6TB 1KLNA 3CC7S 4LFAJ 1XJWB 1S6QB 5C24B 4KO0B 4NZ0A 5K5MA 4X66F 1AUSL 2OTLS 5LMNF 3NCPA 5EX3A 5DS7A 3ELHA 1YJTA 2QSFA 4QCLA 2K7JA 1XNRJ 2KVQE 4XPEA 1RWVB 1P27B 2PFFB 1VC0A 3NRBA 5GAEU 1TKZA 3AA9A 5FIIA 1X4GA 2OPPB 2VODA 3K8VA 2FY8A 1IBMF 1VBXA 2O67A 4MKBA 2CJKA 2GVZB 5ETPA 2VG7A 4Y2AA 3QJLA 1MNEA 2CPIA 2UUAJ 5IM0B 5KFYA 1NHKL 1UETA 3QSIA 2OPSA 3HJVA 3VAFA 1XNQJ 3W5ZA 5KFBA 3RRGA 5HJYA 1FWPA 4MKYA 4WK1A 4DCOB 5LT5A 2PFDA 2ACYA 5IXUA 3LUYA 5K14B 4DR6F 4WFZA 2G9OA 4CH0S 3GJRB 3KXDA 1UPPA 3SIPB 1H0HB 2G2OA 4DL5A 2ROGA 3R5CA 1EIYB 4YY3J 3QFHA 5IWAJ 2ZJPQ 2F40A 3JQKA 4F4ZA 2CDRB 2AYEA 3UPFA 3T1YJ 3ZZOA 1EP4A 3IGNA 1YITS 2NLWA 2IJFA 3BGOP 4DS5A 4JP8A 2C2MB 4ED3A 1KTQA 3QT8A 1M5PC 2QIFA 3UFCX 2W2QP 2Z4PA 3N9UC 4ZVRB 3GB0A 2ZOGA 1CC8A 3OTOJ 4NCAA 3HHLA 5U47A 3ICLA 3W5YA 3ZZYA 2N82B 4V1Ak 3C15B 4P71A 3QIPB 3W64A 3BO2A 2B7BB 5DDQC 2F1FA 3G96A 1DHMA 4OYBA 2VC1A 1VRUA 4Q8FA 2GCFA 1S12A 3W9IA 2B43A 2YXLA 4X62J 4X4SA 3UWTA 1MN9A 1IKYA 3SSRA 1L3VA 3N5BA 4FS2A 4FYYB 3KLGA 2BANB 2V34A 1H2UX 5HVHA 1S1XA 3CE8A 4RWXA 2LDIA 2ZITA 3RUBL 5KT4A 1BC6A 2B7CB 3U1MA 2MKKA 3MF5A 1Y5LB 3P49B 2VFRA 1KTVA 4NI2A 3LAMA 3HFZB 2IDEA 3PG9A 1VBYA 4DUZF 1PC4A 1KQFB 5LSLA 5CHCB 5F8LA 2P9CA 1OYEA 1MROA 1S9EB 1RWMB 2CADA 3MGJA 1RU1A 2MHEA 4P2XA 4JI0F 3BYPA 2BUNA 1S4EA 2C2NA 2JWNA 1X60A 2QTWA 2V9KA 2V2VA 1KNZA 1LXJA 1NXIA 2R8GA 2G0IA 1SIZA 3RW6A 2M4MA 5B0DA 2AYBA 1RYRA 4EUVA 2IMOA 1HNZF 1UPMB 5I4MA 1NJWA 1YBTA 4BLGA 2H65B 1UWBA 1RTDA 5CZVA 2LA6A 3MCMA 2YKAA 1M5OC 4ED1A 1FNOA 4WP8A 2KRBA 3HHLD 2D3UA 4JV5F 1BMQB 3QLHA 3M2UB 3GJTB 4ZN3A 5IV3A 3HVAA 3PVXA 2BJ3A 4WU3A 1N36J 4ZDNA 5KFGA 4CM2A 2MKSA 3IBWA 3MHYA 3R1HA 3R5AA 1RSCA 3M8QB 2VL1A 3THPA 1FERA 1FXRA 3VVUA 1W25A 2OTJS 4DV3F 2HZAA 3QATA 2N4CA 2YY3A 2X1GA 5KFJA 4IFVB 3SQOP 4QR1A 4NLWA 3JAMY 1NK4A 4HDHA 1WSRA 2CXEA 1RKJA 2N3OA 1QDUB 1RT7A 2C28A 2OPQA 4RX6A 1TTHB 3CXCR 1NJYA 4C11A 3SSQA 3W60A 3W2VB 5A6PA 4PXDA 3DOKB 3J7ZT 2VUGA 5F3ZA 1N0VC 3OUYB 4W98A 3LGMA 1HWLA 1HBNA 3KLIB 3TYTA 2R2UA 4OYMA 1I3OB 3FC9A 2WSCC 2GQCA 3HT3A 2MQPA 4DR6J 3DHXA 1JK9B 2DB1A 4PPZA 1JXLA 1TL7A 3MUVP 4NLOA 3PRDA 3TUPA 1URNA 2EXUA 4ITSA 1YIJS 2R8IA 2DHSA 2BJ8A 1ZPWX 3MI7X 4XDDA 2PA3A 4A8SA 3QYYA 1PILA 3CCVS 4DQSA 1Q81T 2WSFC 2YX1A 2RKIA 2EFGA 2RDDA 1ZTWA 3QFWA 2AYMA 4Y3CA 3EZUA 1SJRA 2ZC4A 1UWAA 4DR1F 3P45B 3P96A 1FKPA 3SV4A 3HP6A 2R2SA 2COLA 3TA0A 5KG7A 3VR1A 4OMFG 3X3UA 1FJCA 3OTBA 4USJC 5E3PA 2M2BA 3S6EA 1G4CA 4XDCA 4O44A 4WFBQ 3QWPA 4I64A 4QR0A 2HHTA 1B0PA 3QT6A 4DWIA 1F5CA 3QRQA 3H5UA 1JLEA 4B3TJ 4G1QA 4YB1P 1S72S 5D4LA 1RT2B 3DLGA 1ULRA 5THWA 2LXIA 2VFTA 2CQDA 3PR4A 1WJ9A 5A8RB 3R3TA 3CD5A 4UY8T 2HGLA 4K4VA 4HI1A 3DDKA 3VVTA 4H4OA 1DTTA 3NY0A 5ETVA 3EXYA 3NBPA 3S01A 1EKSA 1VQMS 4GO5X 1REVB 4QWBA 3BPSP 2W4DA 2ZHOA 5GMEA 3CCUS 2XGPA 2VBYA 1N52B 2AQ4A 4LSLA 3ENWA 3OTEA 3HVTB 2OH2A 2OP5A 3M1VA 3CVKA 3EVOA 3KDNA 3MM8A 1N5TA 2FVQA 4XIUA 1FCAA 3TRGA 4LRBA 5I3PA 1TZ0A 1WACA 5KFAA 3UVJB 4LF9J 2BKPA 4K4UA 5A8WB 3F73A 2KTQA 3NNAA 4HACB 4TN2A 4NCBA 4MAKA 2BRLA 4WFYA 1O51A 1T03B 1TV6B 4ID5B 3CIMA 4PG5A 1S1UA 2ZJRQ 2DR7A 3OXGA 2HWHA 1VHIA 2Y3YA 2IVYA 4X4NA 1SI9A 2A1BA 3UDLA 1TKTB 4ZCIA 1CULA 1HMVB 1HNXJ 1NK6A 3AJDA 2EKYA 4AYBD 1JLAA 1NKCA 1CS4A 3M8PB 4NEZA 1PAEX 4A48A 3DDIA 4F50A 1VQPS 2QLBB 3A3OB 4J9SA 2Y1LB 3GPAA 1N33F 2ZH1A 3A3PB 1VRTB 4NL5A 4DN0A 1S9GA 1T94A 1PO6A 2MSSA 4ZP6A 3DRPB 2VIHA 2MJNA 3TEGA 3HFVA 4DV4J 3BQ0A 3TUJC 4B02A 1RT1A 4Y28C 2C3OA 3UCGA 5K8NA 3CC4S 2RIJA 4WZMA 2QV6A 3CC2S 2XMUA 4TY8A 3LALA 2V4JB 2LFVA 2B4VA 2DPIA 2EVZA 1VLYA 2KKHA 4PYAA 4UZBA 2Q66A 1D09B 3LP0A 3KK3A 4PUOB 1RHRB 5L1IA 5AE1A 4RR5A 3H2VE 2H51B 2HMIA 3J80Y 3RU0A 2HGNA 4K2XA 2HNDB 4U8VA 4IH7A 3CCJS 