The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
10
|
sequence length |
70
|
structure length |
70
|
Chain Sequence |
MSAVQVLKFPLSVDLAGFVGLLRRLNVPHRVSEESGQQVLWVPDERLAEQVRELYRRYPEGDPQATLEAA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Solution structure and dynamics of the N-terminal cytosolic domain of rhomboid intramembrane protease from Pseudomonas aeruginosa: insights into a functional role in intramembrane proteolysis.
pubmed doi rcsb |
molecule tags |
Hydrolase
|
source organism |
Pseudomonas aeruginosa
|
molecule keywords |
Rhomboid Intramembrane Protease
|
total genus |
10
|
structure length |
70
|
sequence length |
70
|
ec nomenclature |
ec
3.4.21.105: Rhomboid protease. |
pdb deposition date | 2006-04-20 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF16733 | NRho | Rhomboid N-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits |