2GQCA

Solution structure of the n-terminal domain of rhomboid intramembrane protease from p. aeruginosa
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
MSAVQVLKFPLSVDLAGFVGLLRRLNVPHRVSEESGQQVLWVPDERLAEQVRELYRRYPEGDPQATLEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and dynamics of the N-terminal cytosolic domain of rhomboid intramembrane protease from Pseudomonas aeruginosa: insights into a functional role in intramembrane proteolysis.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Rhomboid Intramembrane Protease
total genus 10
structure length 70
sequence length 70
ec nomenclature ec 3.4.21.105: Rhomboid protease.
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16733 NRho Rhomboid N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2080 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gqcA01
2GQCA
chains in the Genus database with same CATH superfamily
4JBCA 3CCJS 1JKHB 2DTJA 2R2RA 4XK8C 1R7IA 4PABA 1ZPVA 3ZTQA 4X4QA 3PYEA 1NB7A 1VCTA 2GVDB 2L9DA 2UZAA 1U2RA 2GZOA 1WC3A 2OPQA 3V81B 1UZHA 2O1PA 4B3OB 3Q86A 4CO3A 4M5GA 2IDEA 5LL6d 1S7HA 1GH8A 4TKTA 5EX0A 1DQ8A 3TJAA 5IT0A 1D8YA 1GX6A 2AJ0A 4LJMA 1TAQA 2ABYA 4XDCA 4UZCA 4PWDA 3L9ZA 3HPOA 3C14B 1G6BA 3GJSB 2N4CA 3ICLA 4NLVA 1S6UA 1S6QA 4UY8T 2HLTA 5KT6A 1J5OB 3NCPA 1X8DA 4F50A 4UT4A 1GMWD 1RT5B 4ES3A 2MB0B 4LMZA 3NOCA 1YRUA 3NMRA 1OY9A 2P9GA 3PKMA 2AMCB 3ILJA 4TYBA 2CZ4A 1CC7A 1Q79A 3LPEA 4LSNB 1WKJA 1X4GA 4OX7A 4PRFA 2RS2A 2UXDJ 4DR2F 2YTCA 3RG6A 4JB8B 4LREA 4ZPVR 1JLBB 2DH9A 3BR8A 5HQMA 1TKXA 4OHWA 4O4GB 4HVZA 2K1RA 1K0VA 1KN6A 3RR8A 1LW0B 3IS9A 4RW9B 3ZZTA 3DRRA 5ETSA 3FUYA 4WE1B 1U09A 1WF1A 4FYYB 3T1HF 1LK7A 3NBPB 1KLNA 2FVQA 2DGOA 4Q0BA 2HPUA 3B6BA 4M5MA 4DPXA 4KB7A 2B9XA 5G0RA 4F3MA 4ZCIA 2C1EB 5JXSA 1ZM3A 4PG7A 3CCQS 2DNMA 5CYJA 1HNVA 2F9DA 3F56A 4HDGA 5E0OA 3P45B 5C7PA 1N32F 4NLQA 1LEOA 3UE2A 2ERRA 1IKYA 3DN9A 1UVLA 1RAHB 1S9GB 3ETMA 3EUNA 2YWKA 5CHCB 3UN3A 3OTDA 3MR5A 2JOQA 3TAQA 1T9VA 1UVMA 1TKDA 4QWBA 4U8VA 3VGVA 4IRDA 1OSCA 4JYAJ 4WCEQ 2AGOA 1S97A 5J2NB 3KYLA 2DGTA 2RAQA 4NYPA 5CD4H 2LU1A 1B0TA 2NXJA 1X0PA 4ID5B 4UF4A 4KHPF 4JI6J 4E8UA 4RW8B 3K0JA 1DZ5A 4OI3A 1DURA 4KGVB 3A4TA 4EK2A 3KLFA 1RAAB 2FJBB 1Q5YA 1MU2B 3RBXA 4CIOA 4K7QA 4Y34A 3G96A 3CJ2A 5ETMA 4YFUA 2YNGA 5KFXA 4DL4A 4RW6A 1R89A 2XYPB 3UVJB 2JJ4D 2W8KA 2FLLA 1XBWA 1YTYA 3OLBA 3LP1A 3HT0A 2ZWOA 1AXQA 4IH5A 4F25A 4DQPA 5HMXA 3JSYA 1FDDA 2DNKA 4WIQA 5GAEU 2F63A 2FDNA 4C11B 1GT8A 5HANA 4M5KA 1NRKA 4A8SA 2Y1JA 4B9TA 1PYTA 2V6AA 2C22A 4N77A 3JQMA 2MQPA 1FD8A 4J9OA 2VOOA 3ENQA 3DGPA 2BVZA 3MR2A 4PXEA 1V3ZA 2J8AA 4NA3A 4OLOA 4FZVA 4RNMA 3F73A 3G6YA 1FI4A 4L74A 4C6AA 2L9NA 3QO9B 1NBEB 1VOMA 3HD2A 3GV5B 2PA3A 3UD3P 3HKZD 4YEAA 1K8AT 3GU0A 4DV2F 2C2DA 1CS4B 3D28A 5A0YA 3SYZA 3ZTSA 4LQ9A 3HD1A 1SQGA 3POTB 2BV3A 1FT8A 3THTA 2MY7A 4KQZA 3D9BA 4OHZA 4Q2MA 4QBUA 2DB1A 4V1Ak 1RWMB 4ZVOB 1U6BA 4C98A 1HBMA 2B5JA 2CFXA 2FHJA 2ZVIA 3DHXA 4DEZA 1S1XB 2AJQA 3FEXB 2IYGA 1R8AA 4ZA1A 5A2QY 2FJAB 2VPZB 2MLZA 3TVZA 2KFYA 1IKVB 2YNIB 2V8VA 4RPFA 3PV8A 2R42A 1TK0A 1HNZJ 1K0TA 5C42B 1S72S 3PDNA 4KRWA 1L3TA 1Q1KA 4IG0A 4RL1A 4DUZF 5E3PA 3KG0A 2C3PA 1KC8T 4UOHA 1BGXT 2M52A 4DN9A 2QA4S 3IWXA 4LF8F 4X66F 1UVIA 2DNQA 3WIVA 2GMHA 3WX4A 3HT3A 4YR0A 5HBMA 1KQSR 1TQLA 5DDRC 1VQKS 4Z2XA 4A8WA 2VG7A 2YBVA 3D4JA 3GYGA 3DLEA 3I55S 1FF2A 2A2CA 3NY0A 2AJFE 4G1PA 1XMOF 2I5JB 3MR7A 3OJUA 3MM5B 4I6YA 1A6LA 4KGXB 2G2YA 3BKUA 3PFEA 4U95A 3MD1A 4TN2A 2EKYA 4A8XA 1N5QA 1NB2A 1TV6B 3SSRA 3OTOF 5HROB 1XIQA 4DLEA 4JI0F 3NGRA 2HFVA 4NLWA 4CRJA 3HCXA 3TZXA 2MY8A 2CNOB 4A8OA 4XO0A 4OJ3A 2IM3A 2D3O1 1MN7A 1EQ0A 2OUGA 1UFKA 1X5TA 2FVRA 1RSCA 3AHPA 3HX9A 3I87A 4DPUA 3A3OB 3EXCX 4OYAA 3RRKA 1QTMA 2JC1A 4JI4F 2MHNA 5DDPC 1NJWA 4DPWA 3CDWA 1RHQB 3QQCD 1Y5LB 3CB4A 4PUOA 4NL5A 4IFVB 2DRBA 3W61A 2B4UA 1FD2A 4I6AA 4TLQA 1ZBTA 1JX4A 1XJWB 4JI3F 3MMAA 4RWXA 1D0EA 4KPCA 3BBBA 3HFZB 2AV5A 2OEJA 2UUAJ 4EMDA 3CDUA 5JVHQ 3AJ1A 4OYBA 1S9FA 2W4CA 3NGDA 3TWZA 2F65A 3IGVA 3X3UA 1U1PA 2UVUA 4I6WA 5D77A 2GMJA 1DFDA 2XY5A 2YNFB 2HHTA 1ZS6A 3IS9B 5IM0B 3CW2C 3R27A 5FLXU 2OPSA 1HBUB 2H54B 2CNNB 2BXJA 2XBPA 3ITHA 1SJ1A 3GFHA 3MM7B 2V68A 1DTQA 4MK8A 4L72B 5IWAF 2X1AA 4C2MA 2V8DA 3HHKA 1RT6B 4UZBA 1RYSA 4DWIA 5KFNA 4ECZA 2ZZTA 3TRGA 3UWTA 5DG7A 5A8RB 2FJVA 4WP9A 3IA0A 3THVA 1FX2A 3DRSB 2M88A 2WB4A 4ZP7A 5KG0A 4DJBA 4JI6F 5KT3A 4UQGA 2Z56B 3MM6A 1B7YB 4DF4A 3ULHA 4F3QA 1N6QA 3WBZA 3OT9A 3F44A 6AT1B 3OR1B 3K5LA 2HNDA 1CJUB 3TEGA 2GQ2A 1VBKA 4HL9A 2VH7A 1K1QA 3MGJA 2NZCA 2L9WA 2YKPA 5DJBA 5AE2A 2Y9HA 2GS8A 2KH9A 4DS5A 2QL7B 3N6NA 2FTRA 4C8NA 2C2OB 4ZVQB 4ZN1A 4WFNQ 5KFEA 1B3TA 3IM9A 2DD8S 1DHMA 3VGTA 4MKBA 1L5UA 4LF6F 1RA7A 5IT4A 3KHHA 4LFCF 1S6PA 1KVJA 1IXKA 1RTHB 4XIUA 3M9OB 1CULB 2A1BA 4J91A 2AQ4A 1RWKB 4RLEA 3R5AA 1VIXA 4MFBA 3IAS9 4C3LA 5A6PA 2XO6A 2GIFA 2DY9A 2Z2YB 4PWWA 3R9LA 1O6XA 4RW4B 4Y00A 5F0UA 4NXMF 3WX8A 5HN0A 5GMKa 1HMVB 3IR6B 2M8HA 4RW6B 3CDAA 5MAOA 2RDJA 3RRHA 5CAAA 3DLLQ 1T05B 2WW4A 3L7UA 3TX8A 2FLPA 3AQOA 2JHEA 3B78A 1KQFB 3MPYA 1S1VA 1JLQB 1Q7YT 4QYZK 4FP9A 4MYTA 2YQ0A 2NXUA 4H4OA 1RACB 1OS5A 