2GQCA

Solution structure of the n-terminal domain of rhomboid intramembrane protease from p. aeruginosa
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
MSAVQVLKFPLSVDLAGFVGLLRRLNVPHRVSEESGQQVLWVPDERLAEQVRELYRRYPEGDPQATLEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and dynamics of the N-terminal cytosolic domain of rhomboid intramembrane protease from Pseudomonas aeruginosa: insights into a functional role in intramembrane proteolysis.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Rhomboid Intramembrane Protease
total genus 10
structure length 70
sequence length 70
ec nomenclature ec 3.4.21.105: Rhomboid protease.
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16733 NRho Rhomboid N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2080 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gqcA01
2GQCA
chains in the Genus database with same CATH superfamily
1MN9A 2B7CB 2RNEA 4I67A 4CCHA 1FEHA 4KE5A 1HNVA 4Q45A 1ROFA 3FZBA 4USKA 4Q43A 4K4UA 4HDHA 2R7SA 1NKEA 1VISA 5BR8J 2MZ1A 1F5AA 3HVTA 1SJFA 2G0IA 3O5TB 3UVJA 3QWPA 4B3MF 5B0DA 4ETZA 3M2UB 1IWAA 4K2JA 2D69A 1T9XA 2H51B 1OQ6A 4P2MA 1XMQJ 1YGYA 4JI1J 1IKXA 1PJ7A 2KXHA 4KPCA 5JXSA 3VVUA 2AKWB 5D4LA 3I55S 2VICA 1U1OA 4PWDB 2HVIA 1JLFA 1OY9A 2UV8G 4PQAA 3V4IA 2K1RA 5B7WA 3ILJA 3GR1A 2HFVA 2YWKA 2BBEA 1TK5A 1HKAA 3OBIA 3OTDA 1MU2B 1TAUA 3DHXA 1TQLA 3J81j 2YNGB 3D7SB 5GADU 2NYIA 3TJAA 1BHNA 2C28A 1S4FA 1SV5A 1KBRA 1S49A 1N34J 4ZVOB 2IY5B 2VG5A 3BN7A 4DCOB 4IR1A 4JI0J 1BE4A 1KLMB 1WC3A 2ZVSA 5E2QA 4BBYA 4HH0A 3BSCA 5KT7A 2B4VA 1Q78A 1WJ9A 3MMAA 3KLEA 4LQ3A 4JI6F 4EYIB 4FP9A 4IFVB 1RBAA 3MECB 4C3KA 2CPFA 4NLYA 5SUHA 5GAHU 3KJQB 1VQMS 1YBAA 2V4QA 5KFEA 4NA1A 4J9VA 1OMSA 4OYWA 4LFCJ 2PO4A 2DO4A 2ZUGA 3V6DA 2G13A 2QFIA 4Q7AA 4DZDA 4NEZA 4I4BA 5KFKA 4ANEA 3BB5A 3MD3A 4GKKJ 1DTTB 2GJ2A 3A3PB 3SCIE 3CCLS 2HSEB 3N4WA 1TZ0A 1VDHA 1IBLJ 1EQ0A 3PKYA 1NB7A 4IQMA 1AA1B 2EEYA 3RYLA 4F2SA 1UWAA 4DV0J 3IS9A 2BACA 4I0WA 5KOWA 1HI8A 3PRVA 4P73A 5D0RA 3OR1A 4AT1B 5BXIA 1AUDA 4B3MJ 2PFFB 2C3UA 3LP1A 5F8IA 2XO6A 4X4NA 3KJFB 1HFEL 1NZ8A 3I87A 5L39A 4A4JA 4NLSA 1PBAA 2EC0A 3SDEB 4PXDA 4X4VA 3LGHA 2IYIA 4ZJOA 2DHGA 2W2OP 3QMQA 3CJKB 1F3VA 4J9QA 1H2VZ 2BE7D 4KHMA 3NNHA 3VF0B 3KXDA 4X84A 3H2VE 1Y3KA 2GJFA 4PUOB 1FK9B 5C25B 1RWPB 2LCWA 3QT6A 5KG3A 2F7VA 3H4DA 1X8DA 1F9FA 3U02A 2DK2A 4ZIWA 4IOCQ 3A12A 2MYFA 2MQPA 2WRMA 2R8IA 3KLGA 3QSYB 1LWCA 3W2VB 3QZ8A 1QAIA 3I6PA 2IM1A 1HNZF 1HYSA 4DUYF 2ADCA 1EARA 2BRLA 3MPUB 4KGZB 4BC7A 2KKHA 2KJWA 3ENQA 1RT1A 3UDCA 3NGRA 1Q8IA 1D9FA 4LFAJ 5ETTA 3V81A 2OTJS 2XBPA 2D74B 5HMYA 4NXMJ 2KN4A 3BSNA 2WOMA 3R6LB 1I6JA 1TU0B 3S7RA 4DBQA 1WHWA 1RHJB 4CO0A 3IG1B 2H9ZA 5B0FA 4B9NA 3HHLA 2J7WA 1J27A 4C3LA 4F8RA 2QIFA 3CJ8A 2HBYB 3TI0A 3OFEA 4ZP9A 5HJXA 1UW9A 3G8SA 3OSNA 2HG4A 2EXUA 5I4MA 3PX4A 2VA2A 5J2PA 3HCXA 1K1QA 2C2EA 3OFHA 4JOUA 2VQFF 1T05A 2QO3A 3D0HE 2HNZB 4ID5A 3HM9A 1K9MT 1HBNB 3SIPB 3ZZYA 2E1PA 3JQMA 4RWWA 2J5AA 3LPYA 1QY7A 1F3FA 2BX6A 2VPZB 3BPDA 1A0OB 3LTOA 2VKZG 5ETRA 4YFUA 2DR6A 3C14B 3HMJG 4KJIA 1RTJA 3E01B 2R9LA 4DPOA 3T19A 2NXCA 1LW2B 4KH0B 4E2FB 1BMQB 4V19X 2XS7A 2DTJA 1LQ9A 2SXLA 3NEKA 1C0TA 2MQNA 3LALA 4LUBA 1FNXH 4DV7F 3DXBA 3PY8A 1S57A 1RT4B 1SUQB 4KV8A 3CNQP 3LF0A 7AT1B 4RJVA 1V3RA 1U25A 4DV3J 1S1TA 1S5ZA 1T9YA 2BOPA 4WKRA 2DIVA 2MSTA 4B9MA 3SSRA 5DETA 3EUNA 2OPRA 2W9CB 4Y6IA 2ZJQQ 3DXSX 3B8HA 2GGPB 2JFKA 2XNQA 3OUYA 3OFGA 4LSLA 3P5TL 2JNJA 3EGVA 2C1EB 5D3GA 2J0XA 1EB0A 3UQSA 2E1CA 1K44A 4DSKA 3J80U 2MLXA 4PXBA 3OL7A 1G3OA 4ED5A 2RJZA 2AF6A 4QU6A 1R89A 1PYTA 3N9UC 2CQCA 4Q8EA 2V34A 2FZCB 2R8KA 2VZ9A 3GLJA 2QMWA 4IO1A 3IWNC 3I0RB 4CO5A 1UZDA 2MDAA 2LXUA 1RQ0A 2G2OA 2Q66A 3C6TB 2JEFA 4DUZJ 1V9OA 2AWZA 4ECVA 1AZSA 4HI1A 5KFFA 1YJVA 1JLFB 1OSDA 3KG1A 2GMJA 2EFPA 3DYAB 4RW9A 1Y11A 5GAEU 1Y5LB 4A8SA 4WJBA 3T1YF 1FTCA 2KRBA 5GMKa 2FVSA 1YVFA 2OEMA 2DHSA 2F4VJ 1TL5A 3EJMA 3S6EA 2IRYA 4CLYA 3W2WB 1RWVB 3CJSA 3MEEB 1U0SA 4USUA 1NJYA 1SVDA 1B0VA 1RT6B 5HBMA 1FWPA 2DGUA 4WFAQ 2P6TA 4CH1A 3FKBA 2I2YA 1R8AA 4C8MA 3NWRA 3DRSA 1Q81T 4PG4A 4MTPA 2FJAB 3KLEB 1A9NB 1JXEA 4IFVA 3GIRA 5RUBA 2YKNA 4IDKB 1U4BA 1VGYA 2ASYA 2F1FA 4MKBA 5KG6A 2CQGA 4RNFA 4OIXA 3J81Y 4I2PA 2UP1A 4WE1B 2QSFA 1CSJA 2AJFE 3MI7X 4PQUA 1RWXB 4UQTA 1CBKA 1TKTB 4EK2A 4WBFA 3FRYA 1S9EB 4WIQA 2KL8A 4BC9A 2XULA 3IAS9 2DNLA 3M2RA 4C8NA 1MLAA 1FDAA 5AE2A 4A8QA 1RT7A 1DTQB 3AD7C 1I3OB 2BZ2A 1JLGB 3G86A 3DRRA 3MM7B 5E3QA 2BQUA 2UVUA 4N47A 3BO2A 4C4WA 2HMIB 3C16A 2JSXA 5FD1A 1FXRA 2HGMA 3PV8A 3IS9B 5IQQA 1FWKA 4P72A 2V4JA 1F1BB 2CJXB 2KDOA 2IMWP 1F5BA 1V3SA 2H5JB 4KHRA 3GV7B 2BE2A 3PW4A 2W2NP 3C46A 2H1YA 4KQZA 4MH8A 2XYHB 2P9EA 1IWGA 4Y00A 4G3IA 2IBKA 3OVBA 2DGVA 3WC0A 3CJKA 1VQ7S 2HVHA 2N7CA 4A8XA 1TL3A 3QIPA 2QE5A 2P8IA 3M8WA 4JI7F 3M8YA 1D8ZA 2DITA 3VR1A 4LSNA 2L9DA 4MIBA 1F9EB 5BYQA 4LRAA 5FDLA 2G2YA 1R8HA 2R3VA 4O4RA 2IJNA 1BWVA 3JQKA 5GMEA 3UW1A 1G4CA 2RQKA 4WIIA 4CLZA 1A7GE 3G96A 1HQ2A 2R8JA 1XN9A 1PAEX 2LA4A 4F3MA 3OTOF 4QPTA 4DR7F 1RABB 3M05A 5ETLA 2ZE2B 2FQQB 2ZBQA 4QWDA 1AROP 3J81U 4C8LA 4J9OA 2QN6B 1FVQA 2KH9A 2V2KA 3HP6A 4ZVTB 2GVDA 4Q8FA 5L8RC 2HFSA 4C2MA 4KSEB 2WB1D 1HD0A 1LWEA 2LXFA 4USWA 1YWXA 3TR5A 3N79A 4C3MA 3VAGA 3SV3A 1NDKA 4ATNA 2VG7A 4DFKA 2GX8A 1NK9A 2CPHA 3D9BA 1WWHA 1WACA 4J5OA 3RU0A 4F4KA 4MMOA 2FGCA 4OYOA 1YG0A 2QRRA 3FVYA 3KUEA 1U1PA 4UOCA 2JVRA 3TA1A 2NLWA 3PVXA 2MKYA 1RAIB 3G6VA 1YJUA 2XMWA 1ZTTA 2QFJA 2NQPA 4Z2XA 5K5MA 3SXLA 2CZ4A 4M5NA 4F4ZA 2W4PA 4KIAA 2E7VA 2X1AA 2Q6CA 2C3OA 5J1EA 4ZP6A 4UQGA 4IG3A 2DH8A 2RHSB 3W62A 4XTTA 1NPRA 5D6GA 4EYHB 3NXZA 3T9ZA 2MKKA 4UZCA 3FCVA 3HX9A 3M6XA 5J2QB 2F4VF 4ER8A 4AQYF 5IWAJ 2ABYA 4CNYA 2W9AA 2VONA 1CJTB 2YQ3A 3BGUA 5E7OB 4B3RF 1S7IA 1RTJB 2V2ZA 2AGOA 4JI7J 2N82B 2HS4A 5ETKA 2VF3A 1N33F 3CT9A 3K17A 2F5GA 3V2UC 5KFIA 1FERA 3KK3A 2ZH3A 2FC8A 1K1SA 3DLKA 4N8NA 4YN3B 3LA0A 2QG9B 2ZOGA 3QQCD 5THWA 4RWXA 4C0HA 1RTHB 2OPPA 4KV8B 5GAGU 1HNIB 5F8MA 1QVGR 5F3TA 4XIUA 1RA6A 3TOQA 3D54A 5HROB 1AXQA 1S1TB 2CPJA 5M2UA 4CH7A 5L1LA 1YJWS 1K8AT 1VMBA 2CNOB 2IC3B 4DZ6A 4DR5F 4DPXA 1TL4A 3ENWA 3DDIA 3K89A 2JRSA 3DLLQ 3CJ3A 1CLFA 1SB6A 3ET6B 5KG7A 3I5CA 2IMOA 1QDUB 2UXCJ 1IJFB 2DNQA 1SKSA 3UD4P 1IBCB 1U0HA 2C22A 3FFIB 3JTNA 2O67A 3T6BA 5HVGA 3Q8RB 5KOXA 2YKQA 4ZVPB 1JXLA 2FJWA 2PSZA 5B09A 1S79A 2LQJA 4M5JA 3LANA 2CPXA 2V0NA 4ITSA 4DV5J 4ICLA 4ZK7M 3KLHB 2B8QA 4MKVA 4DX7A 2ZJRQ 1JLAA 4NZ7A 4OHWA 1P9YA 1GXLA 4ZPVR 4ZA1A 3ZNJ1 2IRXA 2KHCA 3TAPA 5DLFA 4ZP7A 2EBEA 5A8WB 4BHQA 4YQWA 4DHVA 2ASLA 1CS4B 1OY8A 2KG0A 1AW0A 5AXNA 2H5IB 2JC0A 3M8ZA 2Y9HA 2OFHX 4LF2A 4DFMA 4DR2J 1FA0A 1HNVB 1X0PA 3AJDA 4A8OA 3BM7A 1NHVA 1S7HA 4D3HA 4B08A 4K5RA 3GB0A 4C11B 2WONA 4ZVGA 4B3SJ 3UCGA 3HVTB 3T5JA 1WKKA 2XG8A 3MURP 3PXGa 3CPWR 3AHPA 1RAFB 3Q22A 3M2UA 2HFOA 2XMAA 1BWEA 1ZBTA 2XWXA 2APOA 3AA9A 3CDEA 2YX1A 3EWGA 1M5VC 3RW6A 3KG0A 2QYGA 2JJ4D 4DSFA 2ACMA 2YWGA 1EHWA 2LQ8A 3NNCA 1Q5VA 3M32A 3R7NB 3FNNA 2F8EX 2PE8A 1W2BR 2HFNA 4OYIA 3DFEA 2BJEA 3BJYA 2ZVIA 5KT4A 2DPIA 5EX0A 3RRGA 3N5FA 2XSJB 4YR2A 2MZSA 3MM9A 2EFVA 3SCKE 4CLLA 4DR7J 3OTOJ 2AJQA 4GO5X 3PR4A 4DSIA 2NZCA 4NWBA 1QTNB 5JJBA 1HNWJ 1XTZA 3MMAB 3TAQA 3MEGA 3SI8A 2OIHA 1IVZA 2D1CA 4RUHA 2FIUA 2DNPA 4UT4A 3MCNA 2FLNA 1UVNA 3MM7A 1RISA 4YP3A 2XEXA 3BGRA 5KAKA 1SJ3P 1PAUB 3HSGA 1CC8A 2ILYA 3V6DB 1X7VA 1BLUA 1WHVA 2A2CA 3L95X 1RTIB 3TUZC 4ELVA 2AT1B 2DXEA 1ZAWA 2N3OA 1NO8A 2HWTA 4F2RA 1RP5A 3CIZA 1REVB 1DTTA 3CJTA 3HD1A 5HSPA 1HQEA 1MROB 1Q95G 1O0PA 1VIXA 3AB4B 1ZM3A 2UUTA 1TL3B 1KONA 3I82A 3QIPB 4FPRA 4ZCIA 3D1HA 2RB7A 4WP9A 1RYRA 3OFFA 3M9NB 2KHDA 3MM6A 2POKA 5I3UB 3M8QA 1NJIT 1LFWA 4YMEA 3UR0A 3M8PB 1MN7A 3TO8A 4B3TF 3SDEA 5IV4A 1DQ9A 3SCJE 1TKZA 9ATCB 4KO0A 1NK0A 2BANB 2CNLB 3IWXA 3HK2A 2WSCC 4OLPA 5KFOA 3OXFA 2PGCA 5G4DA 4CP5A 5KFXA 3C6UA 3K5MA 2GVDB 1D3WA 4QQBA 1UA0A 1IBMJ 3G6YA 2HRYA 3Q8VA 4I7FA 1LW0A 2MZQA 4CTAA 4CYUA 2R2SA 5CYJA 2HHXA 2PIIA 3M6UA 4LT6A 3J7A1 4I6WA 2L9NA 2Y1RI 2F9DA 2IIHA 3PW0A 3K5PA 1R27B 4L3KA 3K57A 1FRKA 4G1IA 2FY8A 5I3PA 1RKJA 1VQPS 4DN9A 2D9PA 2HQGA 2XMUA 2J7KA 1C1CB 4FPIA 4U7UK 4WCEQ 2I38A 1RT1B 2CAJA 4U6PA 2MJNA 2Z2YB 3D6MB 4LIRA 4IG0B 3MMBB 3QT5A 1M5SA 2V5HG 1XJWB 3A13A 3WIVA 1SXLA 4NXNF 3H5SA 1YBTA 2RE1A 3H0PA 3R7BB 1QE1B 2HGNA 4QWEA 3NWGA 5JVGQ 1JNRB 2ZBCA 3FZ2A 1KSPA 1FF2A 2GQCA 2YKMB 3DRPA 3T1AA 3NAIA 2FLLA 3KDOA 4P2FA 3PR5B 4Y65A 4QR2A 4RU2A 1NAQA 1PJ5A 1NB2A 1TUGB 2F8MA 4WYLA 4PR6A 2WZ1A 1T03A 2VKRA 2E5LJ 4K0KF 1R0CB 4USIA 4MIWA 3F0NA 3LUYA 4XAKA 5EDWA 1KHWA 1KTVA 2GMLA 3HKWA 5EWGA 4J9MA 2MQLA 4ID5B 1SH3A 3VZIA 3TQ1A 3OV7A 2FLPA 3QRPA 3H59A 2ACYA 5GVQA 1HQUB 1WSRA 3S01A 2VPXB 1N8RT 1VQLS 5EN1A 4NA3A 5LL6d 1YHQS 2V67A 2I0XA 2RKIA 4U95A 1GTEA 1Z4UA 1JKHB 1FX4A 4U9RA 3CJ0A 3R5CA 1L3UA 4M5LA 4OL8A 1PIEA 1NXIA 1WORA 3QYYA 4DV6J 1SBRA 1KQGB 4QW9A 1Q86T 3QLHA 3PIOQ 1ZYQA 3EVWA 2R7QA 3H90A 1R0BG 2RIJA 2MXYA 4CNZA 1Z1ZA 1F60B 3MM8B 1IR2A 2GIQA 2OGUA 4HHUA 4HTIA 5HMZA 3OVSA 2Y1IA 4ICLB 4LFCF 5CHCB 2OPQA 3EYZA 4G1QB 1Q8LA 3GG0A 3Q8PB 3SQOP 1HNXJ 1WC6A 4DPWA 1GK8A 4USMA 1SQEA 2VOOA 1QUVA 1X60A 3J7ZT 1TP7A 3QT8A 3U1NA 3UN2A 4DPTA 5A8WA 2CQHA 2MGZB 2DO0A 2DD8S 4MYUA 1IQTA 1VC6A 1DZ5A 5L9XA 3C3LA 3B4DA 3BQ0A 4ELUA 1FNOA 1RWOB 1U6ZA 2MSSA 2F9JA 3NCPA 5D15A 3TZWA 5IXUA 3MWBA 3RBEA 1SL1A 1P27B 1G1XA 1S1VB 1H2TZ 1U8SA 5D4NA 5KFLA 1M5PC 1B3TA 2KB2A 3BH6B 3ILLA 1CJVA 4URSA 4DS4A 1FHTA 3VAFA 2KFZA 4FN5A 2M0GB 4CLSA 4DUTA 1N6QB 2OI2A 4ED4A 4AL7A 3VCDA 4UF4A 1K0TA 3A8KA 2HS3A 4O44B 3QPIA 4H54A 3SEOA 3OL9A 2BJ7A 1YSJA 4K50A 3W63A 4KH1B 3Q8SB 4YS2A 5CCLA 3KHGA 1XMQF 1AZSB 1KNZA 3GFYA 2HPUA 4RW4B 4OJ1A 4LFBF 1F9HA 1VLOA 4OZ5A 2YNHB 4FYVB 1QSYA 4C97A 4LFAF 1ZZFA 2PMHA 4QIVA 3BGFA 1RAEB 1S0VA 3UVJB 3CO9A 1QM9A 4DUYJ 5D0HA 3FBFA 1HW8A 3CMAS 4J90A 1FKOA 5CAAA 2AW0A 1C1BB 2CQ4A 3CCTA 4LVNP 3F44A 2CWKA 4F0HA 4HTJA 2FJBB 4F4AA 4PWDA 2JLGA 3MTKA 1HBUB 3QGIA 3BBBA 1Q5YA 2XMKA 3N5BA 2YKNB 2GMHA 3C15A 1WOPA 4DX5A 2C2ZB 2E1RA 3H2LA 2ZJPQ 4WE1A 2KXFA 3QRQA 2X3GA 5AXKA 1FJ7A 2XC9A 4ED7A 2J9DE 3VGSA 2ZBRA 3DI6A 1UMJA 4ZIVA 1O6XA 2K7KA 4C9DA 2B9YA 4Y2IA 5LOQA 1SKRA 1RTIA 1G7CB 1SH2A 1UVKA 4QOTA 4R0EA 4PG8A 3CC2S 3M2RB 3NCRA 1HMVA 1WF1A 1IKVB 1REVA 4DV0F 1HNWF 3CULA 1UTAA 2Z0GA 2G1HA 1SQGA 1S9FA 1GFWB 1BUXA 3DRRB 5MLCV 1E6VB 2ZH2A 