3BH6B 4TKTA 1N32F 3TAQA 1C2PA 2IY5B 1T05B 2E5JA 3FSIA 4EBDA 2YNGA 4DR1J 2SXLA 2V63A 3VGUA 4P10A 2YPYA 3CO0P 2GVDA 1Q7YT 2XO6A 3GG0A 1JNZB 1RCOB 2N7CA 3H4BA 1TL1A 1HYSB 2NXNA 2ZD1A 2NUHA 4M95A 2MZTA 2MQLA 2CJXB 2VJVA 2CJQA 1NH8A 3TR5A 1U02A 3M6UA 1S0MA 3RRKA 3UN2A 3I5AA 2W9AA 4X4PA 2CQ4A 2KYXA 3ZFVA 5E5NA 2HHHF 3MR2A 4URGA 1RT5A 1C1BA 5GAHI 2F65A 4OL8A 4F4XA 2DR5A 1T3OA 3GYNA 4ID8A 1MSWD 2WVEA 2VA2A 2W9CA 1TKXB 4L73A 1SQFA 2OEMA 2V67A 2RT3A 4HI2A 4C8YA 4N5SA 3DRRA 4RUBA 3PO5A 5IT9Y 1SV5B 3A12A 3CNQP 4C9DA 2FLOA 5D78A 2J0SD 2MZQA 3M9NB 3BQ2A 4ZLNA 2DGVA 1XWLA 2B56A 3A4TA 3HD2A 2RRAA 3M6XA 2WOMA 1WKJA 1R7IA 4IFYB 5MAOA 3FQLA 3HSDA 2R7WA 1NEEA 2XG8A 1RISA 1MMDA 1RT4B 3FMBA 2KH9A 2DT9A 4LT6A 3NWGA 1OO0B 2JLFA 2YX7A 3IR5B 4MYTA 1ZS6A 2BW7A 3ISND 4ILRA 3PW5A 1WOPA 1LWXA 2DXEA 2YKOA 1JJHA 3IRXA 4PRFA 4B3SF 4LQ3A 4YUDA 3TX8A 6FD1A 1MU2A 4YDDB 5H9FK 5I42A 2DGUA 2FLLA 2ZZMA 1R6YA 4ECYA 1WDDA 2ZKUA 1DARA 2IAJB 3FSXA 5KT7A 5J2NA 3NAIA 4R25A 2DNHA 3D54A 2PDAA 5A0YA 2L48A 5I3UA 2HWTA 1WHWA 4LF2A 5KG4A 5F8IA 2IJRA 2C3PA 1NDLA 1RTIB 2KHDA 2BW2A 3GSIA 2RDIA 2RH3A 3SCIE 4WPAA 2I5JA 3CCQS 1CQNA 4DR3J 2NYHA 3MEKA 2DGTA 2C1EB 2E9RX 1GFWB 5B0EA 5T7LB 1YJRA 4ES1A 1Q5VA 4X4QA 2DRBA 3HHNB 3GFHA 4WFAQ 5KT6A 1WHYA 4N8OA 1N32J 3H40A 1FTCA 1Y5IB 2HHUA 1N88A 2UZAA 4RO0A 1PSDA 3EVMA 5CCLA 4Y2KA 1XQIA 4XPCA 1D0EA 2V68A 2OSRA 3CDWA 1GQEA 1YLXA 3CD0A 4OZLA 2D3OR 4FVMA 2DEIA 5CCMA 1RAIB 3JQMA 1J27A 4CT9A 2V5HG 4CLFA 2AJQA 2LYVA 2CPDA 3I4PA 1RK8A 1N0UA 3C14A 3NGRA 2PEBA 2UVUA 4OHYA 1V5VA 4NXNF 2ZWPA 3CJKB 5KFPA 3G6XA 2KZZA 1Q4RA 4DG1B 4KQZA 1KR4A 5IQQA 3MPWA 2OMLA 4ETZA 1N48A 1YWXA 2J6TA 4UOHA 3W62A 1M5KC 4OX9J 2R9LA 2H5IB 1YGYA 2M8HA 3OFFA 2NXEA 3OBIA 2P5VA 2MY7A 2FJXA 5DM6Q 4MIBA 3CMES 2CZ4A 1XR5A 4JI7F 4KHMA 4ECTA 4QQBA 4J9OA 5LSOA 4Y0FA 3VTIA 4B3MF 4LR8A 