3KJFB 4O44A 3BKTA 2KRBA 2YKNA 4M1KA 1KEKA 4WK1A 3S8SA 2UUBF 3UR0A 3IGNA 3M9MB 1EHWA 4PXCA 2FJWA 3S1TA 4L75A 5LMUJ 5AXNA 4DCPB 2B9EA 4YB5A 1Y00A 1FXRA 5KT5A 3QO9A 5B0EA 2ZH8A 4LF8J 2BKPA 2GX8A 2E5LF 1XR7A 2RRNA 3UI3A 3BB5A 1EETB 1EX8A 1RKJA 3RGIA 2QMWA 4LF5J 4ZK7M 1KS2A 4RO0A 2YXLA 1NK5A 4CP5A 4DI6A 3CC7S 4YMEA 1LWXA 2FJDB 2LA6A 3MEDB 4EU0A 3FKBA 1HI8A 3OL8A 1M1KT 2LXFA 2WSEC 1TK5A 2ATCB 2YPZA 1H38A 2HAIA 4QYRA 4BWMA 1TR0A 3CCUS 4DF8A 1HBOB 1WWHA 4LRBA 5A2QU 3Q22A 1SKWA 1IR0A 2HBZB 3KK1A 2Z30B 1FFWB 2DNRA 3RR7A 2FHMA 3U02A 1M0SA 4V19X 2K3IA 3R1LA 2YH1A 2Y8YA 1RA6A 4ED7A 4TU9A 1MU2A 5M2PA 2QN6B 1NPKA 3KLVA 4QZVB 4WYWA 1LNQA 1KSPA 5LXRA 4OYIA 2OMLA 3E51A 2DHSA 1LV5A 2R8GA 3NG8A 3VAIA 1KOHA 2E7WA 3KLIB 1FJ7A 3TO8A 3QPIA 1X4CA 1IR2A 1IWAA 2IJRA 2IVMA 2L08A 3T19A 2P9CA 2DBBA 1AROP 3HZGA 4LFAJ 3THPA 5J2NA 3RAQA 4MFBB 2K7KA 1SIWB 5F41A 3QGHA 4YN3B 4JI2J 1HYSA 4R5PB 3MTKA 4ANEA 2MEWA 2O67A 3H5SA 4CYUA 1LFWA 5THWA 2VODA 3KLEB 2RS8A 2ALZA 3A1YG 3KLEA 2BUNA 2V9KA 3M6VA 1ZM9A 2W4PA 3OFGA 4MYUA 2OPRB 5B0CA 1SKUB 4NLYA 2MZRA 1RU2A 2V63A 4K50A 4KHPJ 5G4DA 2E29A 2W2MP 5CYMB 4RUCA 1O8BA 3OTBA 1UTAA 1VC0A 1K47A 1U1NA 5JJBA 3JB9k 3PZPA 4IO9Q 4UOGA 2NYHA 1HQ2A 2ROGA 4BHQA 1SC3B 2XC9A 2MHEA 4F7VA 4LBHA 2ZJRQ 2R9LA 1FRHA 2E7VA 3OTEA 4MH8A 1NK0A 3EICA 4W92B 2HMIB 2YQ3A 3DXBA 2BJEA 4ZPTR 1F9HA 5K14B 1FJGF 3MPVA 3N5FA 4QOTA 3CCSS 1CEZA 3MEDA 4JUZA 4CLLA 4CT9A 2VJVA 2P2CB 3IG1B 2PN6A 2GHPA 3QNWB 1H7WA 3EYZA 3FMBA 3O6QA 4GVBA 4NXNF 3MEGA 3BR9A 3GPAA 1UFWA 3B82A 4QIGA 5F0WA 3D0HE 3T9ZA 1U48A 1VC6A 3KNAA 1HI1A 5KFHA 2ZFHA 4DV0F 2BX6A 5H9EJ 1UPPA 1ZOTA 2DH7A 3LTOA 5SZTA 4Y65A 3DLGA 2FZKB 3H8YA 3DLGB 3O3LA 2V50A 2WONB 3UN2A 3G8TA 4GC6A 3OW2R 4DL7A 2J9DE 3NAIA 5AXKA 5KG4A 2DKOB 3Q2SC 1HW8A 2HHPA 4QPXA 5F3ZA 3H25A 1VMBA 2EFOA 3V4MA 5KG6A 3C15B 3G82A 3PACA 2DNLA 3RW7A 1UEVA 3KK3B 3MPUB 4X84A 2FYXA 3OBIA 3H5XA 1U0HA 3E3XA 3QWPA 4GO5X 4OHXA 3CJQA 5CH7B 1S1WA 2H1YA 4ZP8A 4OI4A 3MM8A 2LECA 3C66A 3KDNA 4LQ3A 3MWBA 1HLWA 2EW9A 1R3NA 2G0CA 1KRPA 5D4NA 2FLNA 2CPXA 3J7ZT 5KFBA 3BO3A 2GCFA 1LK5A 2YPYA 3AQPA 1Q82T 2FQQB 3G6VA 2CG8A 2E1PA 2FHOB 2GGPB 1KP6A 5AXMA 4ES1A 4I64A 4CQ1A 1NK7A 1XN9A 3MMBB 5HP1B 1WOSA 4EWTA 5HLFA 1PC5A 1K1SA 4RJVA 3M8YA 3KXDA 5AXLA 3VGUA 5L39A 5KFPA 4I7FB 2NREA 4DG1B 4USIA 2RU9A 2WBRA 2F8EX 3Q23A 3QRQA 3TUJC 2IC3A 1ZPWX 1FJEB 1RTIA 3KOAA 3KK2A 4R0EA 3KK2B 3NLCA 4Y2IA 4DX7A 4DSKA 1VS3A 2FHJD 1N33J 3PW5A 3FBBA 5EX3A 3G2XA 5DGBA 1JJ4A 2XULA 4F2RA 4KHRA 1Y5IB 2XSJA 1RHKB 2E7XA 2MKIA 1ZAWA 2K8GA 4XTTA 3T1AA 1R0AA 2QC3A 4DZ6A 5CQGA 3BPSP 3C8YA 4Q5VA 2AEJA 4UOFA 3CJSA 4F3OA 1N32J 1XK8A 5D4OA 3MPDA 1XR6A 1CJVB 2VKRA 2XYGB 4AD6A 2KZZA 2LMIA 3PXGa 3L7OA 1JLEA 2EC2A 3LAMA 4KGKA 5DO2A 3S7RA 5IM0A 1QAIA 3CO9A 4J9QA 3HHDA 3KK1B 3BO2A 3SV3A 2CJKA 2MQMA 2DR7A 1PJ7A 3HJVA 5EHHA 1PO6A 5T7LA 3UCGA 1LQ9A 2ADCA 5IQ6A 2BYCA 3ILOA 5LMUF 3FVYA 2AZ1A 3K59A 4B3TF 4ILRA 1QUPA 2OD4A 3M2UA 3M30B 4GKJF 1X4BA 3G87A 2H65B 2XMVA 3DDKA 1M5OC 2GQQA 3QT5A 3QJPA 1GK8A 2MQNA 3ZZYA 1MMNA 2MJUA 3CD0A 4TNOA 1JLGB 2J5AA 4NLRA 3DLJA 7FD1A 2QA4G 2YKMA 4ZPCA 2UP1A 4WTOB 4WZQA 2QIFA 2GVZB 2V5HG 3KJVB 1AB8A 2MKYA 5J2QB 1HA1A 4NRUA 3ETOA 2DITA 4LSZB 4QR1A 3P8BB 5AE3A 3OJSA 4FS2A 4RW8A 1T94A 3V6KA 1T05A 1C2PA 1D3WA 2RQMA 1OQ3A 3MMCA 2DPJA 1VQNS 2H5IB 2JX2A 3BH7B 1REVB 3E01B 2OJ3A 2V4JB 2OEMA 3BQ1A 1RAGB 4JV1A 2HZAA 1S1VB 2GFFA 5DS7A 4C3MA 2V69A 4C11A 5I3UB 4H4MA 2UVWA 1WTBA 3GMGA 3L95X 3OV7A 4OZNA 4BLGA 4HKQA 3CJKA 4U6PA 1T9YA 4C7QA 2KTQA 2OTLS 3EXYA 1REGX 1CULA 1U1OA 2NUHA 2KDOA 4USKA 2NPIA 4G65A 4N8OA 4ZVHA 1RT1B 4DU7A 4DLGA 3EJMA 4NZ0A 1FNXH 2VASA 1RKIA 1H74A 1ROFA 1SJRA 2ZD1A 5J1NA 3SSQA 3PM9A 4IQMA 2A2DA 1QDUB 4QIVA 4ZVFA 7AT1B 3EM1A 3GIKA 1Q4RA 5CYMA 2MDAA 4OZJA 6FDRA 1T3OA 3PJWA 1X4AA 4IOCQ 2QYGA 3EGZA 2V2VA 1TKTB 4EO6A 4CLPA 3DRPB 4KV8A 2KKHA 2R2UA 2WK4A 2D3OR 1RTZA 3MMJA 4DMZA 1NJIT 3JSMB 1NUEA 1HNZF 4B9NA 1BY9A 4M5DB 1MROB 1TL3A 3FFIA 1UW9A 2Z8QA 2HIYA 1H2UX 1PYOB 1RJJA 3N28A 3PCOB 1RCXB 1DARA 1T11A 2AX1A 2PSZA 2VFTA 3M2RA 4CTAB 5HO4A 3KG1A 5GADI 2HYIB 4K4SA 3N6MA 4PG8A 2IA0A 4QPTA 3WC0A 4CLFA 2QL9B 4DCOB 1UVKA 2IA6A 4LSNA 1F0XA 5D0GA 4OYZA 4DR4J 5LOQA 3TARA 3DOLA 3RB0A 1C1BA 2VB6A 1WACA 2FC8A 3I56S 4P72A 3TQEA 1FJGJ 2NLWA 3NMAA 3FZ2A 4K0KJ 1YHQS 3N0VA 5D8HB 1F60B 1WC1A 2VIHA 4JI0J 4FYWB 4HEA9 4KIAA 3HHEA 2PMWA 2RMLA 4CLYA 1HBOA 3D68A 1SJFA 2FGCA 1TU0B 2ZVSA 5KFRA 2DR6A 2YNHB 1U1MA 4EFAC 1U0SA 1VR6A 1YGYA 4TQRA 3EMTA 2HGNA 2DPIA 4JI4J 1NPPA 1TUVA 2D3ZA 2OPQB 3V81A 2OAUA 3BM7A 3DYAB 4MIWA 5F9LA 4J9LA 5IV4A 3UVJA 3UCZP 4DV1F 3UD5A 2BA9A 3FBCA 3SCIE 1IKWA 4KGZB 1VLOA 4ZN3A 4EYIB 2YKOA 5ETKA 1N8RT 1N52B 5IXUA 5IC6B 4B08A 3QZ7A 3KLFB 4NA1A 4RU2A 4PUOB 4B3OA 1N34J 1TL1A 2WSFC 4WU2A 4FDFA 5KFJA 1MWQA 1NLKL 3C2PA 2NSBA 4CLSA 1M5HA 3NGTA 2D9OA 5L8RC 2AT1B 3GJRB 5HMZA 3J80Y 4QR0A 2QLFB 4WP8A 2J6SA 2L48A 4Y2KA 3SMZA 1UA1A 3AA9A 3HM9A 5DQHA 1RT2B 2YNGB 3NS7B 2GHVC 1RT2A 4W4MA 4ERDA 2J6UA 2DEJA 1LXNA 1WELA 2MMYA 1ACMB 1BXNA 1FFGB 1KWMA 2EG1A 2UUTA 5FIIA 1KQKA 3S6EA 3T41A 3VF0B 2LCWA 3BGOP 3V2UC 4G1QA 5KG7A 5SUHA 2DH8A 1V9OA 1HBMB 1VFJA 4DFJA 