4RBUA 2ZBPA 1UWBB 2HLTA 1T9VA 2J9DA 4HVZA 3HHKA 2GW8A 2W1BA 4ANDA 1TVRB 2XSFA 3MM6B 5IFMA 2YKPA 3OLAA 3KK1B 1NKCA 2FHOB 1P1LA 2N7YA 4QJVA 4RW8A 4O3NA 2BE2B 2B9XA 4FZVA 4NLVA 4ZOSA 5I42B 3KHHA 2VD3A 5DM6Q 2L41A 2VC0A 5D8HB 2J76E 4LRFA 2ZH1A 5DG8A 3AOBA 1FX2A 5K14B 2GQQA 5EGYA 4OHZA 4DV4F 1DURA 1F0XA 4W98A 1B7YB 3TJ9A 3FBBA 5HLFA 3IBWA 4JI6J 3I96A 4FVCA 4WZMA 1HW9A 4CH0S 4GO7X 3NKYA 5E5NA 4NRTA 2W25A 1B4SA 2DHAA 1SIWB 1X4BA 1S1XA 1KR4A 2KTQA 3QFHA 5AXLA 3RBZA 5A2QU 4XPEA 2GAHC 2AJ4A 2ZOFA 1CJUB 4FBUA 1S4EA 3H5XA 2UXBJ 5FJ4A 3QO9B 3JS9A 5T7LB 4WYWA 3CUNA 2CPZA 2AJ2A 3BEGB 2JOQA 2WW8A 1JJHA 1ZAXA 4FYYB 2BABA 4JI2F 3ZZRA 3W5ZA 1APSA 1PCAA 2CQ1A 2CZVC 2I9SA 1OS5A 5A8KA 4LF5J 4GVLA 1HI1A 3KLGB 2HRUA 1WI8A 4UOHA 3W2VA 3T6JA 1LOUA 2IRUA 4EEYA 3ULHA 1N36F 2FVPA 2AEFA 3PZPA 1RCOB 5K20B 2CWXA 3D0IE 2Y1LB 4K2XA 2EW9A 3UCZP 1M1KT 2ZZMA 3G4SS 1WEZA 2H5EA 2AGPA 4K4VA 2UXCF 3H8YA 4RNHA 1PC5A 2HNDA 4P74A 4LF9F 2XCAA 5CD4H 4OV6A 1KFSA 1UJ5A 2HWHA 2OPSA 3CJRA 4DV2J 2RRAA 3HHDA 4AUKA 5F8HA 4M63A 1T9UA 2DRBA 4FXWA 4F50A 5F8LA 1H7WA 3E3XA 1EETB 1PSDA 2XZDB 3M2VA 1WC5A 3NCQA 4I69A 2C2OB 2CKWA 5LXRA 5M2PA 4WK1A 3SYZA 2M70A 2OTLS 3R7SB 3AQPA 3CJ4A 3ZZ0A 3CCVS 4OZ2A 1IKYA 4NLPA 4NZ6A 2J0WA 6AT1B 2YPYA 5B0BA 1ZTWA 2RDDA 1RTHA 5J1NA 8ATCB 1PO6A 4FXDA 2E5IA 1LK5A 4OMFG 4Y0FA 4X62F 2DIUA 4Y2AA 1RBLA 2X1GA 4RU9A 3C14A 2M3DA 3MM8A 3C66A 2B9EA 4HACA 1LW2A 2C3YA 4OI3A 4U96A 1VQ9S 2V8GA 3DM2A 4JI4F 1VQNS 2DRAA 2CVEA 1T0TV 4UOFA 4U8VA 5KFHA 2RU3A 4DN0A 3ET6A 4OHYA 2WTFA 3ILIA 2I5JB 2CQ2A 2GFFA 1KOHA 1U0HB 1Z2ZA 2FJEB 3A4TA 2A0FB 4ZLLA 8AT1B 1WTFA 3SSQA 1X9SA 1VHIA 4Y28C 1VBYA 4LF6J 1N33J 3J7YU 1ZA2B 4C6AA 3CD5A 1PJ6A 2RMLA 3GR0A 3HDSA 4DL7A 3V6JA 3V6HA 1WDTA 2NREA 1U26A 4FYWB 4J9RA 3OUYB 1RUSA 3D4JA 3IN5A 4URGA 1RAJA 4YY3J 1FDBA 1C0UB 3OVAA 3CCUS 3TRGA 3H25A 4GC6A 3UCUP 3GV5B 1J5EJ 4OLOA 1M1HA 3G71S 2MQMA 3BS9A 2UV8A 1R43A 4ZITA 4F0MA 3K5LA 2K3KA 4OHXA 5F3ZA 1KWMA 3IXQA 1YDLA 4RLEA 1IM4A 3VVTA 4CLUA 2QA1A 4IO9Q 4IKAA 2LMIA 7FDRA 2OFGX 5KFQA 3RTVA 4L76A 1RWUA 2A3JA 2F63A 4P71A 1HLWA 4O4GA 4DL4A 5KFUA 3I4HX 3SBMA 4IR9A 3GIMA 1IN0A 1RHMB 1FJEB 4LF7J 2XNRA 4JYAJ 1TMMA 5GAEI 1RHRB 3UE2A 4CQ1A 1XMBA 1F2GA 2UXDJ 1QD1A 1C1BA 4HEA9 3VQTA 3EGZA 4ES3A 2BKNA 2OD4A 2W4CA 2DRDA 1HBUA 4M5MA 3KLFA 3K0JA 3ZNUA 4MK8A 5HMXA 2QLXA 4X4QA 4FBTA 2FVCA 3QJJA 2B5JA 3FQLA 2IDLA 1XR6A 2O3DA 1EKSA 2Q43A 3E51A 4PEOA 2IM0A 1UJ4A 4WPAA 4DI6A 3FGVA 4GKJF 2XI3A 3DI6B 1N0VC 5DQGA 2E9TA 2XLKA 4G65A 5A8RA 1IR1A 1RT5B 3DRSB 4AXJA 4C48A 1N5YB 3CGIA 4NCBA 1SC3B 4OX8A 4Q0BA 4NLGA 3MEGB 3LAMA 5HANA 5JMNA 1HMVB 1RAHB 3HHLC 4H4OB 1IKVA 3NAHA 1FDNA 2CJAA 4I2PB 2Y1JA 1VQOS 1PYOB 2G9OA 3AJ2A 1RHQB 1E6VA 2AX0A 4M5HA 5U47A 1VOMA 3TEGA 4LBIA 5C7PA 2K3IA 4J91A 3M8SA 3HVRA 3PYGA 2BW2A 5HQMA 2D3OR 2XHCA 2VJUA 1ZZNA 1X5TA 2ILZA 4PG6A 1S10A 2FJXA 2MZRA 4Z7YA 1Q82T 4LF8F 4ZKAA 1SC1B 2M2BA 2J6UA 3HFKA 4ZHRA 1T95A 3OHAA 1U7LA 1RU2A 4M8LA 2VASA 2C42A 3DMJA 1MROA 5F8GA 1JB0C 1O51A 3B4MA 3C16B 3M7VA 4L73A 3MUMP 1CG2A 4HR2A 5DGBA 5LJ3Y 4YB6A 1JLQA 3HZEA 3M8QB 1RAGB 1VQYA 2OD6A 3IM8A 4OZ1A 4XDCA 4LF8J 4TLQA 1ZPVA 3CTRA 1TL1A 2LECA 3U1LA 1RTDA 4JV2A 4EFAC 1YJRA 2RU9A 2HW3A 4ZLNA 2F40A 3DNCA 2AHOB 2RQ4A 4L3NA 5F0UA 2EFOA 4TLRA 1C2PA 2M9KA 4ED6A 2IAJB 1UPPA 1OY6A 2WVBA 4LBPA 3VGUA 3T5HA 4MJKA 3VV2B 4WFBQ 1KS2A 2V94A 2LYVA 3N6LA 5EX3A 2V50A 1OQ3A 2RILA 3A3OB 3QO9A 3CC4S 4V19J 3OR1B 3W9JA 3CMES 2NR0A 1RWNB 3L09A 1XEZA 2CJ9A 4OI1A 4CTAB 4CYUB 3RB4A 2D3O1 2W7AA 3W5YA 4NLDA 3CDAA 4B9VA 2QMXA 3R5GA 4KHPJ 3TARA 3AOCA 1RADB 1RZMA 2L48A 4CT8A 3UDEA 4ILLA 1P1TA 2EBGA 4ZVRB 2XS5A 3OQ2A 2LDYA 3D2WA 4UUXA 3LQVA 3EPGA 2GO9A 5KFAA 2LEAA 3AXMA 3MMBA 2VG7B 3EXCX 1SJRA 1ACMB 2OP5A 3MAQA 4J7CA 2HVZA 3GFHA 1XC9A 1QE1A 1WG4A 2WCXA 3ZO7A 5KG2A 4ECQA 3SZ2A 4IH7A 1H74A 1OIAA 3UNYA 5LJ5Y 4ECXA 1DLOB 2XY5A 1U6FA 3CJ5A 5CZXA 1H72C 3RGIA 3AB2B 2D3UA 1EETA 3AOAA 2I8EA 1UA1A 3RZAA 2FHKA 1H73A 4BCAA 3O3LA 2CDQA 3FDSA 1NSPA 1JMTA 3W8GA 4DV7J 2WOMB 2X1FA 4OQJA 2V6AA 3DKDA 2IPOB 3SCLE 4J9NA 4DV1F 2E66A 1Q4RA 4U7CA 1YI2S 3HHLB 3PRBA 4B3OA 1W26A 2WBMA 4F26A 1OPIA 1EZZB 3CD7A 3TVZA 1X9MA 5F9LA 1REGX 2CQ0A 3GFZA 4HACB 4NOHA 5LT5A 2CYYA 2DNYA 3WDOA 2ERRA 3PG9A 4NLTA 4B9LA 2VQFJ 5D4PA 3KK3B 1T05B 2MY7A 5H9EK 4CDIA 2DGQA 4QWBA 3NMAA 2K8GA 1XWLA 3CF5Q 1R7IA 5J2MA 2FZKB 1UFLA 3CIMA 4DX8H 4OX6A 1YX2A 1FRHA 1YITS 3Q8YA 5HROA 1GMWD 1OYDA 3E01A 5EUHA 1WOOA 2GNKA 3P5BP 3DOLB 2IC3A 3PYEA 2MJUA 3MMJA 3RAQA 1C0TB 1RTZA 2J9EA 2MPUA 4F04B 3NS6A 1XMOJ 1RK8A 3UO0A 3KLVA 1CULA 1L5UA 5L1IA 4IRKA 1WF2A 3EMTA 2JLFA 2QX0A 4HLBA 4NASA 4Q5VA 4L74A 2ROGA 3MAAA 2DR7A 3F73A 4KPYA 3DLEB 3VAHA 3R27A 4UZBA 4NCAA 1T7PA 1S99A 4ECTA 2A10A 4K59A 3U1MA 2GCFA 4JI8F 2HHWA 3TWZA 2W9CA 1UVJA 2X7IA 2YTCA 1NH8A 3JYTA 1IR0A 2QYCA 2BE9B 2G0JA 4QZVB 1WEXA 4PYDA 4JI3F 2UU9J 1C4AA 2IJRA 3UFCX 5DG7A 2CG4A 4KBIA 2IA0A 2OMLA 2Y8YA 5EWFA 4DV2F 3LO3A 2Z2LA 1GQEA 5IM0A 2ZM6F 2FTRA 2AYGA 1QSLA 2AX1A 2HFZA 5KT3A 4WU3A 5SZTA 3A3NB 5KFWA 2QT7A 3LOUA 2HRTA 2ZNYA 4Q44A 3I9V9 3D68A 1WHYA 4F4XA 2DPJA 1WELA 1GX6A 2N4DA 2V8HA 3VWSA 3KYLA 3CCSS 2RDJA 1FEEA 1VRTB 1EP4A 