3OL8A 4M8LA 5HANA 2AX0A 4K4WA 4K50A 3W7BA 2RQCA 2MZRA 4RW8B 2DNZA 1SJFA 2CNNB 1FD2A 4DR5J 4ECUA 2ILYA 1T3NA 2NZ4A 1PCAA 1D1UA 1HNVA 2JFDA 4ED4A 4QR2A 4F3QA 4DS4A 2ZH6A 3DLKB 3EPGA 2H3EB 2ASDA 4ZITA 1K44A 1S1TA 5C42A 4WFXA 2AJFE 1QAIA 2QZ8A 2YNHA 2NSCA 3M6WA 5C5JA 5AXLA 1ZM3A 2XS5A 2J0QD 2YWFA 4HT5A 1UVJA 1GX6A 2CQIA 3SMZA 3Q8QB 2VQFF 1GXLA 1WHVA 4P7TA 1IJEB 3N6LA 5KFNA 2FTRA 1NK7A 4XK8C 3CEDA 4CQ1A 2IPOB 3V6KA 4DSKA 3MAQA 2AKWB 2DNKA 1TKZB 4UOCA 3TZXA 3Q8SB 2E5GA 4HLBA 3PIOQ 2JJ4D 1F1BB
chains in the Genus database with same CATH topology
3TQ1A 2RS2A 5HROB 1YRUA 1LW0B 2KG0A 1H7WA 1Q86T 2FVPA 2A2DA 1CLFA 4YMEA 2DNGA 2B6AB 2QA2A 4X4RA 2HWIA 4OV1A 5GMKa 2M0GB 1IKVB 3HVRA 2WHOA 4K59A 5KFUA 2JEFA 2HLTA 3JTNA 3FEXB 2KG1A 1HHTP 2VG7B 4DL7A 2CQCA 3BN7A 1KHWA 5KAKA 5SUHA 1SIWB 4ES2A 2XY7A 5D3GA 4OI2A 5JVHQ 5KFSA 2RU3A 4NLUA 4ZA1A 1VQYA 3AB2B 3I56S 2CJBA 1RTJB 1SV5A 3BN4A 2UV8A 2LU2A 3DNCA 5HI7A 1FRHA 4LIWA 1BQMB 3THTA 1LV5A 1IBKF 3E01A 1FJEB 2UUCF 1U1QA 2OPSB 5L38A 3RYLA 3MM7A 1JLQA 1S6PA 1HHSA 1F5BA 3TVKA 2BE2B 5M2PA 5KG0A 5D4OA 5LJ5Y 3GV7B 3VAJA 3M30B 1UEVA 4ZLPA 1VIXA 3V6JA 1U1LA 5A8KB 4CTAB 1HNIA 2J6SA 1ZH5A 2M52A 1URRA 5DQGA 1F5AA 4X64F 3MM5A 1DTQB 2C3YA 1FRKA 4R0JA 2JC1A 1JJ2R 3IWXA 4I2PA 1BGXT 4HHJA 2MMYA 2GO8A 2OD4A 2VOPA 4LUBA 2M9KA 5F8JA 1X4AA 3CDUA 1Q7LB 2K1RB 1UA1A 4ED6A 1X4FA 1KOOA 3L7OA 4OZNA 1FXLA 2HZCA 4IFYA 3D1QA 2HIQA 3IA0A 1FEHA 2ZHBA 1Y3KA 2NPFA 3GFXA 5F8NA 3HHEA 4NOHA 4DSEA 1FKOA 1R8PA 2J5AA 2PD1A 2V9WA 5C42B 3O44A 1RT4A 3OJUA 4I68A 4DQPA 2D9OA 4NX9A 4C98A 3BM7A 5BYQA 3MOZA 1GT8A 2FD2A 4HEA9 4OI0A 2FC8A 3PIPQ 2KRRA 1X5PA 4D3HA 3N4WA 4OI1A 1N5YB 4OI6A 2RF2A 1P1LA 2LXUA 2UUTA 2P6TA 3FMWA 4PQAA 4OLPA 3K58A 4QZVB 1H38A 4F2RA 2AWZA 2VPYB 4OZ1A 2ZH2A 3DLEB 2XCAA 1EP4B 4R8UA 4YB6A 3X1LB 4C3LA 4LFBF 1WI6A 4EWTA 1Y5NB 2PGCA 