4O4RA 3OHAA 4ECWA 3QT8A 1M1HA 2J8SA 2V94A 5M2UA 3H4DA 4WFZA 3G86A 2NSCA 3IC1A 1JWWA 5CZXA 3DKDA 4K4WA 2E1CA 4ETXA 1APSA 3FRYA 2FPHX 1AA1B 1JLBA 2ZHOA 4ZIWA 1VQ8S 1SC1B 3GG0A 4OLPA 4N7TA 5C2CA 4IG0B 1R31A 2UUBJ 1HNIB 2DGWA 1X5SA 1HWKA 3FBFA 3M6XA 4ZJOA 3SCJE 4A48A 5DLGA 4K2XA 2YWWA 3RBDA 2F7VA 2FGOA 3DM2A 1O0PA 1ULRA 4MIAA 1FE4A 4JV5F 1DTTA 1FKOB 1PG5B 2MQ8A 4ED2A 2C3YA 3PNIA 4LFCJ 3K5MA 3MOJB 4DPTA 2CPIA 2ILZA 1RWNB 1WC5A 4H54A 4RUHA 5E41A 2KFZA 2MLXA 3HVAA 2FY8A 1U8WA 1R27B 3HSJA 3LF0A 3OTCA 4L3KA 4LVOP 4J9UE 1IM4A 3IRXB 3BBCA 4QQBA 5B7WA 4X62F 1VBZA 3C46A 1FKPA 1EQMA 2B9WA 2J9EA 3DOLB 4C8YA 4O3NA 4YUDA 4HYKA 2J6TA 3KJQB 1JNZB 2HKEA 3D2WA 4ELUA 5I3UA 2CUYA 2XEXA 5JVGQ 2E66A 5GAHU 1HBNA 3H4BA 3G9CA 1O5JA 3EGWB 4DUZJ 3MR3A 4P2FA 2DGQA 3SEOA 1ZETA 4Q8EA 3BF4A 1RZMA 4OZLA 2QSFA 3DGPB 4OX6A 1CQNA 5EN1A 2J76E 2Q79A 4BC7A 1M5VC 2BW2A 3MPWA 3OXLA 4JI7J 3QRRA 4DR6F 4K5SA 5KFWA 1YX2A 5IFMA 1FTCA 2ZOGA 4ICLB 2HFZA 2P6TA 1FWKA 3DFEA 3W9JA 4ZVTB 4CM2A 1HWUA 1PYSB 2PC6A 3ISND 1D9FA 2DGXA 3GIJA 4JV0A 3GJQB 4FVMA 5AJ3J 2K7JA 1T9UA 1RWWB 2ROPA 3FCHA 2EEYA 2GIQA 2IIHA 2VBXA 3AJ2A 2SXLA 1JLQA 1P9QC 3FRZA 3KUHA 2FHKA 2HRUA 4DZDA 2VG6B 3L3CA 5CD4A 2HHHJ 4QYZJ 2ALYB 1SC4B 1SVDA 2VA3A 1Q8LA 1VRUB 1NSPA 5D6GA 1TMJA 3CPWR 3R2DJ 1Q95G 1RB0A 4G6VB 1U4BA 2KFNA 3AODA 3K8VA 4MK7A 4C97A 4X4UA 3OPKA 1NEEA 2LU2A 4IOAQ 2AEFA 3SQGB 3W2WA 1OPIA 1RQ0A 2X7IA 4DR1J 1N0VC 3IWLA 4ZDNA 4UTGA 9ATCB 3BGLA 3EPGA 2BOPA 1X5OA 2B6AB 3M30A 4ANCA 5HQ8A 1QVFR 1N5YA 3KUGA 3Q8VA 2J0WA 2JSXA 4CH0S 3H40A 1N36F 1SL2A 3TUPA 2W9AA 1FVSA 2HLUA 1OQ6A 3I4HX 1KBRA 3JTOA 5LT5A 1JK9B 2CQ0A 3EVOA 3CMQA 1DRZA 4LF7F 4Q7AA 2WRMA 3BGUA 4WWSA 1AZSB 1W25A 3RW6A 2AU0A 4YY3F 2W9CB 1GAOA 3BSCA 2H4WB 4NCGB 2GHWA 5IWAJ 3M2UB 3LWLA 4F4KA 1HBNB 2JFKA 3IRXA 4FVCA 1KFSA 4M5HA 5IS2A 4OYOA 1C0UB 1C0TA 1R0BG 2ZBPA 3ADAC 3VAMA 4TVAB 1TVRA 2JLEA 2OELA 5ETQA 1UAWA 4DR4F 2GO8A 4R25A 3BPDA 2LXIA 3PRDA 1YVFA 1VK8A 3I6PA 3SFGA 4RUBA 4NI2A 4QW8A 1RT4B 4LFBF 1XEZA 2DIVA 3KG4A 3HVWA 3PJ9A 3ZXWA 2JLGA 1B70B 4A47A 3J7AN 1E6VA 4AFFA 5GVQA 5ADZA 5BYSA 3OUYB 1T7PA 4JOUA 1HPZB 1U26A 1G1XA 4DV3F 2R4FA 5KFSA 5HP1A 1S5ZA 2K3KA 2AJ1A 3M2VA 5HQLA 1RK8A 3OVBA 3P4UB 1CSJA 2PIIA 1MG7A 3VAKA 5EUHA 1S0OA 2ZOMA 3QJJA 2ROEA 4FN5A 4PG5A 2UXCF 2VFUA 1HBUA 4NLSA 4WFAQ 1CPZA 2HQGA 2F40A 3Q89A 2VPWB 1EB0A 2O5DA 1WEZA 2ASLA 3SQGA 3W2WB 2YX1A 4IR9A 2UU9J 3QIDA 1GTHA 1AW0A 2VF3A 2G4BA 1RCOB 2YQ1A 4IG3A 1VLYA 1FRKA 4ITSA 4K8RA 4B17A 1F9EB 1BWVA 3A8JA 4YDDB 1U7LA 1PIEA 3HULA 4R8UA 1S1UB 3PY8A 1YG0A 2RT3A 2QZ8A 1IR1A 3DRPA 3K89A 4KV8B 3VWSA 2FZCB 3OXGA 4LF1A 5M2RA 3IG1A 5F9NA 2XZDB 3MZIA 2OMOA 4DN0A 4TLRA 4HDHA 4NLXA 3O2IA 4TU8A 3V6JA 4JI1F 5GAGI 2XCAA 1Q16B 2LDYA 5BR8J 2DNOA 1XMQF 1MNEA 2ZWPA 5ETRA 1GXUA 4I68A 3VGSA 4TY8B 3UFCX 3D3BJ 4CO2A 4F36A 2N7CA 4WFBQ 5CYQB 5KG1A 2FLOA 5LMNF 5L1KA 5K8PA 1RP5A 4PCQA 3FCVA 8ATCB 5DG9A 4M95A 3MI7X 1EETA 1T9XA 2HRYA 3GFZA 3M4XA 3PFOA 5D3GA 4QIWD 3W65A 1SB6A 1S10A 1S0MA 1IKVA 2YNIA 4QJVA 1O51A 2IRXA 2XMMA 3CJ5A 5ETOA 2VICA 2QFJA 3C16B 1UCNA 4CT8A 3VALA 3W66A 1CLFA 3ZFVA 1YJUA 2Q3PA 1Y3KA 3P3DA 4B9SA 2AYMA 1AUSL 2YKQA 3H2UB 3NWGA 4IOBA 3TX0A 2B56A 3FK4A 4NZ7A 1V3RA 5HBMB 3AOCA 4M5LA 2ZZNA 1BWEA 4OZ1A 4DX6A 2VA2A 1PSDA 4GKKF 2VG5A 4AE5A 1QVGR 4OIXA 1VJWA 4WBFA 2FD2A 3ZZZA 5C24B 4IFYA 2CPJA 4ZCKA 4NI2B 3WHIA 2ZBQA 2B8PA 4URSA 1NK9A 2G1DA 4KC5A 4H4KA 3QJLA 4J37A 4MJKA 1F3FA 4DFPA 1Q86T 2XLKA 3RB6A 2R7QA 3EVWA 3NS5A 3CDBA 3NEKA 3NS6A 3QLHB 4UUWA 3LP0B 4OX9F 3C14A 2MTLA 1P8GA 2CA9A 4RNFA 3CF5Q 4DQRA 2C3OA 2ASJA 1R8HA 1KTQA 1QLNA 1HYSB 4C8ZA 1KR4A 1S48A 4ZPDA 3W7BA 4ZKAA 1BHNA 1FK9B 1V5VA 3AOAA 4A4JA 4JI2F 4C0HA 4RUAA 5F8GA 2U2FA 4A8KA 1HFEL 2JL9A 2QLWA 2D41A 5D4PA 3PYGA 4ZLNA 4M5IA 1U6ZA 3D1HA 5A76A 2R8KA 2VUGA 5HVGA 3MF5A 3ZNJ1 3GWCA 3PKYA 4PR6A 2ZBCA 3CCLS 1PKUA 1U02A 3TAMA 3BQ0A 4CLWA 3TEHB 4GKJJ 1BLUA 2I0XA 4I2PA 4GVLA 4X66J 1B64A 2R7RA 1PJ5A 2QSWA 5ETTA 4PQUA 4EUVA 3I4PA 4G1QB 4P74A 4Q2LA 3IBWA 2HFOA 4CH1A 3W63A 4DR5F 5KFQA 3JSBA 3BZQA 3R6GB 2DRDA 1VRUA 2UV8A 1NNDA 3QGIA 3W60A 3QSYB 4W90B 1RWPB 1S1TB 2RKIB 5HMWA 2WBMA 2ZDOA 2KJWA 1OYDA 2JDJA 2R2TA 2HHQA 1KVIA 1WKKA 3FQLA 4Y6IA 1RAOA 2ZE2A 2UV8G 2NUUG 1OJ4A 1SV5A 5BXIA 4DL2A 2DNGA 2IY5B 2Z2LA 4M94A 2ZBRA 1N5TA 1I5OB 3HK2A 1QE1B 2M5YA 3C6TA 5E2QA 7FDRA 1PAEX 1GX5A 2XHCA 1NJZA 3MR6A 3NNHA 4PG4A 1JLGA 4TY8A 3WC2A 2ZKTA 4FS1A 4WJBA 3SFUA 3SSSA 5C25A 2PO4A 3MCSA 1FO1A 3NKYA 4NLOA 3FCWA 1UKUA 3LA0A 1NK8A 4OX9J 4NMXA 1BMQB 2DYAA 3PYDA 1A0OB 4DV0J 1VQOS 5H1SV 3LP2B 3HHLC 1RTHA 2AJ4A 5F8IA 2UUAF 2BE2B 4U67Q 3OD2A 3BREA 5ITHA 4B3SJ 2KZMA 2AYEA 3AFGA 4I1TA 2I6WA 3DDIA 4IDKB 2B4OA 1RT5A 4HR2A 2H48B 3HXMA 1IBKF 2VFRA 2G9OA 2V67A 3QYYA 3T6BA 2OO4A 3HSDA 2FUG9 2AX0A 3HDSA 3LGHA 1YJRA 2VV5A 2Z4PA 1NHKL 4LUBA 3W64A 4DS4A 2W25A 1N6QB 2GNKA 1N5SA 3RU0A 2IMOA 4ECUA 1TKXB 2GO9A 3NRBA 4NPOA 4F2SA 2CQ3A 3T9NA 2KL8A 2QFIA 5BR8F 3HFKA 4IYQA 1UEKA 2ZBIA 3ISNC 4XPCA 3Q2TC 2CDQA 3PW7A 2NS1B 3EWGA 3QLHA 4O23A 3GIIA 3DLHA 4RNOA 1IN0A 2DXDA 2MSTA 2EFPA 3DLKB 4Z37A 5K8MA 3T5JA 5H9FJ 3VTIA 1JLEB 1T3NA 3FSYA 2KVQE 2C2KB 2RVJA 3NNCA 4NZ6A 