1FKOB 1FKPA 1MMNA 3C6TA 4DLEA 1T9TA 2VUGA 1EAYC 2NYHA 3FEZA 2R2TA 1YIJS 4IOBA 3NGDA 1IBLF 2RRNA 3CVKA 3HI9A 4TY8B 1GT8A 2YWWA 1D8YA 5HQLA 4JYAF 3WIUA 1N5YA 3M32B 2XGQA 2DH7A 1K47A 1N5QA 1D0EA 1MWYA 2CDRB 3C15B 3IBCB 3OTCA 4H4OA 5K9FA 4CI0B 4F67A 4DQPA 3QATA 4N56A 2A2DA 2W2MP 3MEEA 2OEJA 5A0YB 2XSJA 5LMNJ 1GTHA 1RHUB 1ZOTA 5BYRA 3R9LA 1L3SA 2XZWA 5ADZA 5IS2A 2XI2A 3DCAA 3R5JB 2V4RA 1IBKF 2OEKA 4I64A 2XY7A 1J5EF 3TA2A 3GV8B 2MQ8A 1NDPA 3BKUA 5CYQA 2R7VA 4E98A 3ZC4A 2DHHA 3DC2A 2E5GA 5KFMA 2DJWA 2OMOA 9RUBA 3VAIA 4X4SA 1CQNA 4K5SA 2HAFA 3JSMB 1TKTA 2KFNA 4DWIA 1HL6A 1NJWA 4NI2B 1TVRA 2VQEF 3RBDA 3IGVA 4PWWA 2R7XA 2ZHAA 2QLFB 1JLBA 3S1TA 1X4FA 1U1LA 1RTDB 1VK8A 3VZHA 3GSDA 3M6WA 3PHEA 1DTQA 1FFSB 2UUBJ 3X3UA 1HQEB 1JLGA 2FLOA 5D77A 4DR4J 1VC5A 2KU7A 2IAJA 2RF2A 1WTBA 2HMIA 1YJTA 3JTOA 3W60A 2HYIB 1MW7A 1OPZA 2R8GA 2IHR1 2V63A 1FT8A 5DZ6A 2O66A 5AT1B 1N32F 5I3UA 5DJBA 1N88A 2DR8A 3LH2S 5BR8F 1WD6A 3MFHA 1KHVA 1W25A 2KT5A 3FRZA 1HNZJ 3HHNB 3NOGA 5KFGA 3PO4A 4ZS6A 4X64F 2H4YB 2BANA 3K8VA 5GADI 2C2RA 3Q0AA 1NJXA 2XB2D 2YX4A 3GJQB 4MK7A 2W8LA 1KQKA 2HLUA 2LQBA 5FDLB 2MQQA 2HZCA 2EFQA 2HHSA 1RCXB 4DPYA 1RACB 3IMQJ 1LW0B 4YDXA 2HHUA 4H4MB 1SC4B 1N5TA 3P96A 3FMWA 4JUZA 5IT9Y 1BQXA 5A76A 3HVWA 2B3TB 1LK7A 1JXVA 2BA9A 3BREA 5HATA 4X64J 1SKUB 1X31C 1BC6A 2HS0A 4ZMMA 1SL2A 4RW7B 4PG5A 2HQFA 2K7JA 2B51A 5DGAA 2OH2A 1ZPWX 4USTA 4ENOA 2JEIA 2DCLA 1RYSA 1KOOA 2AU0A 2DGOA 2GVZB 2UUWA 3I4PA 1BQMB 3HO1A 2D9OA 4USJC 2YNFB 3H98A 4DR1F 2OPSB 4ECWA 4OI0A 5ETPA 1DRZA 5B0AA 4JI2J 3G9CA 2MB0B 4F25A 3OTEA 4OV1A 3H20A 3RG6A 1GNKA 4ZVQB 3LWLA 1U45A 4HH1A 4C8OA 3HKZD 1SJ1A 2PEHA 1Q7LB 1VYAA 3PEJA 4ECZA 1Y3JA 2RRBA 2YQ0A 4M94A 4IG3B 4LR9A 2QL7B 1LXNA 4YHHJ 4ZCKA 1IKYB 2KM8B 1VQ5S 4OYXA 1S6PB 4TU9A 3IR5B 2FGOA 1FDDA 2W01A 2Z2ZA 1URRA 1DJ0A 3U27A 1FKAF 3GE9A 2IDEA 3J7Z5 4DQIA 1L3TA 4M5DB 3OL8A 5KFCA 1U09A 3SSSA 1S0MA 5F8JA 1H2UX 3KLIB 1ZAVA 4WWSA 4YHHF 3T1HF 5C42A 4TQSA 5A6PA 1FI4A 3R1LA 5IT9U 3QLHB 3PJ9A 2AJ0A 4DCPB 3B6BA 3MPDA 4BWMA 1B64A 2VH7A 2LFVA 1XNQF 1XR7A 3GQCA 1HBMA 2Q3PA 1HI0P 2DNNA 2HVDA 2QGFB 3DLEA 1RU1A 3JB9k 4AL5A 2AQ4A 1N54B 3FSYA 3GJSB 2XHWA 4LSZB 4RUBA 4F4WA 1XNRF 2EVZA 2U2FA 5D0EA 4ETXA 2JWNA 4J37A 1VR6A 3HHEA 2HWIA 3C8YA 3GG1A 5L46A 2M8HA 3I31A 3O6QA 3AH6A 3NMRA 3CDWA 4CO4A 2B9WA 2L9WA 3ISZA 5G0RA 3PACA 3IRXB 4X4OA 4DSEA 3R2CJ 1WUUA 1S1VA 1HBOA 3O2IA 1V5IB 2PA8D 4EGLA 1X4HA 5E3AA 3G6ES 1R0AA 2PMWA 2H54B 1CJVB 3D0GE 5HN0A 3JTPA 3ZXWA 4FYXB 4WK3A 4NE9C 5DQIA 4BS2A 4O4GB 2ALZA 1VRQC 5DDPC 2CJBA 2MY8A 3WX4A 1OYEA 2FB0A 2YNIB 2QLWA 2CPEA 2ZC4A 2VA3A 4A46A 4W90B 3K7RA 1FNMA 2HAIA 2V69A 2Z8QA 2GZOA 3PX6A 4PZVA 3MHYA 4ECYA 4DQSA 2ZH4A 1KC8T 3DRXA 4RO0A 2ZH5A 2GIRA 2WONB 4CT9A 4TY8A 2VG6A 3MCMA 2CPIA 4X4RA 4DPUA 2K06A 3QZ7A 3KK2A 4U7UD 3W7BA 5E0OA 3OL6A 4DLGA 1DARA 2VU5A 5CCMA 1NBEB 1TTHB 2GS8A 3IR6B 4B17A 3W9HA 3OLBA 1WKJA 2HFUA 3PW7A 3TANA 1N32J 1T9WA 1ULRA 1WC0A 4LMZA 1M90T 2C2KB 5C24A 3GJTB 4H4KC 2HHQA 4I2QA 4DR6F 5D4OA 1U2CA 2BW7A 4TYBA 1X4GA 2H4WB 2VC1A 3KOAA 2HK2A 4NYZA 4Q0BB 1S72S 4DXLA 2KZMA 3TUIC 3QBCA 2PMZD 2LU1A 3VQSA 1W7WA 1DQ8A 2YKAA 4KFBB 2IFXA 2ZD1A 4ZCMA 4RNOA 2Y3YA 2AIRB 2ATLA 3KKFA 1WG1A 1NPPA 2YWHA 3JSMA 3RB3A 1TFWA 4IH6A 2VDHA 3MM9B 4NMLA 2J6SA 4B3TJ 3LWMA 2EI5A 1UFKA 2CZ9A 4Y34A 1SIZA 4PAAA 1GMUA 2BJ3A 3PKMA 3HVAA 3PM9A 1AFIA 1RAOA 3KHRA 4ZHRB 1IBKJ 3G8QA 2JL9A 3ZZZA 2ZH7A 3LP2A 3THVA 2X3DA 1KQFB 4YB1P 4OI4A 5H1SV 4RL1A 3V5RA 3L4BC 5LMNF 3MEKA 3VAKA 1EJ7L 3OSPA 2JH3A 3G6XA 1U49A 2VHGA 4X66F 1U1NA 3EPIA 4K4TA 4UUWA 1FE0A 5E3RA 2WAQD 5DM7Q 1UFWA 3H42A 4RKUC 2B4PA 4EBEA 1F6TA 3TEHB 4ALZA 1NNDA 1MWQA 4CWBA 1FFWB 2Q6BA 4ZJLA 1X5SA 1HHQA 2QZ8A 2BOAA 4OZLA 4ES2A 3C2PA 1OSCA 1M0SA 2G2ZA 3H7HB 5KFPA 4OX9J 3IWLA 2BJ1A 5HLFB 2VPWB 4O0NA 3QJLA 1ZS6A 2LU2A 3NGSA 4CO1A 4CLPA 4TNOA 4H4MA 2QA2A 3R3TA 3RB6A 1NK7A 3NY0A 3O1LA 2XQCA 4JV5F 3GCWP 2MLZA 3I56S 2KVIA 3GTYX 1CJKB 1TKZB 1H3DA 1PKUA 3PHTA 4P52A 1S1XB 2QMUB 1C4CA 2EC2A 3M30A 4KO0B 4RW6A 1ZM4A 3ZTQA 1TKXA 2E1AA 1Y10A 2VFVA 3EVOA 1WDDA 4RX6A 4YR3A 3VGVA 2E5LF 1HR0F 4QCLA 1RI7A 3CD0A 4PQUB 4USVA 2XYPB 3OXLA 3PEHA 3AA8A 4J9KA 3X1LB 2GVZA 4QU7A 5H9FK 2WVFA 1E6YA 1IM6A 3FBEA 3P4UB 4C98A 1SQFA 2E9RX 2O01C 3DLHA 1Y5IB 4CLTA 4WFXA 2KM8C 3CCQS 2VBXA 4JI8J 1UCNA 1VJWA 2RD5C 3LPEA 2HVEA 3FJ2A 3EE3A 4HI2A 4TY9A 4UTGA 4K4WA 4KTQA 1VRUB 2QV6A 3MGJA 1HWIA 4QR0A 3IRWP 1OJ4A 2UUAJ 2VPYB 4IG0A 2U1AA 3QFWA 1LWFB 5KFZA 2KJVA 1HARA 4NLXA 3PFOA 4URQU 2DNMA 4U8YA 4AFFA 4DDFA 1TV6B 2OAUA 3GJRB 5KFDA 3Q2TC 1CEZA 3QGPA 1TL7A 4WFNQ 2MEWA 1HA1A 1MNEA 1VIOA 5ETQA 4RZRA 2WK4A 2KT3A 2CIMA 3J7AN 4I56A 2PFDA 4EBDA 2RT3A 2MLYA 3F56A 4O0IA 4EBCA 3CXCR 1EX8A 2XY6A 4N77A 1O5JA 3TZYA 4ILMA 5CQGA 2IVFB 2ZH9A 2QLBB 4DQRA 1HNXF 3IBFB 2UUCF 2EG2A 3MOZA 4QIFA 3KLIA 1MMLA 4PPDA 3W65A 1MMDA 1JJ4A 2YY3A 2E44A 5LM7E 3GWCA 3R5DA 3GYNA 1VK3A 2ZFHA 4USHA 4DF4A 1HQUA 5H9EJ 1TR0A 1UEUA 4NCGA 2CG8A 2M4MA 2GIFA 4OHVA 1UVLA 3A1YG 1SPBP 4DV1J 1R6YA 1GMWA 1DHMA 1B0PA 3DLGB 4DG1B 5F9NA 2E7WA 3K58A 4F0KA 4ILRA 1KD1T 1K73T 2L08A 5AJ3J 1RBOB 4DR3J 4FF1A 5K8PA 2QJ3A 3SFGA 3JAMY 4A8FA 1KEKA 3CCRS 