1R0AA 2CPHA 4KKOB 5L39A 4YR2A 1U1NA 2OMOA 2RE1A 1YRXA 2XBPA 3I82A 2UXDF 2A2CA 1YSJA 4AE5A 1HI8A 4DFMA 3OSPA 3TP2A 1WI8A 2ZFHA 4ZVFA 1FE0A 3MEEA 4DPOA 4JI5F 4GKKF 2MZJA 2E44A 4DF4A 2ZJQQ 4DV2F 1LKZA 4FS1A 1XNRF 1N4LA 3KLFB 2Y0SD 5KFTA 3NNCA 2ALZA 4MK9A 3HKWA 2DIUA 4PPDA 2R7XA 3DLBA 4ZP8A 1G1XA 1G6BA 4F3MA 4OX9F 2V4QA 3RR8A 1UVMA 3FFIA 2EFVA 2R7TA 2EBGA 3UD4P 1P8GA 4A4JA 1U48A 3KNAA 1YRTA 3I0SB 5KFRA 1H2TZ 4DFPA 1M90T 2L41A 2KT2A 2JVOA 4ECZA 5E3CA 3R1LA 1A6LA 4J9RA 4TY9A 4J9LA 3S7RA 5LJ3Y 2F4VF 4NCGA 4OJ1A 1ELOA 3LW5C 1JLFA 1AFJA 3F44A 2DTJA 3PO4A 3IS9B 1O0PA 1VQ5S 2IBKA 3HHLB 4O3SA 1P9QC 2QE5A 2V94A 1FA0A 4WE1A 4Q2MA 4P7VA 2G0CA 3D1OA 3MECA 1FESA 1DLOB 1X9SA 2IAJA 3FDSA 4NZ7A 3TVZA 3MMJA 5EHHA 1RA7A 3K0JA 3NL0A 4CH7A 4CZCA 3G71S 4I69A 2MQOA 1UA0A 3DLHA 1FF2A 4KRWA 2AJ1A 1VRUB 3M8SA 1DBDA 2PI4A 1YJVA 1BY9A 3Q22A 4ZPDA 3CD7A 4A8KA 2J9DE 3L3CA 3L95X 3PKYA 3OR1A 1IKYB 1IQZA 1U1MA 3P6YC 4ZPBA 4CT8A 1V3SA 5E3AA 3D0GE 2MZ1A 3BGRB 3KLGB 2RRBA 1UJ6A 4RW9A 1HW9A 4RNOA 1S6PB 1SJ3P 2J6UA 2L3MA 1RTIA 1S1XB 1UVKA 1HBMA 4DFJA 2W4CA 4I7FB 3PXGa 5BR8F 5CA5A 2ZDOA 4C8OA 5CYQB 1TAUA 1UJ5A 3PM9A 4H4MA 2MXYA 3K5LA 4NLPA 1HBUB 1S99A 3RBDA 2NR0A 1HARA 2OPRA 4DR5F 4M94A 2BRKA 2RQ4A 1H7XA 3LH2S 1AFIA 4F4KA 3OHAA 4H54A 5E3RA 5J2QB 4IDKB 1Q8IA 2J7KA 3U7JA 3QMQA 1UEUA 1C4AA 5L1JA 1M5VC 4CO2A 1K8AT 3OL9A 3OLAA 5DGAA 2DNLA 2IC3B 2MSTA 3B8HA 4QYZJ 4F67A 3RBEA 1RWUA 5IS2A 5B7WA 2LQJA 2XY6A 3PNIA 5T7LA 2KXHA 2CPEA 3DFEA 5IWAF 4GC6A 1XMQF 1MROB 2KJWA 2JEIA 1WWHA 1TL3A 4OHVA 3OHBA 3FZBA 2VD3A 1M5SA 5KOWA 2EFPA 3IG1A 4ZS6A 5K9FA 3SEOA 3I55S 2UU9F 4NLYA 5GAGU 5DDPC 1Q8LA 4RW7B 2DHAA 2LXFA 2F9DA 3LO3A 1U26A 1L3UA 2V8DA 4BC7A 3EZ5A 1RT3A 5E0OA 1R0AB 2J7UA 1Y00A 4QIGA 1QSSA 4C8KA 4R5PB 1ZAVA 3NKYA 5DM7Q 1A7GE 2HHPA 4ZOSA 3POTB 3TARA 3RB0A 7FDRA 1NJIT 3CF5Q 1U6ZA 1FK9B 4WXWA 4TLQA 2H9ZA 2VB6A 3U1LA 3H8YA 4D3GA 4EO8A 1KN6A 3QGIA 1HL6A 3ONQA 2KI2A 2K3IA 5EWGA 2ATLA 1ZBTA 1YHQS 1WG4A 4WKYA 1M5HA 3OTDA 4IO9Q 3JB9k 4OHZA 2X1AA 1VQ7S 3JTOA 3HDSA 4JV0A 3TOQA 1YJWS 3HKZD 4O4GA 3CDAA 1UWBB 3MD1A 1U6BA 1A9NB 3DXBA 3H2LA 3PW0A 3MMCB 4JI1F 3FRYA 2BXJA 3OTCA 3BQ1A 4CO1A 2FVSA 3RAMA 2XLIA 2MB0B 3TAMA 3NCQA 4FBTA 3PKMA 2Q3PA 4Q0BA 3PFOA 4B9MA 2R8JA 3NMAA 1S6OA 1QVGR 1VC5A 1TK5A 3GIMA 2EBEA 3MWBA 4EU0A 4QW9A 2XMMA 3C6TA 4PXBA 5KG5A 3OV7A 1QSLA 2DD8S 3DM2A 3MFHA 2EI5A 4I2QA 3KHGA 1D3WA 2O66A 5ITHA 3WC2A 1CG2A 2AX1A 4ZCMA 2M70A 1JNRB 1SUQB 3QLHB 4RW6B 4ETXA 2VPZB 1LWFA 2LU1A 1KONA 1R8CA 4IH5A 4TXSA 4P2SA 1XC9A 2ZBCA 1T95A 4WYLA 4DG1A 2RD5C 3G8SA 4KPYA 3M32B 3MEDB 1QM9A 2PIIA 3JSBA 3MMBA 1S7HA 2HNZB 4IR1A 2HLUA 2HFNA 1LWEB 2ROEA 4ZP9A 4TQSA 5DETA 2VG5B 2GA7A 1LWCA 4DF8A 1G7CB 3SFGA 4RNFA 3AY0A 1TFYA 1YBAA 2IA0A 4E98A 3DU5A 4ECRA 2CVEA 2LVWA 1LFPA 3DMJA 3CJ2A 4KFBA 2IA6A 2GMLA 3Q8PB 3UD3P 4NLDA 4ILMA 2CQHA 3V81B 1K73T 3D0HE 1S1WB 2FJVA 2B0GA 2E5LF 2B9XA 5KFMA 3I0RB 3NP5A 1MMNA 1T02A 3Q2TC 2V2KA 1TQLA 1L3SA 1FRJA 2M8DB 2E1AA 2P6SA 2DGWA 1HBOA 2XB2D 4B3OA 1ZZNA 1TL3B 1IKXA 4JOUA 4JYAF 3LQVA 4DSFA 4WJBA 3I5CA 4RLEA 3W3SA 1XMOF 1N8RT 4PQUA 2V8VA 4CCHA 2L9DA 3MZIA 2YWEA 3MMAB 1ZAWA 3A1YG 4NMLA 2UVWA 1RT7B 2WCXA 2ZOFA 5KFHA 2OPQB 4FF2A 3MCSA 2RQMA 1LQ9A 3NS6A 4NRTA 4LF4F 1Z4UA 3TUZC 2ZHAA 2VFVA 1ZETA 3ENVA 3N6MA 4C11B 4NYOA 2CIMA 3MM9A 2FIUA 1PC5A 2HQIA 3D28A 3FVYA 1WG1A 3CJ5A 4IRDA 4JBCA 1RI7A 1UMJA 4YFUA 4C3KA 5JXSA 2XEXA 4ZPAA 3MUMP 1N6QB 3K57A 1I6JA 3OFHA 4PCQA 3SSSA 3I6PA 1B64A 2E5IA 3C6UB 3LWMA 3DC2A 3DRYA 3RRHA 1WTBA 4DBQA 2KO1A 4TQRA 3AJ2A 4L72B 3OXFA 4AQYF 1HBNB 1VK8A 4RW8A 3OW2R 1X5TA 3CUNA 3NAHA 5B0AA 3G8QA 4KIAA 4WYWA 1I1GA 4DSIA 2EK1A 1R27B 4YB7A 3T19A 1WF2A 3N79A 3M4XA 2DGQA 2KT3A 2VG6A 2JZ5A 1FRLA 