3RZAA 5LSRA 4ECSA 1RLDA 5KAKA 3KJNB 3IXQA 3H20A 2UXCJ 3LGMA 3US5A 4NEYA 4BWJA 1N33F 1WC6A 3OXFA 4I4BA 4ZS6A 2NCKL 1NH8A 5C42A 4URGA 2B7BB 3MAQA 4X4VA 1UL3A 4KSEB 3AT1B 1HNIA 3DRSA 4LRDA 4FKYA 2R8IA 2QL5B 3N6LA 2JEFA 3LH2S 5K8OA 4DR7J 2F4FA 3T5HA 2PEBA 2Q6BA 4LVNP 4URQU 3FEZA 1CG2A 2XMWA 3NWRA 2WVBA 3R5JB 2IAJA 5HK4A 5GADU 2KT2A 1RISA 2AHOB 2C2MB 3VQSA 4OV6A 3KK3A 2CJXB 3DXSX 5IV3A 4YHHJ 2CWXA 2ZITA 3AD7C 1M1GA 4FBUA 4JI1J 5I42B 1S1WB 2MQOA 2E1MC 2GJ2A 2LQ5A 4USMA 2G2OA 4JI5J 1YITS 3DNCA 1FRXA 1REVA 3OLAA 1D09B 2VD3A 2Y0BB 3QMQA 4WZMA 3AB4B 2JRSA 1TL1B 4NYOA 1Q78A 2CWKA 4DSJA 4ILLA 1BQNB 2HWHA 5F3TA 5L46A 5BYQA 2HBRB 1SCJB 2EPIA 1S99A 2BJ1A 3CCES 2XQCA 1NK6A 1PBUA 1OIAA 1KLMA 2LP4A 2WAQD 3AXKA 3R7NB 4JV2A 2JVOA 4KGMA 1L3KA 1R6YA 4KO0A 3D1QA 4CM0A 3J81Y 4LIWA 1H3DA 3FSXA 3R5CA 1PJ6A 4QW9A 2LA4A 4ECRA 2IYIA 1YQHA 2I38A 1RBLA 1RUSA 1FRIA 3I32A 3H2VE 4N5SA 2OI2A 2NR0A 2W7OA 3MOZA 2U1AA 1WHXA 4X65J 1PBAA 2F4VJ 4LRFA 5HROA 3KTQA 1Q5VA 4USVA 1M5KC 2JH3A 3PHEA 3OTOJ 5GAEI 1WC4A 4RNNA 2AWZA 1WSVA 3W8GA 4Y28C 4ZOSA 5K8NA 4DPYA 2I2YA 3FMWA 2JWNA 4X4SA 1YBTA 2OD6A 2ACYA 3J81j 5E3QA 5GAGU 1X4EA 3GFXA 3GONA 1HQEB 5KOWA 2IMWP 2XYHB 3MEKA 1WI8A 4HHJA 2PEHA 3BH6B 3U7JA 1H6KX 4JI8J 1FDNA 1RBOB 3GB0A 3N4WA 3BYRA 4MKAA 3CO0P 3U27A 1OWXA 3NOGA 5A6WA 2NPFA 1ZTTA 1QUVA 4M5DA 1HNWF 2VC1A 3DM2B 2AW0A 2DXEA 4ZVUB 3Q8QB 2M7SA 1CS4A 1C1BB 3MAHA 1HWJA 4FYXB 3CDEA 4OL8A 4K4TA 2ZE2B 1U1KA 2WOMB 3JSRA 4OV1A 2J7WA 3PW2A 3H7HB 3R5DA 2DIUA 2RHSB 4IH7A 3C3LA 1E6YA 2F8HA 4LFAF 1FNOA 2M4MA 3DRRB 4F4YA 4ZVRB 4DX5A 2GIRA 4KBIA 2CQ1A 2LEPA 4HI1A 2MKSA 4B9UA 1ICEB 2VDHA 3KHGA 4ZJQA 3AJDA 4AT1B 1XNRF 3A3PB 1VDHA 3BKFA 1JNRB 5GAHI 4NLTA 2ZH7A 1TFWA 2X1BA 2CPFA 2Y1RI 5DZ7A 1AUDA 5D0EA 2PDAA 2BRLA 2CPZA 3PR5B 2DGSA 1S4FA 2OP5A 2R7UA 1EP4A 1X9SA 4XDDA 2IJFA 1NMEB 3AB2B 2QA1A 2OIHA 1XNQF 1WHVA 1CJUA 3R3TA 4MT1A 2KM8C 4H4MB 5J2MA 4FF4A 3CD6S 4R0JA 2GQCA 3IR7B 1X60A 3UDCA 4A8MP 2HHHF 3QRPA 2HHSA 1S79A 3CCTA 2LQBA 3DI6A 4OJHA 4QU7A 1B99A 1WC0A 2CQCA 3EGVA 5B0FA 1NXIA 4NOHA 1B7FA 2VOPA 1EJ7L 5C25B 2J0XA 3T3FA 1S12A 5L38A 1I3OB 2ZUGA 3NAHA 3TUIC 5J1EA 4CLTA 2UXDF 2VG6A 2Z0GA 2WW8A 4OZ2A 4JI8F 1BC6A 2AZ3A 5F8JA 2ZH6A 1PAUB 4NCAA 1XWLA 3Q8YA 3DOKA 4A8YA 1KFDA 3MM7A 1ZAVA 4FBTA 2H9ZA 1QAXA 5EWFA 2EWHA 3M8RA 1MW7A 1RBAA 3SXLA 2B8QA 4LF7J 1N34F 2EC0A 2RIJA 4OJ1A 4NXMJ 1BQMA 4P6QA 5IZHA 3RJMB 3HSGA 1QM9A 1H72C 3I0SB 3I9V9 4LR8A 2KYZA 4O4GA 1WEYA 4GVBB 2ZH4A 1R0AB 2LFVA 2I9SA 2HHVA 1S9EA 2CQPA 4M5JA 5J2PA 2G1HA 4OFZA 3FC9A 2B7CB 2V2KA 1U8SA 2RRBA 3EZUA 4ED3A 4KH0B 1CJKA 2GC8A 4C8LA 4DL5A 2IAJB 1LOUA 3R8YA 5IT9Y 4QCLA 1VQMS 1GMWA 2KT5A 5C5JA 3TW0A 4X2BA 3B54A 3T6JA 1JB0C 2MZSA 2BQUA 1CQMA 5HATA 2N82B 4NEZA 1EP4B 1DTTB 1FKOA 3VR1A 3Q0AA 2AGQA 2A0FB 1FWPA 3PX6A 1YJWS 4DSIA 3P96A 2H5JB 5FJ4A 1NAQA 1NH7A 1FEEA 1W2IA 1NZAA 2XI3A 2XI2A 2HS3A 3D0GE 3P5BP 4KKOB 4L76A 4EI2A 4C4WA 3HF5A 3J7A1 1RWUA 2CJBA 1D8ZA 3ISZA 1C1CA 1WD6A 2BRKA 3HHLD 2HFSA 3M8QA 4U96A 5ETPA 2LVWA 4RNHA 2CQ2A 2BJ7A 2MZTA 4P2SA 3UD4P 4C8OA 2BANA 4P75A 5I3QA 3IMQJ 3CC2S 2J7KA 1QY7A 3N79A 3MCOA 3OUYA 2HS4A 4YHHF 3MMBA 5HLFB 1EKSA 1VGYA 2KRRA 4TQSA 1HHTP 2KXHA 4K4ZA 2JEGA 2V4JA 2DR9A 1OPZA 3J81U 3KLHA 1BD6A 1JXEA 4ZPBA 2DNHA 4AYBD 2FY1A 3M32A 3Q83A 1JKHA 2R3VA 4R5PA 4BBYA 2X3DA 3TZZA 2L41A 5AE1A 3GG1A 4DR3J 4WF9Q 1GQEA 3MUTP 2KHCA 2UUWA 4OYXA 2WVEA 1RT1A 4WFYA 3IN5A 2QO3A 5ETVA 3RBZA 3LQVA 3I0SA 3MUVP 2XMTA 1OY6A 1Y4ZB 1IM6A 1VIOA 2EK1A 2YNFA 1GMUA 2CXEA 2ILYA 2J9DA 3MMAB 3QAUA 1YJ7A 3ZZOA 3A12A 4DBQA 2RHQB 5K20B 4H4OB 1S9EB 1S6OA 2QYCA 2XG8A 4O3PA 4CH7A 1R43A 5KFYA 1XNRJ 1Z2ZA 2HBQB 1VQ6S 1IBMJ 4HHHA 4HLBA 4M8LA 2MQQA 3KLGA 4HACA 4K59A 3QZ8A 2E1AA 3BV8A 5A8WB 5FDLA 3T1YF 1VJQA 1AZSA 4KT0C 1SQFA 1XNQJ 3TOQA 4CNZA 1QSSA 1MWZA 1NHVA 3NGUA 1LWCA 3CGIA 2JFDA 1N0UA 3VAFA 2HQFA 3CC4S 1QD1A 2B4VA 2C3UA 1V5IB 2O3DA 1RTJA 1WHYA 5DRKA 4F26A 4I69A 3ONQA 2CZ9A 3A8EA 3GV7B 2ZH5A 2JVRA 2XM3A 1BQNA 2C42A 1IKYB 3EZ5A 3V6DA 1FESA 2POKA 4ID5A 3C6UB 1HL6A 4K5RA 1G7CB 1U47A 2C28A 1KQGB 4AXIA 3DLEB 2KI2A 2VG7B 2XMAA 4F02A 2F3JA 4K4YA 4WXOA 4ICLA 3TR5A 2HBYB 1DJ0A 1LKZA 1P27B 2W4DA 3KNGA 1GEHA 1RU1A 4CO0A 3BDPA 2HAFA 4QU6A 2BE9B 1VQ4S 4IH6A 2CNLB 2OSRA 3W3SA 3JTPA 1YBAA 2W9BA 5I4MA 2W9BB 4LR7A 3V4IB 2Q66A 3OSNA 2RQCA 1FRMA 1DQAA 1UETA 2W2OP 3L4BC 4DU8A 3AAWB 1QSYA 2QLBB 2O66A 2EKNA 2LEAA 3J7Z5 2XZWA 2Y1IA 2IBOA 3BS9A 1Q0NA 2MGZA 2XGPA 1FKAF 1ZYQA 3R7SB 3CSKA 2A3JA 2WVFA 4MAKA 2F8MA 5DLFA 1VBXA 1HWLA 2Y3YA 2HSEB 4RX6A 1RTDA 2R8HA 5FD1A 1RT7A 3Q8SB 2HNZA 4B3MJ 3HO1A 1M90T 4M5NA 1UJ4A 4KYZA 1Q8BA 4DPOA 1JLCB 5K5MA 2V4RA 2KT3A 3PRBA 4G1IA 3T1YJ 4NLDA 4N47A 2COLA 2W8LA 2IHR1 2WOMA 1S6QB 2P5VA 2D3UA 3M6UA 1UP1A 1NPRA 3QWUA 3TJ9A 2VBYA 1GXTA 2JLFA 2OEKA 2RNEA 3M1VB 3NP5A 5K9FA 3A8IA 4DDFA 2NQPA 2B3TB 4O0IA 2D7SA 2OPSB 2ZUAA 3IP0A 5E3CA 4X4PA 1AFJA 3QAEA 4LRAA 1J5EJ 4I67A 4Y0FA 3BSAA 4J9SA 4JI3J 2V9WA 5CYQA 3DRXA 1GFWB 4OQJA 4MIBA 4F4ZA 4D3GA 4CCHA 3A8KA 3AA8A 4QWDA 2HVIA 3C15A 3EVMA 3G82B 1FHTA 5KFVA 2HIQA 4BDPA 1M5SA 3EX7B 2ATLA 1D9DA 1FXLA 2ACMA 2IBKA 2GJFA 3ET6A 4BCAA 2DHHA 2W7AA 2Z2ZA 2HG4A 3TP2A 