1RT2A 2XMTA 1S0OA 4NLWA 5KFJA 5KTQA 4HKQA 1S9GB 1J2VA 3BBFA 4JP8A 1LFPA 1UAWA 5A6WA 5G0RB 4C0BA 3TZZA 2FJDB 2DR9A 2QTWA 4G1QA 1M1GA 2E5JA 5DZ7A 4WF9Q 4A47A 4X4UA 3TYTA 1EKRA 3ADAC 3I5AA 3EGNA 3HULA 4DL2A 1L3VA 4IFYB 3GPAA 5IWAF 2MGZA 3T41A 3RB0A 1Y5NB 3TA0A 1U02A 2BJ8A 5LMUF 5HL7Q 1CQMA 4CRJA 4P7TA 1I94F 4O23A 2RSQA 1RWKB 3GZ7A 2GHWA 2ROPA 2LLZA 3EM1A 2XLIA 2N4CA 3ZFVA 2KT2A 3Q86A 2CQPA 4FF3A 4DL3A 4N76A 3M9OB 2E1MC 3W66A 1YRUA 4O3PA 5CABA 3G2XA 4HT5A 2E9ZA 3EZUA 2AZ1A 1RAAB 1VRTA 3HLUA 1HD1A 1VHFA 3FEYB 4ECUA 2RQMA 5J2NB 3LGMA 2PC6A 2AYBA 4LR8A 3OPKA 4RW4A 2OELA 5DDOC 4LF6F 3I9ZA 2YNHA 2K1RB 3K5NA 4KT0C 2W9BA 4IQXA 2GV1A 2B5JB 4B02A 1PGZA 2W7PA 1B99A 3BN4A 2ZD1B 2V68A 3D67A 2W8KA 4B3SF 3OW2R 4QIGA 2IA6A 2JFDA 2P9CA 2R7OA 1Y4ZB 2DNOA 3PNIA 2R8HA 1FRXA 3RRKA 2RS8A 2CQ3A 5AE1A 2Z57B 5A8RB 3EX7B 1S59A 3K8WA 1WC1A 5IZHA 1RT5A 1FRIA 2R2RA 3NBPA 2E29A 2QEXS 2BJ9A 5CYQB 1Z2LA 1FJCA 3TW0A 3Q24A 1N52B 1RHKB 3GYGA 3IP0A 2J7UA 2V8DA 1T02A 2ZUAA 4TU8A 4P7VA 3KJVA 2I6WA 3IM9A 3E8OA 2GJIA 1IKWA 5DO2A 3ZTRA 1VQ6S 2HHPA 3IC1A 2J0QD 4NMXA 2QSWA 4RNNA 3MR3A 4JV1A 1RA7A 3C19A 4A48A 3AFGA 4WFYA 5IC4B 3HT0A 1BQNB 2NPFA 4C0OC 3RJMB 2IJFA 3DMJB 2VBZA 3Q83A 3D3BJ 3NP5A 2MHEA 2G0CA 3TVYA 5KFYA 1MSWD 4XDDA 3DDNA 4GKJJ 2QL9B 1UWBA 2LQ5A 4KKOB 4QYRA 1UJ6A 5HVFA 2W7OA 3KK1A 3HFVA 3HXMA 3CSKA 3JSBA 1HPZB 2EK6A 4GMKA 2XTJP 1TL1B 4OYAA 5I42A 3FK4A 1VQKS 1X4CA 3QJPA 1Q8KA 3BR8A 3I5BA 3QWUA 3VAMA 3W5XA 3PJXA 4QPXA 2M52A 1EQMA 1NSKL 3CJQA 2HQIA 5ETSA 1WC4A 3HT3A 3GIKA 2UUCJ 2EK1A 1TKXB 4DSJA 3MEDA 2MKCA 2RS2A 1FK9A 4NLUA 2YQ1A 4FYDA 3DOKA 1JLCA 2RHQB 1DAXA 4LF7F 2HIYA 3PRDA 2MZJA 2OO4A 1TAQA 1T8EA 3N6MA 4YDDB 4BDPA 1UP1A 1E6YB 4RUCA 1U48A 3D1QA 2BV3A 4NYPA 2CJQA 4X65F 3MR2A 2COLA 5KFTA 1I1GA 4DU7A 4A8MP 4TVAB 1DQAA 1HYSB 3UD3P 1U2FA 2FZGB 2HBQB 3NS7B 3AXKA 5T7LA 2KI2A 1FVSA 4LF4J 3Q8QB 4HHJA 3IFEA 4F02A 3G82B 2FHJD 3FMBA 1NZAA 3PCOB 3MM5B 4ECRA 3P49B 3MMCB 3CJ2A 4DV4J 1TUWA 3CCJS 2H48B 4DUZF 4ECSA 3BYPA 2DNKA 3SQGB 2KYZA 4Y3CA 2AEMA 1IQZA 4X4PA 2KFYA 2M7SA 3CCES 3V6KA 2Q79A 4TN2A 5KFNA 1S12A 1S48A 4MIAA 3AJ1A 2DH9A 1RXOB 4QWCA 2YWEA 3EVMA 1P6TA 2HNDB 5J2PB 1XBWA 2B0GA 2D41A 1RLCL 2JC1A 3BV8A 3ETMA 3JSYA 4MAKA 1NMEB 2IVYA 5HQ8A 2HNZA 1S6PA 3NNAA 2DNRA 2JX2A 2BXJA 4LRCA 4AL6A 1CPZA 2CNNB 1YZ6A 3MR5A 4OFZA 3FC9A 1Y00A 1R6VA 3M2VB 4NCGB 1U47A 3NLCA 3GIJA 3L7UA 1QAXA 1AUSL 1SH0A 1BD6A 4PYAA 4RBTA 1FJGF 2BQ3A 2CRLA 1IJEB 1Q1KA 5C42B 5I3QA 1S6QB 2FD2A 2GHVC 3FBCA 4P6QA 3Q89A 2D7SA 2NXUA 1FRLA 5J2MB 1FXLA 4EI2A 2F65A 3CWJA 1JJCB 1RT2B 2CVIA 5T41A 5CYMA 3N6NA 3DOMA 4J9PA 2XYGB 5M2RA 3DM2B 5J1PA 3MUVP 1J5OB 4B9SA 2GA7A 1UVMA 2WSFC 2YKOA 1Y9OA 1TELA 4QIWD 4IUFA 2K2PA 2N3LA 1CVJA 1CULB 3I0SB 2I5JA 4TQRA 4ZPBA 3HHLD 3T3FA 1TFYA 4XK8C 3MAAB 4OX7A 1MG7A 2DGWA 4NX9A 4MT1A 3U7JA 3OR2B 4NPOA 4J9LA 4FS2A 4A8YA 1N36J 1ZH5A 3W9IA 4F3OA 4LFBJ 3MPYA 5B08A 1H7XA 4CO2A 3Q8UA 4O3OA 1LV5A 1HBOB 4E8UA 1R0AB 4ED8A 2LKZA 3IR7B 3JYTB 3FEXB 2HK3A 3I0RA 1F5CA 1C0UA 2ZC3A 2ZEJA 3TZXA 1IUJA 1U2RA 2YNIA 4ZCLA 4QBUA 3DU6A 2PEBA 1FXDA 1MWZA 4LJMA 4OZNA 2JEGA 3ICLA 4KAIA 5IM0B 4HT7A 4ANCA 4I1TA 3PX0A 3HSZA 1WF0A 4FS1A 3R8YA 3IAM9 3DYAA 3KK2B 1KQSR 4DSLA 2M5YA 3AD8C 2HIQA 2OHDA 1N0UA 3GCXP 2UVVA 2FPHX 4XPCA 2DY1A 3R5BA 4JB8B 4N7TA 3CCZA 5GAGI 4DFJA 2WSEC 4OYBA 4RBVA 4LF1A 1T3NA 4F4YA 4DQQA 4V1Ak 2DNHA 1FKPB 5KT5A 3J7YI 4A8KA 2JEJA 5KG4A 1IKXB 2XMVA 1OWXA 2AJ1A 2G4BA 1GMVA 4YB5A 5C24B 2IBOA 3LGNA 4X4TA 1HIYA 1UKUA 1XIQA 2BUNA 3BBCA 3DLJA 1T3OA 2OLWA 4S0MA 2KRRA 4F3QA 3KLFB 2NCKL 3NBPB 2NZ4A 2YBVA 3IA0A 1KLNA 3JAMU 4IDKA 2CJYB 1MU2A 3R5AA 1NK5A 2YNGA 2E7XA 3DGPB 4WXWA 1W2IA 3DN9A 1YRXA 2F4FA 4ZVHA 1Y0HA 4R25A 5KG1A 2HZVA 5A0YA 2VL1A 3POTB 3MR6A 5KFVA 4DV6F 2VG5B 3T9NA 2KZZA 2DBBA 4JV5J 4RUAA 4Q2MA 4ED1A 1TUVA 2ZOMA 4Y2KA 3PO5A 4M95A 4L72B 1JK9B 2CPYA 3NGTA 4KYZA 4M5KA 4XO0A 3VAJA 2M8DB 4C8KA 4E0DA 3MECA 4DJBA 4Z37A 3DU5A 4ZPDA 2OSRA 4OX9F 4N5SA 5B0GA 3AY0A 3DRYA 2DEIA 1NK8A 1ELOA 1FD8A 3UN5A 3AODA 4PXEA 2BEFA 4KGXB 4KGMA 4JBCA 4U67Q 5GMDA 1YZ7A 4NI2A 4K0KJ 4DV3F 2YPZA 1U1QA 1NM2A 3THPA 2IVMA 3UNGC 7FD1A 1JLBB 2V8PA 2DXFA 5MAOA 3VALA 1RT3B 1KFDA 1NHKL 3H40A 3A8EA 1B0TA 3T1HJ 2FDNA 3BSAA 4FVMA 1X4AA 4ZP8A 1U1RA 4OJGA 3BSOA 2DVIA 3KUHA 5CA5A 1HWKA 3WZ0A 1XERA 2RF2B 1V6HA 2WVEA 2ZHOA 2LA6A 2Y0BB 1FCAA 4YEAA 5KFRA 3TJ8A 1WI6A 1UL3A 4RR5A 3OD2A 1U1KA 2FVRA 3N28A 3EZOA 1JLQB 1ZA1B 3DOKB 1NLKL 1LWXA 2ZKUA 3G87A 3VGTA 4BLGA 1N48A 3L7PA 1AFJA 1K0VA 1X0FA 2VDIA 4OYMA 4ZPTR 4GC7A 4ELTA 4UY85 1VC0A 5HO4A 3ETOA 4CLFA 1CJKA 4NLQA 3BF4A 1V5VA 2ZE2A 2HHVA 1SJQA 1N4LA 3DLBA 3ZTSA 2A18A 3KTQA 4UW2A 1Q53A 4OI2A 2DXDA 2VBYA 3G82A 1LWEB 1VJQA 4F7VA 3M9MB 4QYZK 3PYFA 3ENAA 1WNEA 1HWJA 2VFUA 2KXNB 1VQ8S 1NK4A 1S76D 1UEVA 4DR6J 3UI3A 2AD9A 4IRCA 3H5YA 1PC4A 1WSVA 2B4UA 4K8RA 5IV3A 1RE1B 4EZ6A 2RDIA 2DNGA 4OJHA 4JI1F 5H9FJ 4NXMF 1Q79A 3WQPA 1YBUA 3CEDA 5KFBA 1OO0B 1GAOA 1L3KA 2I1RA 4RW7A 4J9SA 5FIIA 2BR0A 3BYRA 3BKTA 1KDNA 2C2NA 5EWEA 1NUEA 2LVWA 3L9ZA 1WKLA 2VBWA 5HP1A 1NH7A 1UZHA 2GAGC 1VI7A 1S1UB 2YNFA 1N5SA 3R2DJ 2B6AB 3PYDA 2B56A 2KYXA 3ZZUA 2B7BB 1CC7A 3IG1A 4AXIA 