4Y65A 2WONA 4DSLA 2QA4G 1WEZA 1ZTTA 1VK3A 1UAWA 3KK1B 1VHFA 4NA2A 2CDQA 4BWMA 2HVZA 2XNQA 1N54B 1QJHA 3DRSA 1J5OB 3IRWP 2CQ3A 4BBYA 2QO3A 2VBZA 4IH6A 2PMHA 3GWCA 4MH8A 3C6TB 2ZVSA 5KTQA 2F9JA 3AQOA 3P3DA 1KLNA 3CC7S 2Q6CA 2QA4S 4B9TA 1JLBA 3BJYA 1S6QB 3HLUA 2OFHX 4PWDB 5C24B 2RDJA 3TAPA 4KO0B 2W25A 3PX4A 4NZ0A 5K5MA 3JYTB 5KT2A 5KFDA 2KVIA 4J9PA 5D77A 4FXDA 4U67Q 1KQGB 2HYIB 4X66F 5FJ4A 1OPIA 1S1VB 2ZH7A 1QUPA 5LMNF 1LXNA 2OTLS 2B4UA 4KJIA 3OLBA 2RKIB 1RYSA 2PT0A 1N34F 2YTCA 3NCPA 4KV8A 1Q8BA 5EX3A 4DLEA 3CDBA 5DS7A 2LLZA 1KLMB 1YJTA 4N77A 3VCDA 2QSFA 4QCLA 2K7JA 2FVRA 3AJ1A 2YKMA 4B9VA 4W90B 4XPEA 3UCZP 1P27B 3DLLQ 3OL6A 2PFFB 2Q1LA 4RNMA 3P5TL 1YVFA 5CXTA 4RNNA 1VC0A 3LP2A 2XSJB 5D8HB 2PA8D 1V3ZA 3NRBA 1E6VB 1TKZA 3AA9A 5GAEU 1HPZB 3DI6A 4A8FA 2ZDPA 2Y1RI 4Y34A 2DJWA 3DYAA 1FKPB 5FIIA 1DURA 1X4GA 1YJ9S 3HHLC 1HFEL 2EWHA 5F41A 3FEYB 3OFGA 3I31A 2GC8A 2OPPB 4MFBA 4R0EA 3RTVA 2VODA 2BV3A 3K8VA 5HROA 3GFZA 1LW0A 4QPTA 1IBMF 1HBOB 4NA3A 4IOBA 2O67A 2W8LA 4ZMMA 1VBXA 3T1AA 3H5SA 3K59A 1H6KX 2B6AA 4DL6A 1RDRA 1JX4A 1Q78A 1H98A 2J0WA 4MKBA 4UQTA 5L8RC 3VZIA 5F0WA 1IKVA 1QAXA 2CJKA 2YVSA 2Y1JA 1R3NA 4HYKA 3TVYA 4Q7AA 2VG7A 3DOLB 1IKWB 4NLSA 5H1SV 3QGGA 3US5A 5EDWA 4O44B 4Y2AA 1X4CA 4Z2XA 1KRPA 3QJLA 1MNEA 2CPIA 2LQ9A 5IM0B 5G4DA 5KFYA 1WNEA 3Q8RB 2AD9A 1RTJA 1UETA 3NGKA 4YHHF 1BQMA 2B4PA 4N8NA 2OPSA 3PR5B 5CZXA 4QYRA 4KGMA 3G9CA 2BE2A 1SH0A 5E41A 3M30A 5D6GA 3VAFA 5A8KA 2EPIA 3O1LA 1F60B 4CTAA 5BJRA 5KFBA 3RRGA 3JTPA 1OSDA 1DTQA 1JLEB 4FNIA 1SKSA 4G1QB 2I2YA 2GW8A 3HF5A 1FDBA 4MKYA 4HL9A 1ZYQA 4WK1A 4LF7F 3MUTP 4J9QA 5LT5A 3PW2A 1VI7A 2JSXA 2ACYA 2JDJA 3DLGB 3FNNA 3O5TB 5JVGQ 1U2RA 5IXUA 1ZAXA 5SZTA 2K1RA 4EBCA 1FXDA 2L9WA 3MD3A 1TKDA 1KFSA 3LUYA 5K14B 4DR6F 4WFZA 2G9OA 3DOMA 4FN5A 4CH0S 2NXUA 2JRSA 5CD4H 3CTRA 5CH7B 4NA1A 1R31A 4KHPF 