2BBEA 5L1IA 1YBUA 1ZA1B 2DNNA 3HMJG 2DCLA 1Y7PA 3OHBA 2W1BA 2YH0A 3N9UC 3D6MB 1U0HB 3HZEA 3ZTOA 1S76D 2BEFA 2CPDA 3VCDA 1HWIA 5T7LB 1N48A 1RABB 2G0JA 2MPUA 4H4KC 4FPRA 3ZTRA 3OL9A 3PIOQ 1DQ9A 1KONA 2BM1A 4YQWA 3C16A 2HFNA 2JNJA 4F8RA 2APOA 4OI6A 2QLXA 1MMDA 3OQ2A 2V8PA 4ZCLA 1UWAA 1IQTA 3ZZRA 1R0CB 1KHWA 2J9CA 2QRRA 4LSLA 5CCMA 1L3SA 5E7OB 3TANA 5L9XA 4B3MF 2QJ3A 3HKWA 2RU3A 4KKOA 2GW8A 1F2GA 4EZ9A 3KLHB 4F0KA 1N4LA 1F5AA 1TL4A 3OR2A 4DXLA 4FF2A 3FEYB 4RW4A 1WF2A 2EBEA 2PT0A 3W9HA 2ZJPQ 4FYDA 3KKFA 2CYYA 1FK9A 1FFSB 2HEKA 4DR2J 1E6VB 2C2ZB 2KM8B 3CCRS 3IFEA 4UY85 1F6TA 1T8EA 4LF5F 2DHXA 4RU9A 4GKKJ 1SJQA 2LXUA 3M2VB 4ED6A 2K1RB 4ALZA 3TAMB 2ZH3A 2VU5A 3PYFA 3CMES 2WVCA 1OY8A 1L3VA 1Z2LA 4HT5A 5I3PA 3FBEA 1U1QA 2CRLA 2M9KA 3CD7A 3QGPA 3LP0A 4USUA 4Q0BB 2DT9A 1LXJA 4J9MA 1RAEB 5F8HA 3K5OA 2ZNZA 4DCJB 5H9FK 3M2RB 5A8RA 1S1XA 2X1GA 1R6VA 5DGAA 3LGNA 2FVSA 1TFYA 4KE5A 3P5TL 2DRAA 3CIZA 4Y2AA 4CO5A 1N56A 3ITHB 3R7BB 2HQIA 4RBUA 2RUGA 1TELA 2IM0A 3NCQA 2KG1A 4IUFA 4ZHRB 2JZ5A 4DUYJ 2M2BA 2VL1A 2VKZG 1U1RA 3CEDA 5B0BA 2QV6A 1S77D 3K2YA 3M05A 3ZZ0A 3HVTA 3LANA 4PQAA 1S59A 3JYTB 3CJ4A 4OHVA 3CXCR 5D3GB 1C4AA 2E5HA 4N76A 1IWGA 2WONA 3D6TB 5IT9U 3HHLA 4YB1P 2CVIA 3DMJB 4Y2CA 3UPFA 3CJ3A 4MK9A 2BQRA 2UXBF 5D15A 4ZJLA 1C0TB 1C0UA 3TA2A 3G8SA 1G4CA 3CJKB 3H2LA 1QE1A 3C6TB 3I96A 2ZC3A 4ER8A 1IUJA 2LKZA 2IJNA 3R5BA 1F5BA 1ZZFA 5LXYA 2BE2A 1VK3A 3M8WA 4NASA 3TJ8A 2XO7A 4NE9C 4ZP9A 1SH3A 1ZM2A 4YS2A 2QMXA 1MWYA 4ECVA 4N41A 4LR9A 3M9NB 3V6DB 2LQJA 3NGSA 2XHWA 2H51B 3R6LB 2ZDPA 1SJ4P 4K4VA 2B51A 2ZC4A 2KN4A 1F1BB 1IKXB 4USWA 4O3OA 3TVKA 2V0NA 5GMDA 4B9VA 4ANDA 4YP3A 1JLFB 1FVQA 3PX4A 4DX8H 3O5TB 2B4PA 4B02A 3CNQP 3HLUA 1P1LA 1RADB 1UVJA 1TAUA 2DK2A 2KVIA 2I5JA 3QT7A 5B0GA 1U6FA 4DUTA 3VAGA 3NNAA 2DGUA 1QAYA 4JP8A 3UDVA 3PO5A 1J5EF 2D9PA 3MEEA 1VYAA 1KNZA 1R8PA 3VZIA 4NXNJ 1KDNA 2VQFJ 4AL5A 1EKRA 2CJ9A 4NLPA 2CIMA 5D0HA 3MECB 2XS5A 3M1VA 2E9RX 4ZIVA 2R7TA 2VQEF 1SKRA 2Q1LA 1SPBP 4IG3B 2J0SD 1S1TA 2CQIA 2YKNB 4PYAA 1NKBA 1MLAA 1BQMB 2VONA 1LW2A 3TA0A 1YJ9S 1WG5A 1NJXA 3R5GA 2IRYA 2V8GA 3PEHA 4RBVA 3JS9A 2ZH1A 5DQIA 4E0DA 1TL5A 4PXBA 1Q8KA 1RT7B 2RF2B 3CMAS 2LEBA 1YKWA 3CULA 4ZLJA 1LW0A 2HQCA 1DAXA 4O3RA 3U1MA 1T95A 5KFFA 2RJZA 4E98A 3G4SS 4GRSA 3J7YI 4ID8A 5AT1B 1W7WA 2BMBA 2IRUA 2EG2A 3UQSA 5KFCA 5KG5A 2Y8WA 4RKUC 1JJHA 2B9YA 2E5IA 4I0WA 3D6FB 1H0HB 4DOZA 3PIPQ 4P7TA 1WUUA 2B5JB 2BW7A 1T03B 3K5NA 2V2ZA 1VRTB 2W9CA 1ZAXA 3ENVA 1FDBA 4QWEA 1Y0HA 3OFEA 4RR5A 3JAMU 2DGVA 2ZH2A 3HI9A 2OH2A 4LF4F 2DXFA 3M8PB 5LSOA 2XWXA 3J80U 4DV3J 1LWEA 3KWMA 4ED8A 3MCMA 2PE8A 3ZTPA 1F2HA 2OSQA 1WOPA 2HK3A 3GYNA 4ED0A 4ZPAA 1H7XA 1VHFA 4DL6A 3GSIA 4HHUA 2DVIA 1YRTA 4V19J 2DO4A 1PCAA 2JC0A 5JUMA 2ZM6J 3SZ2A 4JV5J 4KAIA 1QAJA 3E01A 3KDOA 3OVAA 1UVNA 3FGVA 2BJ3A 2HWTA 4RBTA 3DLBA 3KHLA 3CJRA 2C3MA 4P2MA 4WXWA 3DU6A 4O0NA 1JLFA 5U47A 4Z7CA 4DV7J 3O44A 4K4XA 2FVCA 1Y9OA 2XGQA 1JJ2R 2HK2A 4OZ3A 3MECA 2HVZA 1UW4A 2AF6A 4UOCA 4LSLB 3A3NB 2BR0A 2DHGA 3I31A 4RW7A 3GIMA 1U45A 4RW7B 1IVZA 5HMYA 2N3LA 3DGVA 4FYVB 1BUXA 3V5RA 1XMQJ 2N7YA 1AFIA 4JI7F 3RAXA 3D6HB 3CWJA 1NU4A 2NZ4A 2R7OA 3K58A 2A6MA 1X4FA 1RWVB 2EXUA 2DISA 3O8WA 5CA5A 1V3SA 2XLJA 2PI5A 4B3TJ 2H4YB 1Y3JA 5KT4A 2CQBA 4LF9F 1SIZA 3MFHA 1CJTB 2MYFA 1X31C 2FIUA 3LW5C 3PW0A 1RAJA 3ET6B 1TP7A 4CO1A 1CBKA 2XSFA 3I0RA 1YRXA 4AQYJ 2CJYB 1URNA 2YKAA 1VQLS 5DM7Q 1HR0F 4LF4J 2XMJA 5DETA 1GMVA 2UXBJ 3QBCA 2IM2A 2EI5A 2I1RA 3NGKA 4FF1A 2G0IA 4I56A 2DR5A 4MTPA 2JEIA 2GJIA 2W2NP 3PG9A 2WTFA 3VVUA 3I5CA 2PGCA 1N54B 3D66A 4HTJA 3H98A 5KT2A 2PMZD 4CTAA 2DHAA 4ZHRA 4C0BA 3G71S 3VAJA 3PX0A 3MAAB 4DV2J 1S4EA 1VRTA 2JEJA 4IR1A 1Y11A 3LPYA 4P71A 1RI7A 3PVXA 2VZ9A 4KY3A 4B9MA 3OL6A 3LOUA 1DBDA 3DDNA 3RB3A 1HD0A 9RUBA 2XY6A 1SJ3P 4USTA 2HWIA 1JLAB 2DNYA 5KFIA 2R7WA 4ED5A 4U9RA 1NZ8A 2HRTA 1IJEB 2QE5A 3KHRA 3ZO7A 3Q8PB 4K4UA 4CYUB 5I42A 5KOXA 4OI0A 1ITPA 2D74B 3LP2A 2K06A 3A13A 1B0PA 4Y2MA 3ILLA 4NCGA 3WIUA 4S0MA 2C2NA 3AH6A 4KFBB 2RB7A 3X1LB 2F1FA 4FXWA 2EVZA 3I82A 2V2QA 2WB1D 4PYDA 1HW9A 3IRWP 2PD1A 4A8FA 2R8JA 3QFWA 5E3AA 1FA0A 3P49B 2KXNB 2HFUA 4CNYA 3K8WA 1I6JA 3ILIA 2E5JA 3BN7A 2ZOFA 3UNYA 1XERA 3AD8C 3OR2B 1XMOJ 1ZA2B 1FCAA 5KFAA 1RHJB 2ZD1B 1NCLA 2MXYA 2E5LJ 4NCBA 4AQYF 4CLZA 2UVVA 1FJCA 2NXEA 5HL7Q 1SI9A 2Z2MA 3GZ7A 2VPXB 3QATA 3GE9A 3BQ2A 1D1UA 3FSIA 3DOMB 3MURP 3OVSA 3GR0A 2LQ9A 4ED4A 2KG0A 2ZJQQ 3DLKA 4PKDB 3IBCB 4U8YA 5KFOA 1RWOB 3D67A 2N4DA 3MEGB 1HNXJ 3F41A 4M63A 1MMLA 1V6HA 3K17A 2HZVA 4USHA 3AY0A 4YB6A 1XC9A 5A8KA 1LWCB 4UQTA 1FDAA 4C3KA 1NJYA 3FZBA 4O3QA 3NXZA 4ILMA 2M70A 1F5CA 3M8ZA 3FDSA 4WK3A 4ZVEA 1FEHA 3RRGA 4QIEA 2J7UA 3PEJA 5DDQC 2RKIA 4KHMA 2HZCA 1HKAA 3GLJA 2ZM6F 2E9TA 2PFFB 3UDLA 1EAYC 2EFGA 2P8IA 4ED1A 2Y0SD 4WKRA 4DQQA 2CQDA 4WPAA 5ETNA 1ZZNA 5J2MB 1HQUB 2O01C 2HVDA 1WJ9A 1WEXA 2HQDA 5HSPA 4J9KA 1AT1B 3Q8UA 1N5VA 1GNKA 2IPOB 2YNHA 2CAJA 4UUXA 3H59A 3UR3C 5G0RB 4QIFA 2ZZMA 2BZ2A 3W5XA 4GC7A 2ASYA 2HGMA 2YX4A 4EO8A 3PRVA 3DMJA 3DRYA 1EZZB 2CQHA 2VFVA 3G8QA 2P6SA 3GSDA 4WKYA 4IKAA 3W2VA 2MZ1A 1UJ5A 2LYVA 2ADBA 1VI7A 2PFDA 1R8BA 1VQ5S 1S9GA 5F8NA 2EBGA 3V4IA 1T02A 