4DCJB 5KG5A 3B54A 5J2QA 1NJZA 1DLOA 4J9UE 2BYCA 3ILOA 4ED2A 1NDCA 5KFSA 2CJKA 1M5OC 3OT9A 3NL0A 2C3MA 4I6YA 1BXNA 1YTYA 4EO8A 2R4FA 1GXUA 1U6BA 4LREA 1S6QA 2RUGA 1FJGJ 3P6YC 1FWLA 1X4DA 1NRKA 2F3JA 4B3OB 1HBNA 2NPIA 2Z30B 3IGNA 4NEYA 2OPPB 4P2SA 5ITHA 5AXMA 1NDLA 4RNMA 2VIHA 2BDPA 4PRFA 2HNYA 2W2PP 3ZZTA 5KT6A 4LVOP 3R1HA 4M5DA 3DOMB 2ROEA 3CB4A 5HK4A 1LKZA 1TK8A 2UZAA 2QA4S 1HWUA 2XS2A 4JV0A 4LRBA 2P6SA 3DLGA 4DG1A 3JXOA 2MQOA 3KMSA 4GKKF 2JLEA 2LDIA 5C2GA 4GRSA 4WU2A 1NSAA 3W1YC 1HWLA 4DX6A 5L1KA 1SL0A 1M5KC 4TYAA 3A8IA 2DB1A 3LP0A 3N01A 4W4MA 4DL6A 1SI9A 2Y0SD 1NK6A 4WZQA 1HBMB 3OR2A 1S9GA 3R97A 4C8ZA 3DOLA 4K4XA 3CW2C 3UDLA 2WHOA 3PFEA 4ED0A 1JQGA 1JLAB 3WBZA 2GGPA 4C8YA 4LQ9A 4RPFA 5E3CA 1HHSA 1URNA 2ASDA 3W61A 1VQSA 4KRWA 4IFYA 5D3GB 1EIYB 3MXHP 4I6AA 2JVOA 1H0HB 3GFXA 1FRMA 1V3ZA 4Z7CA 4OZ3A 2CADA 3FCWA 5L9NA 4DR2F 4ZLPA 3NS5A 1JLEB 1KKHA 3SMZA 2QA4G 3TUPA 3QNWB 4CM2A 2BM1A 2AGQA 1NEEA 2V2VA 2BJDA 4B3RJ 3BH7B 3O44A 5IT0A 4OJ3A 3AAWB 2ZH8A 3RR7A 2DCUB 3D3CJ 3W64A 5C2CA 4G1PA 3KG4A 3V4MA 5D78A 2KO1A 1S0NA 2EKNA 4DR1J 2L3MA 4FKXA 5L38A 3FSIA 4MYTA 5J2NA 2ZDOA 3DDKA 1Q7YT 5F0WA 3CDBA 3MPWA 4PG7A 4RW9B 1NU4A 2MKHA 3KUGA 3BR9A 4NL5A 4TKTA 4BWJA 5T14A 2DT9A 2W9BB 1VS3A 3ONQA 2C3PA 2VJVA 1A6LA 1LEOA 1KVIA 3DGPA 2Z2MA 1EP4B 3QT7A 4CO3A 3OXGA 1YKWA 3JQJA 4NLRA 2AYEA 4O3QA 5CZVA 1JX4A 4DR5J 4EUVA 2XWYA 3G8TA 1GH8A 3P8BB 4I2QB 3B78A 3ELHA 3O8WA 4OZ0A 5IC6B 3V4IB 4UY8T 2J0SD 2Y8WA 2EPIA 4R8UA 2XZTB 5KT2A 2FC9A 2ASJA 4P9SA 2AYMA 2CNKB 4KFBA 4LIWA 3OHBA 2ZNZA 2ZZNA 5DG9A 1VCTA 1SV5B 1FTRA 4IOAQ 4PABA 4WFZA 2HBZB 3KHLA 3BGRB 1KLMA 4Q2LA 1IKWB 3RAMA 1UVIA 3CO0P 3HJVA 2KG1A 3BO3A 2O1PA 2XM3A 4PCQA 3HD2A 1SJ4P 4K4SA 2LQ9A 2CFXA 2LP4A 4WKYA 3TUJC 4KY3A 1BQNA 1RT7B 4CIOA 1KRPA 3WC2A 1XMOF 4FF4A 1T94A 1U1MA 3HFZB 1NKBA 1NCLA 4R5PA 4DR4F 3ZZPA 2UUBF 2ADBA 5LXYA 2V4JB 2HHHJ 4ZVUB 3TAMA 1DY3A 3KNAA 4FNHA 2VQEJ 5ETMA 4DL5A 1Y7PA 2HKEA 3MF5A 3HPOA 1XNRJ 3UR3C 1Q8BA 4FF2A 2HEKA 3D6FB 1FO1A 2VODA 3M1VB 2H65B 2AV5A 4L6V3 3KDNA 4A8WA 1R8CA 2A6MA 2HQCA 3MEDB 4LSNB 5AE3A 1SCJB 4B9TA 1WEYA 3C6UB 3VTIA 4EZ9A 4N8OA 1KTQA 2EWHA 3FCHA 2ZDPA 2GQ2A 2HQDA 2BKOA 3DHWC 2PN6A 3ENVA 1LXJA 3MAHA 3LP1B 3MDFA 4I7FB 3TQEA 1KVKA 8RUCA 3WX8A 1R8BA 3T5KA 3M4XA 4LF4F 4QYZJ 2HHTA 2DNZA 2FHMA 4EMDA 2AEJA 1S97A 3DGVA 2VFTA 4GVBA 2Z56B 1UETA 4G6VB 1I94J 4W92B 4X65J 2RUSA 1Q0NA 3T5LA 2BM0A 5HJYA 4QWAA 1UEKA 4PUOA 2R2UA 1R3NA 4MFBB 3RR8A 4NXNJ 3HSJA 5IQ6A 1VFJA 3MM5A 3NGKA 1FE4A 2EFNA 3MMCA 3UWTA 3MR7A 4WXOA 5HP1B 3K59A 1QAJA 3ITHA 1S1UA 4CLKA 1LWCB 4I68A 4B9UA 3SQGA 2XLJA 3ZZOA 1ITPA 1S6UA 3BO4A 4DV5F 2EG1A 2YKMA 3DRPB 4DOZA 1QAYA 1VRUA 2O5DA 4PXCA 3RAXA 2Q1LA 4TXSA 2M88A 4DL0C 1NHUA 1S1WB 1U24A 3V81B 1YJ9S 1LWFA 3TNVA 3PTWA 4DR3F 1T03B 4NRUA 2OUGA 5J1EB 2G1DA 1BQMA 2WVCA 3KJNB 1IXKA 1G6BA 1H98A 1TV6A 2CQIA 5HI7A 4OYZA 3S8SA 2R7RA 3D66A 4H4KA 3EXYA 4YB7A 2DISA 5KG0A 2CPDA 1FESA 3LW5C 2R7TA 3QGGA 4HDGA 4ZVEA 3TX8A 5K8MA 2BVZA 4ZLJA 3MOJB 5FLXU 2UU9F 2DGTA 2P9GA 4JI3J 4WP3A 1CJTA 2HGLA 2R7WA 2P5VA 2W2QP 2X1BA 3R6GB 4M5GA 3ZTOA 1VLYA 4Y2MA 3PW2A 1BY9A 1ZETA 4YR0A 1B7FA 4JI5J 3QAEA 2ALYB 3K5OA 1GEHA 1XQIA 4P75A 3HJFA 5F8NA 6FDRA 4IH5A 2NXJA 1YQHA 3DLKB 2NXNA 4ES1A 1S6OA 2DHXA 5LSOA 3L3CA 2ZITA 3IO1A 3BQ1A 1RWWB 5DLGA 4L75A 3LP0B 4LBHA 1HNIA 4CZCA 5K8OA 3GMGA 5GAHI 2W4DA 4AQYJ 3BGOP 3TVKA 4CLWA 2EKYA 2FHJA 5LSRA 2BRKA 1F2HA 2FUG9 3OTBA 4DS5A 1J5OA 5CXTA 2OPQB 2LXIA 4ZN1A 1DBDA 2P2CB 4ERDA 1SKWA 3P45B 2IM3A 2DEJA 2QLJB 3I0SA 1RT4A 1SUQA 4ID8A 4OYPA 4QIEA 2FJVA 3QIDA 3UDVA 4NYOA 2LEPA 3KNGA 1UPMB 4N41A 2KVQE 3NG8A 3GILA 4P10A 3EDQB 3KLHA 2CA9A 2XCPA 1XK8A 5DDQC 1PBUA 3MCOA 4YOEA 1H38A 4LSLB 3OJUA 4NZ0A 3JSRA 4AE5A 1N56A 1N6QA 2ZH6A 4O3SA 2CUYA 3OJSA 4KGKA 3UPFA 1CS4A 5JUMA 1Q16B 3GU0A 1AYEA 4O44A 5FLXY 4AD6A 2XO7A 2B43A 3IRXA 2XMJA 3MPVA 3ISND 5BYSA 5IT4A 2ZM6J 2YH1A 3L7OA 3ZTPA 4C11A 5LMUJ 1S77D 5E41A 2NXEA 2OJ3A 5ETVA 4PKDB 4ZDNA 2VB6A 1M5HA 1BGXT 1GX5A 2YXLA 3D1OA 2W24A 1QTMA 3GONA 1NSQA 2AMCB 2ZWOA 2Z58B 3FSXA 2QL5B 3AD9C 3MUTP 2PA3A 2PI4A 4QW8A 4UOGA 2UXDF 3W3SA 3SV4A 5B0EA 2HQ3A 2YH0A 2ZKTA 4DEZA 2YWFA 1KVJA 2NUUG 2VG6B 5CD4A 3QRRA 1D1UA 3CD6S 1O8BA 2J9CA 3GP9A 3NGUA 4ZJQA 4R8UB 1FFGB 3UD5A 1D9DA 4WTOB 1RGVA 2AP6A 5K8NA 1JNZB 1H6KX 5DQHA 5AJ3F 3M8RA 3W2WA 2JZ5A 2PI5A 2NUHA 4PWUA 3PDNA 1KP6A 3POTA 5DRKA 1RT6A 5HBMB 4KHPF 3US5A 4QR1A 3NRBA 2DY9A 1YJNS 2RAQA 5HMWA 5E3PA 2C2DA 2CXEA 1TK0A 3H2UB 3QSIA 1AB8A 2X51A 2MHNA 2WB4A 3BZQA 3MFIA 1R8PA 2BMBA 2FVQA 2RH3A 4HYKA 2V9WA 2OKQA 3B82A 4R5PB 4Y2CA 4F36A 3KJVB 1KN6A 2J8AA 4FKYA 2Z4PA 1S9EA 1YK9A 2XMMA 3EDRB 3F41A 3MCSA 4AYBD 1JIHA 2UVWA 3TAMB 2VFRA 3RRHA 4RW8B 2JDJA 2BKPA 4FXVA 3FUYA 1HHTP 1RT3A 4NA2A 1D09B 4YUDA 3LP2B 2CQDA 3D28A 1QVFR 3M1VA 4CM0A 3N0VA 1VBXA 4P2XA 2AZ3A 2ZZTA 3D5MA 5K14A 5JVHQ 1P9QC 4ZVSB 2JHEA 2RVJA 1N5VA 4KKOA 3D6HB 5E33A 2PT0A 3AQOA 2B4OA 3FQKA 4EO6A 3AT1B 2UUAF 1HPZA 1RWMB 5LSLA 3M8PA 3T1YJ 2V2QA 2PDAA 4KR0B 1WHXA 5F41A 1D9AA 3CCMS 2GO8A 4D3GA 1XR5A 1QLNA 4TU7A 3MD1A 4GVBB 1IBMF 3BPSP 1TMJA 2CQBA 1FD2A 3BGLA 5BJRA 3KMQA 1JWWA 4JI5F 1ZM9A 1CJUA 1YJ7A 1RSCA 