2F3JA 2FHKA 1H0HB 2KZMA 5A6WA 4BWJA 3T5LA 4DQQA 4DL5A 3R27A 2ROGA 3R5CA 1S49A 3I9ZA 3LP1B 3BO3A 1FDNA 5F8HA 4H4OB 2ZJPQ 4X4UA 2QSWA 2B9WA 1NAQA 3CCES 2D3ZA 2F40A 1B7FA 4DEZA 5DRKA 1DTTB 4F4ZA 4LF5F 2AYEA 1N5YA 4DHVA 3NBPB 1MWYA 3UPFA 1HR0F 2DNOA 4ZHRB 3ZZOA 1BLUA 1VJWA 3HHDA 3DLEA 1EP4A 3IGNA 1YITS 2KXNB 2NLWA 2IJFA 2JEJA 4A8OA 3GIIA 1BQNB 4CO3A 4DL2A 1JKHB 1NNDA 1C1CB 3HM9A 4DS5A 5DG7A 1BWEA 1X8DA 4LSLB 2X1FA 2PO4A 1Q16B 3GFYA 4G3IA 2RB7A 4ED3A 1KTQA 4ERDA 1UW4A 1M5PC 3KLFA 2QIFA 3UFCX 4ZVEA 1NK0A 3M1VB 3QWUA 2WK4A 1F9FA 4IG0B 4Q5VA 2Z4PA 2EFQA 4DR7F 3F56A 3MM8B 3I0SA 1VQ8S 2IMWP 3CJ3A 2HNYB 4V19J 4DQRA 1QE1B 3N9UC 5J1NA 3UCUP 5F0UA 2LKZA 5GADI 4QU7A 3IC1A 3PEHA 4HTJA 3GB0A 4CIOA 5B09A 3RB3A 1FDAA 2ZOGA 1CC8A 1FVQA 2NQPA 1O8BA 4M63A 2G13A 4O4RA 1H2VZ 3IS9A 4NCAA 3HHLA 5U47A 3ICLA 4Y2IA 3ZZYA 2N82B 2HFOA 3SQGB 2YH0A 2DVIA 5KFEA 4C0HA 3QIPB 1DLOA 3CJ4A 4A46A 3I32A 3BO2A 2FJWA 1NH7A 2B7BB 3KFWX 4LJMA 3SFUA 5DDQC 4CO4A 3IN5A 3C3LA 2F1FA 2KU7A 3K5OA 3G96A 3KMQA 1DHMA 3EYZA 5L1LA 1HD1A 3TI0A 3OR2B 2VC1A 1VRUA 4QWDA 1C0UB 1JJ4A 4Q8FA 2VKRA 4AL5A 2GCFA 3ZZUA 2B43A 1HWIA 2ASYA 4X4SA 1NU4A 1SXLA 3UWTA 5IT0A 4HKQA 1IKYA 1VMBA 2KHCA 3PACA 1SBRA 3SSRA 3VQSA 1L3VA 3ZC4A 3N5BA 1YI2S 2QEXS 4FS2A 4FNHA 3BGRA 3KLGA 1S1UB 3GIJA 2BANB 1N5VA 1H2UX 2UXBF 1S1XA 3CE8A 1Q82T 4X4TA 2CPFA 1QAJA 4I7FA 4RWXA 1S4FA 1G3OA 2IRYA 5CYQA 1RT6B 1HBUA 3BB5A 3PW4A 2LDIA 1WF1A 3S1TA 5J2QA 1VQLS 4IDKA 2ZITA 2GGPB 2IYIA 5KT4A 1BC6A 5KFWA 3BSOA 2B7CB 3U1MA 2MKKA 2MQQA 5HLFB 5CQGA 4G1IA 4QWCA 1UFLA 3MF5A 1Y5LB 2VFRA 1U49A 3P49B 2FGOA 3QAEA 1R8BA 2IC3A 1KTVA 4LQ9A 5CYJA 3J7YU 3LAMA 1S97A 1UP1A 2YKQA 4DN9A 2LDYA 1VBYA 4DUZF 1PC4A 1GTEA 2CRLA 1KQFB 5HP1B 2NUUG 5LSLA 5CHCB 5F8LA 2P9CA 1U47A 2R7SA 1MROA 1JWWA 5AXKA 4ZCLA 1S9EB 1K0VA 3MGJA 4LFAF 2MHEA 3WX4A 4QW8A 4JI4F 3AAWB