4I2QB 4ZCMA 3R97A 4N8NA 5DM6Q 2OKQA 4P73A 3R1HA 1NDPA 1C1CB 3M8QB 4DG1A 1RHRB 3ENAA 4PEOA 2DJWA 3CJ0A 3BDEA 1PILA 2YWEA 3GR1A 3K5PA 2BANB 2WHOA 3IAM9 1Y5NB 4DV6J 2C2EA 3DI6B 1VQPS 1U2FA 1JLCA 4FKXA 2X51A 4P7VA 5JMNA 4HH1A 1VISA 1L3UA 1HNXF 3D5MA 4KPYA 3BJYA 4ECTA 2CKWA 1U1LA 1X9MA 4I7FA 3CUNA 1WI6A 4DV1J 1NSKL 4ZVPB 1MSWD 1MROA 3MDFA 1RTIB 5LJ5Y 2GGPA 3RB4A 2AJ2A 4FNIA 1S0VA 4C48A 1CJKB 2M0GB 2ZHAA 1W26A 1J5OA 2ZEJA 4TYAA 2GMLA 2KO1A 5A8WA 1XQIA 2QMUB 3BGRA 1LWFA 4HACB 2VPYB 4J9PA 4F4WA 2B6AA 2R7VA 3BEGB 5FLXY 4Y3CA 2MZJA 2FVPA 3MM6B 4P10A 1HQEA 3GFYA 2YY3A 2XLIA 4DR3F 1SL0A 3HJFA 1JXVA 4JYAF 2QLJB 3SQOP 3CCMS 4AL7A 1WNEA 2CDRB 8AT1B 5MLCV 2HHWA 2CJAA 5F8LA 3GILA 1IJFB 2KYXA 1VRQC 5KFTA 2MSSA 1VQ7S 1SQEA 2XZTB 2HURA 3C6UA 4N56A 4QWAA 3CVKA 2MQLA 5L1LA 2RE1A 5KG2A 4GMKA 2DR8A 1TUWA 2QTWA 3GIRA 3VHQA 4OI2A 4FNHA 1T9WA 4HT7A 3TZYA 1HQUA 5J1PA 3G6XA 1RT3A 1NKEA 3MCNA 1HNVB 4Z7YA 2GVZA 2KHDA 3TUZC 3KJVA 1SUQA 3T5KA 1BQXA 4EEYA 5J2QA 1HR0J 1FX4A 4PXDA 5KFLA 5BJRA 1HI0P 2OLWA 4WFXA 2DNPA 4YR3A 1ZH5A 3TA1A 4P9SA 4NLGA 4C8MA 2F4VF 1VQ9S 2RUSA 3TYTA 2VC0A 3ZC4A 4X65F 1H2TZ 1OMSA 1OYEA 5B0AA 2RD5C 4QWCA 1R8CA 3MUMP 4FF3A 2HVHA 4OX8A 3VVTA 3GV8B 4ZMMA 1WG4A 4ELTA 1Y10A 3U1LA 4F67A 3I5BA 4EBEA 2OPRA 5L9NA 3I9ZA 4X62J 5LJ3Y 2C2RA 4RZRA 1NK4A 2FJEB 3VAHA 5B08A 4ZVGA 1I51B 1KOOA 4ZP6A 5IC4B 1XR5A 2MKKA 2QGFB 2VDIA 4P52A 2QT7A 3TI0A 3SV4A 2IC3B 1TKZA 1F3VA 2AIRB 5HAOA 1TKZB 3DCAA 1X4DA 2R2SA 3EE3A 2MGZB 4DUYF 1IBKJ 2HMIA 3HHNB 3OFFA 2DNZA 2CPYA 3AD9C 4CWBA 4BS2A 3GCXP 1PGZA 4YY3J 1X7VA 1YI2S 1RT6A 3KFWX 1IBCB 4IO1A 3PO4A 2HNZB 2DY1A 3TNVA 5BYRA 1UWBA 4O3SA 3FFIB 5A0YB 1CJTA 1URRA 2AP6A 4WP3A 4FXVA 2K2PA 2V34A 2BKNA 1X9WA 2IM1A 1VQYA 3MD3A 3MHYA 2RH3A 3LWMA 1YJNS 5LSLA 2XB2D 1E6YB 1AYEA 3M6WA 4X4TA 5H9EK 1WF0A 4J7CA 1U2CA 2CZVC 4IRKA 1DTQB 2NYIA 1S49A 1NDCA 3TZWA 3MAAA 3T1HJ 1YZ6A 4ZLLA 3W2VB 4DV6F 1SUQB 3B8HA 1DLOA 1TMMA 3KLIA 2A10A 1DLOB 5KFZA 4DHVA 4YOEA 1KVKA 4IQXA 4HTIA 4DV5F 2AYBA 5KFUA 3NCRA 5IQQA 5EWGA 3LUYA 3TAPA 2H5EA 4W98A 2D1CA 3EGNA 2H3EB 4EZ6A 1RDRA 2DO0A 3GYXB 2E5GA 3LALA 2J0QD 2HGLA 2BJ9A 2KXFA 4BC9A 1RT3B 5DQGA 4ES2A 3CCVS 1IBLF 1J27A 2AD9A 2LDIA 1FWLA 1FKPB 1K9MT 4TU7A 1Q7LB 3L09A 1K73T 3W9IA 3KUEA 5J1EB 1ELOA 2ZKUA 3PTWA 5D0RA 2AKWB 4DFKA 1RHUB 4JI5F 4FXDA 1FXDA 3N5BA 4YDXA 2CG4A 4USJC 4L3NA 4ZVSB 1FRJA 4E2FB 2V4QA 1TTHB 4I2PB 2W2PP 2EK6A 4ZITA 2EFVA 4DQSA 1TL7A 1RTDB 2HS0A 4LBPA 4YB7A 1LWFB 1QJHA 3JXOA 3UNGC 2CQGA 2F9JA 3OL7A 2UUCF 4O44B 2BQ3A 4Q43A 1SH2A 2Q6CA 2L3MA 2PMHA 4K0KF 4GO7X 3CTRA 3IM8A 4AUKA 1G2EA 1NSAA 4OMFG 1SV5B 3E8OA 1UFLA 3QIPA 3SBMA 2ZNYA 3QIPB 3BGRB 4LRCA 4KTQA 1TL3B 1F9FA 3FJ2A 3JYTA 2E44A 2B43A 2GV1A 2WSCC 3NBPA 3BN4A 2RQKA 5B0DA 3LO3A 4PPZA 2BOAA 2FZGB 4DV5J 4QR2A 4EBDA 3PW4A 4LF6J 2RSQA 1LWEB 1YJVA 2R7XA 1TUGB 4WTYA 2MKJA 4OZ0A 1UMJA 1B4SA 4CLKA 3ZZUA 3Q8RB 4ELVA 4X4OA 4I2QA 3M8SA 1WSRA 4ZPWR 2RRAA 4J90A 2HNDB 4KH1B 2HQ3A 2RDDA 1GXLA 3R2CJ 1NHUA 5KFKA 3AXMA 2IVYA 2MKCA 1RAFB 1JMTA 3PHTA 3SCKE 5EDWA 5E33A 1WHWA 1SH0A 3IR5B 3UDEA 2XTJP 2HNYB 1G3OA 1IKXA 1KLMB 1FRLA 3CD5A 4MMOA 2BE7D 4NRTA 3AOBA 2QA2A 4WYLA 1NSQA 3U1NA 1HHQA 2EFNA 3LAKA 3MMCB 3JAMY 3PR4A 1MN9A 3TQ1A 4IFYB 1HHSA 1NM2A 1RAIB 2RDIA 2W7PA 1ZTWA 5DZ6A 4WIIA 2OTJS 1S7IA 4X4NA 4OZ5A 1P9YA 2Z58B 3CJTA 2P9EA 3LP1B 3BO4A 3FQKA 4OJGA 3UN5A 2UUCJ 4LF9J 1WG1A 1TK8A 5KFGA 5HVHA 4EBCA 4KO0B 3M32B 3D0IE 3B4DA 4DR5J 4LF2A 4NLUA 1RYRA 3KMQA 2DEIA 1HMVA 5KFDA 4DL0C 5KTQA 3SI8A 1N88A 2F5GA 3BYPA 3M7VA 4A46A 1WTFA 3MEEB 4R8UB 2X1FA 1Q81T 5IOLA 1B0VA 1VHIA 3CJ8A 3GCWP 4NA2A 4F0MA 1H2VZ 2W01A 3I5AA 2QX0A 2GA7A 2Q43A 1J2VA 1BE4A 1QTNB 1UWBB 1YSJA 1YK9A 1Z4UA 2I8EA 3FNNA 4WU3A 2ZH9A 3H90A 4RW9A 2VBWA 5C2GA 4MKVA 4ATNA 3T5LA 1S1UA 1XMBA 1HIYA 4PQUB 1CJVA 3CT9A 2MZQA 3H42A 3NL0A 3P6YC 3G6ES 5CCLA 2WCXA 4XPEA 1X5PA 3PJXA 3H5UA 2BKOA 1KD1T 1FNMA 2HW3A 4DFMA 3HVTB 2B0GA 3B4MA 3HP6A 5HI7A 4LIRA 3H5YA 2VQEJ 3C19A 2KJVA 3RBEA 1A7GE 2NXCA 1QSLA 4KJIA 1KHVA 2OFHX 3OR1A 1C4CA 1FTRA 1IBLJ 3W5ZA 4DL3A 1WORA 2LLZA 4B3SF 1RWXB 3MTJA 1WDTA 2A6OA 5LM7E 6FD1A 2OHDA 4A8QA 4DR6J 1YJTA 2GAHC 2HNYA 1TVRB 4ECYA 3K7RA 4PPDA 3ZZPA 3E2EA 1EIYB 3RAMA 2EFQA 3D1OA 4AXJA 1I94F 3BSOA 1JLAA 1RT4A 3W8PA 4ENOA 4XAKA 5AJ3F 2HHXA 3D7SB 2IVFB 4G3IA 3UW1A 5DG8A 3HVRA 3GP9A 3BSNA 3CE8A 4EGLA 1X0FA 4IRCA 2FB0A 3MM8B 1JQGA 1H98A 3MM9A 5HJYA 1OSDA 4U7UK 5CABA 3W1YC 4F0HA 1OO0B 1SBRA 4LT6A 4IDKA 3WDOA 1UJ6A 5KFMA 2PA8D 4EYHB 3WQPA 1HARA 2CADA 1W2BR 2YWGA 1T9TA 3DOKB 3CCZA 2GVDA 1Q53A 1VC5A 3EDQB 2VG5B 2D69A 2PI4A 3CCWA 5EWEA 3JQJA 4PG6A 4F4XA 1S0NA 1K44A 2XNQA 1N36J 2E9ZA 2KU7A 4L73A 5F8MA 1CC8A 2GAGC 1M5PC 5E5NA 5RUBA 2CVEA 4L6V3 3HFVA 2CPHA 4J9VA 3V6HA 3UCUP 1UEUA 3IWNC 3W62A 4ECXA 4DV7F 3SDEA 2XMKA 2W24A 3JSMA 1TL7B 2XCPA 1PC4A 3H0PA 5GMEA 4F04B 3K57A 4OI1A 4PZVA 1RLCL 2X3GA 2VHGA 1P1TA 1KTVA 2YWFA 4KR0B 4CZCA 1FERA 1TZ0A 2QG9B 3HSZA 5A8KB 4B9LA 2HVEA 2A18A 5ETLA 3TVYA 2OFGX 2XSJB 4F4AA 3MFIA 2AYGA 2BDPA 1I94J 4DQIA 1FE0A 1RE1B 4OYMA 2MKHA 3SCLE 3GQCA 4WE1A 3J7YU 3EPIA 4DV4F 4X64J 2ASDA 2FJXA 3Q24A 2VFSA 1YWXA 2BABA 4ECQA 2XS7A 3QGGA 1IBMF 4DSLA 