5ETNA 3PJWA 2MZTA 4ZN3A 2ATCB 5EHHA 4O3RA 2J6TA 2VV5A 3CMQA 4MFBA 1JLCB 1YRTA 4LR7A 2YVSA 3BDEA 3KWMA 5IOLA 3TP2A 1QSSA 4ZVFA 3GIIA 4ED3A 4IRDA 4ZPAA 3GYXB 1P8GA 6FD1A 3CE8A 1AT1B 3H5UA 4PPZA 5A8KB 1VBKA 2VFSA 3ITHB 4RW6B 2NS1B 5A2QY 3M30B 3RBXA 5ETOA 2A6OA 4K4ZA 4FNIA 4LF9J 2DR5A 4WTYA 4MKAA 3SFUA 3THTA 3MZIA 4OI6A 1C1CA 1X5OA 2DYAA 2MKJA 3P3DA 5HAOA 5C25A 5L1JA 2WBRA 3BKFA 3QGHA 4ZPWR 2MKSA 3EGWB 4HL9A 3RUBL 1S1WA 2ZBIA 1HR0J 3HF5A 4IYQA 2ZWPA 3W8PA 2R7UA 4C7QA 1RKIA 4R0JA 2B8PA 3WHIA 2VOPA 3A8JA 3NOCA 5D0GA 2XGPA 4OZJA 3CC7S 1X4EA 2B6AA 4DFPA 3KFWX 3I32A 1T11A 4LF5F 1QUPA 5DS7A 3BQ2A 2NSBA 1PG5B 1RJJA 2GC8A 4M5IA 1WG5A 1WOSA 5HVHA 2HZAA 2HBRB 4LRDA 1XNQJ 2LEBA 3E2EA 5DDRC 5C5JA 3H4BA 2UVRA 1SC6A 5CH7B 1G2EA 2UXBF 3HZGA 1U8WA 2WW4A 4X66J 1B70B 4DU8A 4MKYA 4K4YA 4WP8A 2A1BA 1TL7B 3VHQA 3J80Y 3PW5A 2J8SA 4FDFA 2IM2A 2WVDA 4X2BA 3CDUA 2E5HA 3EZ5A 2GHPA 3LAKA 1R31A 3EICA 3MTJA 2HNYB 4YY3F 2D3ZA 2QC3A 3CCWA 2BQRA 2RKIB 1QJHA 2OSQA 1JKHA 2DKOB 2V8VA 4JI0F 4DF8A 1VQ4S 3UN3A 4DMZA 2MKIA 1N34F 1PILA 4M1KA 3K2YA 2R42A 1RB0A 1TKDA 4KC5A 1NPKA 4ZPCA 2EFGA 5B0CA 2V9KA 3M6VA 1YLXA 4KGVB 3HSDA 1X5PA 2HHHF 1PYSB 3TX0A 3BDPA 5CYMB 2H3EB 4K7QA 4NLOA 2FY1A 4EWTA 2MTLA 4JI4J 2F8HA 2MMYA 2DGSA 3QAUA 1I5OB 1JJ2R 1GXTA 1I51B 1ZM2A 4X62J 2HURA 1LNQA 3FFIA 1DFDA 2IYGA 2ZHBA 2DGXA 3PIPQ 1VBZA 3GSIA 1UW4A 2RQCA 4HHHA 2YX7A 1X9WA 2C2MB 2PD1A 2OPRB 1RDRA 3RW7A 1JLEA 4MK9A 1FRJA 2FYXA 3Q23A 2NSCA 3ISNC 4EU0A 3Q2SC 1RLDA 1ICEB 3D6TB 4KB7A
chains in the Genus database with same CATH topology
2B7CB 2RNEA 4I67A 4CCHA 1FEHA 4KE5A 1HNVA 4Q45A 1ROFA 3FZBA 4Q43A 4K4UA 4HDHA 2R7SA 1NKEA 2MZ1A 1F5AA 3HVTA 1SJFA 3O5TB 3QWPA 4B3MF 5B0DA 4ETZA 3M2UB 4ERDA 1OQ6A 1YGYA 1IKXA 5JXSA 2KXHA 5D4LA 3I55S 2KZMA 2HVIA 1U1OA 4PWDB 1JLFA 2UV8G 4PQAA 3V4IA 2K1RA 5B7WA 3GR1A 2YWKA 2BBEA 1TK5A 3OBIA 3OTDA 1MU2B 1TAUA 3DHXA 1TQLA 2YNGB 5GADU 2NYIA 2C28A 1S4FA 1SV5A 1S49A 2VG5A 3BN7A 4IR1A 1KLMB 2ZVSA 5E2QA 4BBYA 4HH0A 3BSCA 5KT7A 2B4VA 1Q78A 3MMAA 3KLEA 4LQ3A 4JI6F 4EYIB 4FP9A 4IFVB 3MECB 4C3KA 2CPFA 4NLYA 5SUHA 5GAHU 1VQMS 1YBAA 2V4QA 5KFEA 4NA1A 2PO4A 2DO4A 2ZUGA 3V6DA 2G13A 4Q7AA 4I4BA 5KFKA 3BB5A 3MD3A 1DTTB 2GJ2A 3SCIE 3CCLS 3N4WA 1TZ0A 3PKYA 1NB7A 4IQMA 3RYLA 4F2SA 3IS9A 2BACA 4I0WA 5KOWA 1HI8A 1AUDA 2PFFB 3OR1A 2C3UA 3LP1A 5F8IA 4X4NA 1HFEL 3I87A 2EC0A 4A4JA 4NLSA 3SDEB 4PXDA 4X4VA 2IYIA 2DHGA 3QMQA 3CJKB 4J9QA 1H2VZ 4KHMA 3NNHA 3VF0B 4X84A 3H2VE 1Y3KA 4PUOB 1FK9B 5C25B 2LCWA 5KG3A 2F7VA 3H4DA 1X8DA 1F9FA 3U02A 2DK2A 4IOCQ 2MYFA 2MQPA 2WRMA 2R8IA 3KLGA 1LWCA 3W2VB 3QZ8A 1QAIA 3I6PA 2IM1A 1HNZF 1HYSA 4DUYF 2ADCA 2BRLA 4BC7A 2KKHA 2KJWA 3ENQA 1RT1A 3UDCA 1Q8IA 1D9FA 3V81A 2OTJS 2XBPA 2D74B 5HMYA 2KN4A 3BSNA 2WOMA 1I6JA 3S7RA 4DBQA 1WHWA 4CO0A 3IG1B 2H9ZA 5B0FA 4B9NA 3HHLA 2J7WA 4F8RA 4C3LA 4M94A 2QIFA 3TI0A 3OFEA 4ZP9A 3G8SA 3OSNA 2HG4A 5I4MA 3PX4A 2VA2A 5J2PA 1K1QA 2C2EA 3OFHA 4JOUA 2VQFF 1T05A 2QO3A 3D0HE 2HNZB 4ID5A 3HM9A 1K9MT 1HBNB 3ZZYA 4RWWA 4FBUA 2J5AA 3LPYA 1QY7A 2VPZB 4YFUA 2VKZG 4KJIA 3HMJG 1RTJA 3E01B 2R9LA 4DPOA 3T19A 1LW2B 4V19X 2XS7A 2DTJA 1LQ9A 2SXLA 1C0TA 2MQNA 3LALA 4LUBA 1FNXH 4DV7F 3DXBA 3PY8A 1RT4B 1SUQB 4KV8A 3LF0A 1V3RA 1U25A 1S1TA 2BOPA 4WKRA 2DIVA 2MSTA 4B9MA 3SSRA 5DETA 3EUNA 2OPRA 2W9CB 4Y6IA 2ZJQQ 3DXSX 3B8HA 2GGPB 2JFKA 2XNQA 3OUYA 3OFGA 4LSLA 3P5TL 5D3GA 2J0XA 3UQSA 4DSKA 2E1CA 4PXBA 3OL7A 1G3OA 4ED5A 2RJZA 2AF6A 4QU6A 1R89A 3N9UC 2CQCA 4Q8EA 2R8KA 2VZ9A 2QMWA 4IO1A 3IWNC 3I0RB 4CO5A 2MDAA 2LXUA 1RQ0A 2Q66A 3C6TB 2JEFA 1V9OA 2AWZA 4ECVA 4HI1A 5KFFA 1YJVA 1JLFB 1OSDA 3KG1A 2GMJA 2EFPA 3DYAB 4RW9A 5GAEU 4A8SA 1Y5LB 3T1YF 4WJBA 2FVSA 1FTCA 2KRBA 5GMKa 1YVFA 2DHSA 1TL5A 3S6EA 2IRYA 3W2WB 3MEEB 1NJYA 1B0VA 1RT6B 5HBMA 2DGUA 4WFAQ 2P6TA 4CH1A 2I2YA 1R8AA 4C8MA 3DRSA 4PG4A 4MTPA 2FJAB 3KLEB 1A9NB 1JXEA 4IFVA 1U4BA 2YKNA 4IDKB 1VGYA 2ASYA 2F1FA 4MKBA 5KG6A 2CQGA 4RNFA 4OIXA 3J81Y 4I2PA 2UP1A 4WE1B 2QSFA 1CSJA 2AJFE 3MI7X 4PQUA 4UQTA 1TKTB 3FRYA 1S9EB 4BC9A 2XULA 3IAS9 2DNLA 3M2RA 4C8NA 1FDAA 5AE2A 4A8QA 1RT7A 1DTQB 2BZ2A 1JLGB 3G86A 3DRRA 3MM7B 5E3QA 2BQUA 2UVUA 4N47A 3BO2A 4C4WA 2HMIB 5FD1A 2JSXA 1FXRA 2HGMA 3PV8A 3IS9B 5IQQA 2V4JA 2KDOA 2IMWP 1F5BA 1V3SA 4KHRA 3GV7B 3C46A 2BE2A 3PW4A 4KQZA 4MH8A 2P9EA 4Y00A 4G3IA 2IBKA 3OVBA 2DGVA 3WC0A 3CJKA 1VQ7S 2HVHA 2N7CA 4A8XA 1TL3A 3QIPA 2QE5A 4JI7F 3VR1A 1D8ZA 2DITA 4LSNA 2L9DA 4MIBA 5BYQA 5FDLA 1R8HA 4O4RA 2IJNA 3UW1A 2RQKA 4WIIA 3G96A 1A7GE 2R8JA 1XN9A 4F3MA 2LA4A 3OTOF 4DR7F 4QPTA 3M05A 2ZE2B 4C8LA 4QWDA 1AROP 4J9OA 1FVQA 2KH9A 2V2KA 3HP6A 5L8RC 4C2MA 4KSEB 2WB1D 1HD0A 1LWEA 2LXFA 3TR5A 1YWXA 3VAGA 3N79A 4C3MA 3SV3A 4DFKA 4ATNA 1NK9A 2VG7A 2GX8A 2CPHA 1WWHA 1WACA 4J5OA 3RU0A 4F4KA 4MMOA 2FGCA 1YG0A 2QRRA 3FVYA 4UOCA 2JVRA 3TA1A 2NLWA 3PVXA 3G6VA 1ZTTA 1YJUA 2XMWA 2NQPA 2QFJA 4Z2XA 5K5MA 3SXLA 2CZ4A 4F4ZA 2W4PA 4KIAA 2X1AA 2Q6CA 2C3OA 5J1EA 4ZP6A 4UQGA 4IG3A 2DH8A 5D6GA 4EYHB 3T9ZA 2MKKA 5J2QB 3HX9A 3M6XA 4AQYF 2W9AA 2ABYA 4CNYA 2VONA 2YQ3A 3BGUA 5E7OB 1RTJB 2AGOA 2N82B 2HS4A 1N33F 3CT9A 3V2UC 2ZH3A 5KFIA 1FERA 3KK3A 2FC8A 1K1SA 3DLKA 4N8NA 2ZOGA 5THWA 4RWXA 