4J5OA 4NX9A 4LFBJ 1RHMB 1P6TA 3OSPA 3D3CJ 1DY3A 3UO0A 2BACA 4PWUA 3GTYX 3DYAA 1T03A 2YVSA 3MM5A 3DU5A 2R7SA 4AL6A 4TY9A 3VV2B 2MJNA 2N3OA 2E1RA 3RYLA 2MLYA 1YLXA 3EDRB 4U7CA 5CZVA 4ETZA 3OFHA 8RUCA 4KFBA 3HHLB 1YIJS 2AEMA 2KB2A 3MM9B 2YKMB 4B3RJ 1YZ7A 4TXSA 3N01A 1S6PB 1U49A 1T0TV 4DR7F 4C9DA 1UA0A 4FPIA 1WKLA 4Q44A 3QFHA 1SC6A 4NWBA 1XTZA 2UU9F 2YX7A 1VBYA 1D9AA 3RTVA 3F0NA 1A9NB 1NDKA 2W2QP 1IQZA 2CPEA 2XWYA 4HI2A 4OYWA 2IFXA 4YR2A 1KKHA 2XS2A 3SIPB 1WDDA 2V8HA 3KMSA 1HPZA 3DC2A 1HNWJ 2WVDA 1SL1A 4PWDB 4DSFA 2NXNA 3POTA 2WZ1A 3EZOA 3I0RB 1RXOB 5C24A 1CVJA 3MXHP 1NO8A 1UPMB 2YWHA 4OYPA 3O1LA 2XNRA 2HHUA 1LFPA 3JQKA 4PAAA 2BM0A 2XY7A 2M3DA 5EGYA 2Z57B 1Z1ZA 5B09A 5CXTA 4C8KA 1H73A 5LMNJ 4Q8FA 1TKTA 4DV4J 4UW2A 1U24A 3VZHA 3L7PA 1UZDA 2RQ4A 4IFVA 1SXLA 3KLGB 4U7UD 3RUBL 4ZLPA 2RF2A 5E3RA 1SKSA 4C0OC 2CNKB 3IO1A 3ELHA 1N5YB 2BJDA 1RGVA 1X4HA 5K14A 2RILA 1EARA 3CIMA 4LBIA 1LW2B 3QSIA 2XMUA 3DOMA 1I1GA 3SDEB 2OPPB 3W5YA 2OPPA 1S57A 5D4LA 4J9RA 5FDLB 2AGPA 3ENWA 4NMLA 2FC9A 1NDLA 2G13A 4CI0B 5J2PB 4B3RF 1TV6A 3DHWC 1VQSA 4RWWA 4DR1F 4CO4A 1NKCA 1HD1A 2IDLA 2ZHBA 4K2JA 3QT6A 1WOOA 5KT7A 4Q45A 1U25A 4NYZA 3WZ0A 4J9NA 4P2XA 2M8DB 2CQ4A 4OHYA 1JJCB 3D54A 2OGUA 1YDLA 2Y1LB 3S01A 3VQTA 4CLUA 1RTJB 1JXLA 5T14A 4MKYA 4HH0A 2CJQA 4D3HA 4X4RA 1JIHA 5L1JA 2VBZA 3BBFA 3IBFB 2LQ8A 5HVFA 5T41A 4DSEA 3BGFA 5D78A 1IKWB 5HJXA 4X64F 1ZM4A 3M8PA 3JTNA 5DDOC 2VJUA 1GTEA 3GJTB 1Q8IA 2G2ZA 2DCUB 5KG3A 3ZNUA 2VQFF 2QEXS 2BJ8A 2UVRA 4CDIA
chains in the Genus database with same CATH topology
4JBCA 3CCJS 1JKHB 2DTJA 2R2RA 4XK8C 1R7IA 1ZPVA 4X4QA 1NB7A 2L9DA 2UZAA 1U2RA 2OPQA 3V81B 2O1PA 4B3OB 4CO3A 5LL6d 1GH8A 1S7HA 4TKTA 5EX0A 1DQ8A 1D8YA 5IT0A 1GX6A 2AJ0A 4LJMA 1TAQA 2ABYA 4XDCA 4PWDA 3HPOA 4UY8T 1G6BA 2N4CA 3ICLA 4NLVA 1S6UA 1S6QA 2HLTA 5KT6A 1J5OB 3NCPA 1X8DA 4F50A 2MB0B 1RT5B 1YRUA 3NMRA 2P9GA 3PKMA 4TYBA 2CZ4A 1CC7A 1Q79A 4LSNB 4OX7A 4PRFA 1X4GA 2RS2A 4DR2F 2YTCA 4ZPVR 1JLBB 2DH9A 3BR8A 1TKXA 4OHWA 4O4GB 4HVZA 2K1RA 1KN6A 3RR8A 1LW0B 3IS9A 4RW9B 3ZZTA 3DRRA 3T1HF 4WE1B 2FVQA 1U09A 1WF1A 1KLNA 1LK7A 3NBPB 2DGOA 4Q0BA 2HPUA 4ZCIA 4KB7A 2B9XA 5G0RA 4F3MA 5JXSA 1ZM3A 4PG7A 3CCQS 2DNMA 5CYJA 1HNVA 2F9DA 3F56A 4HDGA 5E0OA 1N32F 4NLQA 3UE2A 2ERRA 1IKYA 3DN9A 1UVLA 1S9GB 3EUNA 5CHCB 2YWKA 3OTDA 3MR5A 2JOQA 3TAQA 1UVMA 1TKDA 4QWBA 4IRDA 1OSCA 4WCEQ 2AGOA 5J2NB 3KYLA 2DGTA 4NYPA 5CD4H 2LU1A 1B0TA 1X0PA 4ID5B 4E8UA 4RW8B 3K0JA 1DZ5A 4OI3A 1DURA 3KLFA 2FJBB 1MU2B 4CIOA 4Y34A 3G96A 3CJ2A 4YFUA 2YNGA 5KFXA 4DL4A 4RW6A 1R89A 2JJ4D 2W8KA 1XBWA 1YTYA 3OLBA 3LP1A 4IH5A 1AXQA 4F25A 4DQPA 5HMXA 3JSYA 1FDDA 2DNKA 5GAEU 2FDNA 4C11B 1GT8A 4A8SA 4B9TA 1NRKA 2Y1JA 2C22A 4N77A 2MQPA 2VOOA 1FD8A 4J9OA 3ENQA 3DGPA 2BVZA 3MR2A 4PXEA 1V3ZA 2J8AA 4NA3A 4OLOA 4FZVA 4RNMA 3F73A 3G6YA 2L9NA 3QO9B 1VOMA 3GV5B 2PA3A 3UD3P 3HKZD 4YEAA 1K8AT 4DV2F 2C2DA 3D28A 5A0YA 3SYZA 4LQ9A 3POTB 2BV3A 1FT8A 3THTA 2MY7A 4KQZA 4OHZA 4QBUA 4Q2MA 2DB1A 4C98A 1HBMA 2B5JA 2CFXA 2FHJA 3DHXA 4DEZA 2AJQA 1S1XB 3FEXB 2IYGA 1R8AA 4ZA1A 5A2QY 2FJAB 2VPZB 3TVZA 1IKVB 2YNIB 2V8VA 1K0TA 1TK0A 5C42B 3PDNA 4KRWA 1L3TA 1Q1KA 4IG0A 4DUZF 5E3PA 3KG0A 2C3PA 1KC8T 1BGXT 2M52A 4DN9A 2QA4S 3IWXA 4LF8F 4X66F 2DNQA 3WX4A 2GMHA 1VQKS 3HT3A 4YR0A 5HBMA 1KQSR 1TQLA 5DDRC 4Z2XA 4A8WA 2VG7A 3I55S 3DLEA 1FF2A 2A2CA 2AJFE 4G1PA 1XMOF 2I5JB 3OJUA 3MM5B 4I6YA 1A6LA 3PFEA 3MD1A 4TN2A 2EKYA 4A8XA 1N5QA 1TV6B 3SSRA 3OTOF 5HROB 4DLEA 4JI0F 4NLWA 4XO0A 2R7XA 1K0VA 2MY8A 4A8OA 4OJ3A 2IM3A 1X5TA 2FVRA 3HX9A 3AHPA 3I87A 3EXCX 3RRKA 1QTMA 4JI4F 2JC1A 2MHNA 5DDPC 1NJWA 3CDWA 1Y5LB 3CB4A 4PUOA 4NL5A 4IFVB 2DRBA 2B4UA 1FD2A 4I6AA 4TLQA 1ZBTA 1JX4A 4JI3F 3MMAA 4RWXA 1D0EA 2AV5A 3CDUA 5JVHQ 3AJ1A 1S9FA 2W4CA 3NGDA 3X3UA 3IGVA 2UVUA 1U1PA 4I6WA 5D77A 2GMJA 1DFDA 2XY5A 2YNFB 2HHTA 3IS9B 5IM0B 3R27A 2OPSA 1HBUB 2BXJA 2XBPA 3ITHA 1SJ1A 3GFHA 3MM7B 4MK8A 1DTQA 5IWAF 4L72B 2X1AA 4O3RA 4C2MA 2V8DA 3HHKA 1RT6B 1RYSA 4DWIA 5KFNA 4ECZA 3TRGA 3UWTA 5DG7A 2FJVA 5A8RB 3IA0A 3THVA 3DRSB 2M88A 2WB4A 4ZP7A 5KG0A 4DJBA 4JI6F 5KT3A 4UQGA 1U4BA 3MM6A 4DF4A 4FXDA 3ULHA 4F3QA 3WBZA 3F44A 3OR1B 3K5LA 2HNDA 2GQ2A 4HL9A 2VH7A 1K1QA 3MGJA 2L9WA 2YKPA 5DJBA 5AE2A 2KH9A 4DS5A 3N6NA 2FTRA 4C8NA 4WFNQ 5KFEA 2DD8S 1DHMA 4MKBA 1L5UA 4LF6F 1RA7A 5IT4A 3KHHA 4LFCF 1S6PA 1KVJA 1IXKA 1RTHB 4XIUA 3M9OB 2A1BA 2AQ4A 4RLEA 3R5AA 1VIXA 4MFBA 3IAS9 4C3LA 5A6PA 4RW4B 4Y00A 4NXMF 5F0UA 5HN0A 5GMKa 1HMVB 3IR6B 2M8HA 4RW6B 3CDAA 5MAOA 2RDJA 3RRHA 3DLLQ 1T05B 3TX8A 2FLPA 3AQOA 2JHEA 3B78A 1KQFB 3MPYA 1S1VA 1JLQB 1Q7YT 4FP9A 4MYTA 2NXUA 4H4OA 4O44A 1OS5A 2KRBA 2YKNA 4M1KA 1KEKA 4WK1A 3S8SA 2UUBF 3UR0A 3IGNA 3M9MB 4PXCA 2FJWA 3S1TA 5AXNA 4YB5A 1Y00A 1FXRA 5KT5A 3QO9A 5B0EA 2ZH8A 2GX8A 2E5LF 1XR7A 2RRNA 3UI3A 3BB5A 1EETB 1RKJA 2QMWA 4ZK7M 1KS2A 1NK5A 3CC7S 4YMEA 2LA6A 2FJDB 3MEDB 1M1KT 3OL8A 1HI8A 2LXFA 2WSEC 1TK5A 1H38A 2HAIA 4QYRA 4BWMA 1TR0A 3CCUS 4DF8A 1HBOB 1WWHA 3Q22A 1SKWA 1IR0A 3KK1A 2DNRA 3RR7A 2FHMA 3U02A 1M0SA 4V19X 2K3IA 3R1LA 2YH1A 1RA6A 4ED7A 4TU9A 1MU2A 5M2PA 3KLVA 4QZVB 4WYWA 1KSPA 5LXRA 2R8GA 2OMLA 3E51A 2DHSA 1LV5A 3NG8A 3VAIA 1KOHA 2E7WA 3KLIB 1FJ7A 3TO8A 3QPIA 1X4CA 2IVMA 2L08A 3T19A 2P9CA 2DBBA 1AROP 3HZGA 3THPA 5J2NA 3RAQA 4MFBB 2K7KA 1SIWB 5F41A 3QGHA 1HYSA 4R5PB 3MTKA 2O67A 3H5SA 1LFWA 5THWA 2VODA 3KLEB 2RS8A 2ALZA 3A1YG 3KLEA 2BUNA 2V9KA 3M6VA 1ZM9A 2W4PA 3OFGA 4MYUA 2OPRB 5B0CA 4NLYA 2MZRA 4K50A 5G4DA 2E29A 5CYMB 4RUCA 1O8BA 3OTBA 1VC0A 1U1NA 5JJBA 3JB9k 3PZPA 4IO9Q 2ROGA 4BHQA 2XC9A 2MHEA 2ZJRQ 2R9LA 1FRHA 3OTEA 4MH8A 1NK0A 4W92B 2HMIB 2YQ3A 3DXBA 2BJEA 4ZPTR 5K14B 1FJGF 3MPVA 3N5FA 4QOTA 3CCSS 1CEZA 3MEDA 4JUZA 4CT9A 3IG1B 2PN6A 2GHPA 3EYZA 1H7WA 3FMBA 3O6QA 4NXNF 3MEGA 3BR9A 1UFWA 3B82A 4QIGA 5F0WA 3D0HE 3T9ZA 1U48A 1VC6A 3KNAA 1HI1A 5KFHA 2ZFHA 4DV0F 5H9EJ 1ZOTA 2DH7A 5SZTA 4Y65A 3DLGA 3H8YA 3O3LA 3DLGB 2WONB 3G8TA 3OW2R 4GC6A 4DL7A 2J9DE 3NAIA 5AXKA 5KG4A 4QPXA 3Q2SC 1HW8A 2HHPA 5F3ZA 3H25A 1VMBA 2EFOA 3V4MA 5KG6A 4QU7A 3PACA 2DNLA 3RW7A 1UEVA 3KK3B 4X84A 3H5XA 3OBIA 3E3XA 3QWPA 4GO5X 4OHXA 2LECA 5CH7B 1S1WA 4ZP8A 1S77D 4OI4A 3MM8A 3C66A 4LQ3A 3MWBA 2EW9A 1R3NA 2G0CA 1KRPA 5D4NA 2FLNA 2CPXA 3J7ZT 5KFBA 3BO3A 2GCFA 1LK5A 3AQPA 1Q82T 2BDPA 3G6VA 2FHOB 2GGPB 5AXMA 4ES1A 4I64A 4CQ1A 1NK7A 1XN9A 3MMBB 5HP1B 4EWTA 5HLFA 1JJ4A 1PC5A 1K1SA 5AXLA 5KFPA 5L39A 4I7FB 2NREA 4DG1B 4USIA 2RU9A 2WBRA 2F8EX 3Q23A 3TUJC 2IC3A 1ZPWX 1FJEB 1RTIA 3KOAA 3KK2A 4R0EA 3KK2B 3NLCA 4Y2IA 4DSKA 1VS3A 2FHJD 3PW5A 5EX3A 5DGBA 4F2RA 2XULA 4KHRA 1Y5IB 2XSJA 2E7XA 2MKIA 1ZAWA 2K8GA 3T1AA 1R0AA 5CQGA 3C8YA 4Q5VA 4F3OA 1XK8A 5D4OA 1XR6A 2VKRA 2KZZA 2LMIA 3PXGa 3L7OA 1JLEA 3LAMA 5DO2A 4KGKA 3S7RA 5IM0A 1QAIA 3CO9A 4J9QA 3HHDA 3KK1B 3BO2A 3SV3A 2CJKA 2MQMA 2DR7A 5EHHA 1PO6A 5T7LA 3UCGA 1LQ9A 2ADCA 5IQ6A 2BYCA 5LMUF 3FVYA 3K59A 4B3TF 4ILRA 1QUPA 2OD4A 3M2UA 3M30B 4GKJF 1X4BA 2XMVA 3DDKA 1M5OC 2GQQA 3QJPA 3ZZYA 2MQNA 1MMNA 2MJUA 3CD0A 4TNOA 1JLGB 2J5AA 4NLRA 3DLJA 7FD1A 2QA4G 2YKMA 4ZPCA 2UP1A 4WZQA 2QIFA 2V5HG 3KJVB 5J2QB 1HA1A 4NRUA 3ETOA 2DITA 4QR1A 4FS2A 4OHYA 5AE3A 3OJSA 3V6KA 4RW8A 1T94A 2DPJA 1T05A 1C2PA 1D3WA 2RQMA 1OQ3A 3MMCA 1VQNS 3IWNC 2OJ3A 2JX2A 3E01B 1REVB 2V4JB 3BQ1A 4JV1A 1S1VB 2GFFA 5DS7A 4C3MA 4C11A 5I3UB 4H4MA 2UVWA 1WTBA 3GMGA 3L95X 3OV7A 4OZNA 4HKQA 3CJKA 4U6PA 4C7QA 2OTLS 3EXYA 1U1OA 2NUHA 2KDOA 4DLGA 2NPIA 4N8OA 1S72S 4ZVHA 1RT1B 1FNXH 4NZ0A 2VASA 1RKIA 2ZD1A 1ROFA 1SJRA 5J1NA 3SSQA 4ES3A 3PM9A 4IQMA 2A2DA 4QIVA 4ZVFA 3GIKA 5L1LA 1Q4RA 5CYMA 2MDAA 4OZJA 6FDRA 1T3OA 3PJWA 1X4AA 4IOCQ 3EGZA 1TKTB 4EO6A 3DRPB 4KV8A 2KKHA 2R2UA 2WK4A 2D3OR 3MMJA 4DMZA 1NJIT 3JSMB 1HNZF 4B9NA 1BY9A 4M5DB 1MROB 1TL3A 3FFIA 2Z8QA 1H2UX 1RJJA 4AXJA 3N28A 4EU0A 2AX1A 1DARA 2VFTA 2PSZA 3M2RA 4K4SA 4CTAB 5HO4A 3KG1A 5GADI 2HYIB 3N6MA 4PG8A 2IA0A 4QPTA 3WC0A 1UVKA 2IA6A 4LSNA 1F0XA 3TARA 3DOLA 3RB0A 1C1BA 2VB6A 1WACA 2FC8A 3I56S 2NLWA 3NMAA 3FZ2A 3N0VA 5D8HB 1F60B 4KIAA 4HEA9 3HHEA 2RMLA 1HBOA 1SJFA 2FGCA 2ZVSA 5KFRA 1U1MA 2YNHB 4EFAC 1YGYA 4TQRA 2HGNA 2DPIA 2OPQB 1TUVA 2D3ZA 3V81A 2OAUA 3BM7A 3DYAB 4MIWA 5F9LA 4J9LA 3UCZP 4DV1F 2BA9A 3SCIE 1IKWA 4EYIB 2YKOA 1N8RT 1N52B 5IXUA 4B08A 3QZ7A 3KLFB 4RU2A 4NA1A 4B3OA 4PUOB 1TL1A 2WSFC 4WU2A 5KFJA 3C2PA 2NSBA 1M5HA 5L8RC 2D9OA 5HMZA 3J80Y 4QR0A 2J6SA 2L48A 4Y2KA 3SMZA 1UA1A 3AA9A 3HM9A 5DQHA 1RT2B 2YNGB 2GHVC 1RT2A 2J6UA 1LXNA 1WELA 2MMYA 5FIIA 1KQKA 2EG1A 3S6EA 3VF0B 2UUTA 2LCWA 3V2UC 4G1QA 5KG7A 5SUHA 2DH8A 1V9OA 1HBMB 1VFJA 4DFJA 4O4RA 3OHAA 4ECWA 2V94A 5M2UA 3H4DA 4WFZA 3G86A 2NSCA 3IC1A 1JWWA 5CZXA 4K4WA 2E1CA 4ETXA 1APSA 3FRYA 2FPHX 1JLBA 2ZHOA 1VQ8S 3GG0A 4OLPA 4IG0B 1R31A 1HNIB 2DGWA 1X5SA 1HWKA 3M6XA 4A48A 3SCJE 5DLGA 3RBDA 4K2XA 2F7VA 2FGOA 3DM2A 1O0PA 1ULRA 4MIAA 1FE4A 4JV5F 1DTTA 1FKOB 4ED2A 2C3YA 3PNIA 3K5MA 3MOJB 5E41A 2CPIA 2ILZA 4H54A 4RUHA 2KFZA 3HVAA 1R27B 3LF0A 3OTCA 4LVOP 1IM4A 3IRXB 4QQBA 5B7WA 4X62F 1VBZA 3C46A 1FKPA 2B9WA 2J9EA 3DOLB 4C8YA 4O3NA 4YUDA 4HYKA 2J6TA 1JNZB 3D2WA 4ELUA 5I3UA 2XEXA 5JVGQ 2E66A 5GAHU 1HBNA 3H4BA 3G9CA 1O5JA 3EGWB 3MR3A 2DGQA 3SEOA 1ZETA 4Q8EA 3BF4A 4OZLA 2QSFA 4OX6A 1CQNA 5EN1A 2J76E 2Q79A 4BC7A 1M5VC 2BW2A 3MPWA 3OXLA 4DR6F 4K5SA 5KFWA 5IFMA 1FTCA 2ZOGA 4ICLB 2HFZA 2P6TA 3DFEA 1HWUA 2PC6A 3ISND 1D9FA 2DGXA 3GIJA 4JV0A 4FVMA 2K7JA 2ROPA 3FCHA 2GIQA 2VBXA 3AJ2A 2SXLA 1JLQA 1P9QC 3FRZA 2FHKA 2HRUA 3L3CA 2VG6B 4QYZJ 2VA3A 1Q8LA 1VRUB 5D6GA 3CPWR 4G6VB 2KFNA 4X4UA 4C97A 3K8VA 4MK7A 3OPKA 1NEEA 2LU2A 4IOAQ 3SQGB 3W2WA 1OPIA 1RQ0A 1N0VC 3IWLA 4ZDNA 2BOPA 3BGLA 3EPGA 1X5OA 2B6AB 3M30A 5HQ8A 1QVFR 1N5YA 2J0WA 2JSXA 4CH0S 3H40A 1N36F 1SL2A 2W9AA 1FVSA 2HLUA 1OQ6A 3I4HX 5LT5A 3JTOA 4LF7F 1JK9B 2CQ0A 1DRZA 4Q7AA 2WRMA 3BGUA 3RW6A 1W25A 2AU0A 4YY3F 2W9CB 1GAOA 3BSCA 4NCGB 2GHWA 3M2UB 3LWLA 4F4KA 1HBNB 2JFKA 3IRXA 4FVCA 1KFSA 5IS2A 1C0UB 1C0TA 3VAMA 1TVRA 2JLEA 1UAWA 4DR4F 2GO8A 4R25A 3PRDA 2LXIA 1YVFA 1VK8A 3I6PA 3SFGA 4QW8A 1RT4B 4LFBF 1XEZA 2DIVA 3KG4A 3HVWA 2JLGA 4A47A 1E6VA 4AFFA 5GVQA 5ADZA 5BYSA 3OUYB 1T7PA 4JOUA 1HPZB 1U26A 1G1XA 4DV3F 2R4FA 5KFSA 5HP1A 2K3KA 2AJ1A 3M2VA 3OVBA 1RK8A 1CSJA 2PIIA 3VAKA 5EUHA 1S0OA 2ZOMA 3QJJA 2ROEA 4FN5A 4PG5A 2UXCF 2VFUA 1HBUA 4NLSA 4WFAQ 1CPZA 2F40A 2ASLA 2VPWB 2O5DA 1WEZA 3SQGA 3W2WB 2YX1A 4IR9A 3QIDA