4C0HA 1RTHB 2OPPA 4KV8B 5GAGU 1HNIB 5F8MA 1QVGR 5F3TA 4XIUA 1RA6A 3TOQA 3D54A 5HROB 1AXQA 1S1TB 2CPJA 5M2UA 4CH7A 5L1LA 1YJWS 1K8AT 1VMBA 2IC3B 4DR5F 1TL4A 3ENWA 3DLLQ 1CLFA 2JRSA 3CJ3A 1SB6A 5KG7A 3I5CA 2IMOA 1IJFB 2DNQA 3UD4P 2C22A 3FFIB 3JTNA 2O67A 3T6BA 3Q8RB 5KOXA 2YKQA 1JXLA 2FJWA 2PSZA 5B09A 1S79A 2LQJA 3LANA 2CPXA 2V0NA 4ITSA 4ICLA 4ZK7M 3KLHB 2ZJRQ 1JLAA 4NZ7A 4OHWA 1GXLA 4ZPVR 4ZA1A 2IRXA 2KHCA 3TAPA 5DLFA 4ZP7A 2EBEA 5A8WB 4BHQA 4YQWA 4DHVA 2ASLA 2KG0A 5AXNA 2JC0A 2OFHX 4DFMA 1FA0A 1HNVB 1X0PA 4A8OA 3BM7A 1NHVA 1S7HA 4D3HA 4B08A 4K5RA 3GB0A 4C11B 2WONA 4ZVGA 3UCGA 3HVTB 3T5JA 2XG8A 3MURP 3CPWR 3PXGa 3AHPA 3Q22A 3M2UA 2HFOA 1BWEA 1ZBTA 2XWXA 2APOA 3AA9A 3CDEA 2YX1A 1M5VC 3RW6A 3KG0A 2JJ4D 4DSFA 2YWGA 3NNCA 3M32A 3FNNA 2F8EX 2PE8A 1W2BR 2HFNA 3DFEA 2BJEA 3BJYA 5KT4A 2DPIA 3RRGA 5EX0A 3N5FA 2XSJB 4YR2A 2MZSA 3MM9A 2EFVA 3SCKE 2AJQA 4GO5X 3PR4A 4DSIA 4NWBA 5JJBA 1XTZA 3MMAB 3TAQA 3MEGA 3SI8A 2OIHA 2D1CA 2FIUA 2DNPA 2FLNA 1UVNA 3MM7A 1RISA 4YP3A 2XEXA 3BGRA 5KAKA 1SJ3P 1CC8A 2ILYA 3V6DB 1X7VA 1BLUA 1WHVA 2A2CA 3L95X 1RTIB 3TUZC 4ELVA 4F2RA 1ZAWA 2N3OA 1NO8A 2HWTA 1RP5A 3CIZA 1REVB 1DTTA 1HQEA 1MROB 1VIXA 3AB4B 1O0PA 1ZM3A 2UUTA 1TL3B 1KONA 3I82A 3QIPB 4FPRA 4ZCIA 3D1HA 2RB7A 1RYRA 3OFFA 3M9NB 2KHDA 3MM6A 2POKA 5I3UB 3M8QA 1NJIT 1LFWA 4YMEA 3UR0A 3M8PB 3TO8A 4B3TF 3SDEA 1DQ9A 3SCJE 1TKZA 4KO0A 1NK0A 2BANB 3HK2A 3IWXA 2WSCC 4OLPA 5KFOA 3OXFA 2PGCA 5G4DA 1UA0A 5KFXA 3C6UA 3K5MA 1D3WA 4QQBA 3G6YA 2HRYA 4I7FA 1LW0A 2MZQA 4CTAA 2R2SA 5CYJA 2HHXA 2PIIA 3M6UA 4LT6A 4I6WA 2Y1RI 2L9NA 2F9DA 3PW0A 3K5PA 1R27B 3K57A 1FRKA 4G1IA 5I3PA 1RKJA 1VQPS 4DN9A 2D9PA 2XMUA 2J7KA 1C1CB 4U7UK 2R7XA 4WCEQ 2I38A 1RT1B 4U6PA 2MJNA 4LIRA 4IG0B 3MMBB 1M5SA 2V5HG 1SXLA 4NXNF 3H5SA 2RE1A 4QWEA 1QE1B 2HGNA 3NWGA 5JVGQ 1JNRB 2ZBCA 3FZ2A 1KSPA 1FF2A 2GQCA 2YKMB 3DRPA 3T1AA 3NAIA 2FLLA 3PR5B 4Y65A 4QR2A 4RU2A 1NAQA 4PR6A 2F8MA 4WYLA 1T03A 2VKRA 4K0KF 4USIA 4MIWA 4XAKA 3LUYA 5EDWA 1KHWA 1KTVA 2GMLA 3HKWA 5EWGA 4J9MA 2MQLA 4ID5B 1SH3A 3VZIA 3TQ1A 3OV7A 2FLPA 3H59A 2ACYA 5GVQA 1HQUB 3S01A 2VPXB 1N8RT 1VQLS 5EN1A 4NA3A 5LL6d 1YHQS 2I0XA 2RKIA 1GTEA 1Z4UA 1JKHB 4U9RA 3CJ0A 3R5CA 1L3UA 4OL8A 3QYYA 1Q86T 1SBRA 1KQGB 4QW9A 3QLHA 3PIOQ 1ZYQA 2R7QA 2RIJA 2MXYA 4CNZA 1Z1ZA 1F60B 3MM8B 3OVSA 2GIQA 4HTIA 5HMZA 2Y1IA 4LFCF 4ICLB 5CHCB 2OPQA 3EYZA 4G1QB 1Q8LA 3GG0A 3Q8PB 3WC2A 1SQEA 2VOOA 1QUVA 3J7ZT 1TP7A 3U1NA 5A8WA 2CQHA 2MGZB 2DO0A 2DD8S 4MYUA 1IQTA 1VC6A 1DZ5A 5L9XA 3C3LA 3B4DA 3BQ0A 4ELUA 1FNOA 1U6ZA 2MSSA 3NCPA 2F9JA 5IXUA 1SL1A 3RBEA 1G1XA 3MWBA 2R7TA 1P27B 1S1VB 1H2TZ 1U8SA 5D4NA 5KFLA 1M5PC 2KB2A 4URSA 4DS4A 1FHTA 3VAFA 2KFZA 4FN5A 2M0GB 1N6QB 4AL7A 3VCDA 1K0TA 4K50A 2HS3A 4O44B 3QPIA 4H54A 3SEOA 3OL9A 1YSJA 3Q8SB 5CCLA 3KHGA 1XMQF 1KNZA 3GFYA 2HPUA 4RW4B 4OJ1A 4LFBF 4OZ5A 2YNHB 1QSYA 4C97A 4LFAF 1ZZFA 2PMHA 4QIVA 3BGFA 1S0VA 3CO9A 1QM9A 1HW8A 3CMAS 1FKOA 2AW0A 1C1BB 2CQ4A 3CCTA 4LVNP 3F44A 4HTJA 2FJBB 4PWDA 2JLGA 3MTKA 1HBUB 3QGIA 2XMKA 3N5BA 2YKNB 2GMHA 2E1RA 3H2LA 2ZJPQ 4WE1A 2KXFA 1FJ7A 2X3GA 5AXKA 2XC9A 4ED7A 2J9DE 3DI6A 1UMJA 2K7KA 4C9DA 2B9YA 4Y2IA 1SKRA 1RTIA 1G7CB 1SH2A 1UVKA 4QOTA 4R0EA 4PG8A 3CC2S 3M2RB 3NCRA 1HMVA 1WF1A 1IKVB 1REVA 4DV0F 1HNWF 2Z0GA 1S9FA 3DRRB 5MLCV 1E6VB 2ZH2A 4RBUA 4RUHA 1UWBB 2HLTA 2J9DA 4HVZA 1KVIA 3HHKA 2GW8A 1TVRB 2XSFA 3MM6B 5IFMA 2YKPA 3OLAA 3KK1B 1NKCA 2FHOB 1P1LA 2N7YA 4QJVA 4RW8A 4O3NA 2BE2B 2B9XA 4FZVA 4NLVA 4ZOSA 5I42B 3KHHA 2VD3A 5DM6Q 2L41A 2VC0A 5D8HB 2J76E 2ZH1A 5DG8A 5K14B 2GQQA 5EGYA 4OHZA 4DV4F 1DURA 1F0XA 5HLFA 3IBWA 3I96A 4FVCA 4WZMA 1HW9A 4CH0S 4GO7X 3NKYA 5E5NA 4NRTA 2W25A 2DHAA 1SIWB 1X4BA 1S1XA 1KR4A 2KTQA 5AXLA 4XPEA 2AJ4A 2ZOFA 3H5XA 5FJ4A 3QO9B 5T7LB 4WYWA 3CUNA 2CPZA 3BEGB 2JOQA 2WW8A 1JJHA 1ZAXA 2BABA 4JI2F 3ZZRA 1APSA 2CQ1A 2CZVC 2I9SA 1OS5A 5A8KA 3KLGB 1HI1A 2HRUA 1WI8A 3W2VA 3T6JA 1LOUA 2IRUA 4EEYA 3ULHA 1N36F 2FVPA 3PZPA 3D0IE 1M1KT 4K2XA 2EW9A 3UCZP 4K4VA 2ZZMA 3G4SS 1WEZA 2H5EA 2AGPA 2UXCF 3H8YA 4RNHA 1PC5A 2HNDA 4LF9F 2XCAA 5CD4H 1KFSA 1UJ5A 2HWHA 2OPSA 2RRAA 3HHDA 4AUKA 5F8HA 4M63A 2DRBA 4FXWA 4F50A 5F8LA 1H7WA 3E3XA 1EETB 1PSDA 3M2VA 3NCQA 4I69A 5LXRA 5M2PA 2CKWA 3SYZA 4WK1A 2M70A 2OTLS 3AQPA 3CJ4A 3ZZ0A 3CCVS 1IKYA 4NLPA 4NZ6A 2J0WA 5B0BA 1ZTWA 1RTHA 5J1NA 1PO6A 4FXDA 2E5IA 1LK5A 4OMFG 4Y0FA 4X62F 2DIUA 4Y2AA 2X1GA 4RU9A 2M3DA 3MM8A 3C66A 1LW2A 2C3YA 4OI3A 1VQ9S 4JI4F 2V8GA 3DM2A 1VQNS 2DRAA 2CVEA 5KFHA 2RU3A 4DN0A 4OHYA 2WTFA 2I5JB 2CQ2A 2GFFA 1KOHA 1Z2ZA 2FJEB 1WTFA 3SSQA 1X9SA 4Y28C 1VBYA 3J7YU 3CD5A 2RMLA 3HDSA 3GR0A 4DL7A 3V6JA 3V6HA 2NREA 1U26A 4J9RA 3OUYB 3IN5A 4URGA 1RAJA 4GC6A 1FDBA 1C0UB 3OVAA 3CCUS 3TRGA 3H25A 1U1PA 3UCUP 3GV5B 4OLOA 3G71S 2MQMA 3BS9A 2UV8A 1R43A 3K5LA 2K3KA 4OHXA 5F3ZA 4RLEA 3IXQA 4IO9Q 1IM4A 2QA1A 4IKAA 2LMIA 7FDRA 2OFGX 5KFQA 3RTVA 1RWUA 2A3JA 4O4GA 4DL4A 5KFUA 3I4HX 4IR9A 3GIMA 1IN0A 1FJEB 2XNRA 5GAEI 3UE2A 4CQ1A 1XMBA 1F2GA 1C1BA 4HEA9 3VQTA 3EGZA 4ES3A 2OD4A 2W4CA 3K0JA 1HBUA 3KLFA 4MK8A 5HMXA 2QLXA 4X4QA 4FBTA 2FVCA 3QJJA 2B5JA 3FQLA 1XR6A 2O3DA 2Q43A 3E51A 2IM0A 1UJ4A 3FGVA 4GKJF 2XI3A 3DI6B 1N0VC