2GQPA

N-domain of grp94 in complex with the novel ligand n-propyl carboxyamido adenosine
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
236
structure length
209
Chain Sequence
GSHMLREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTITSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adensine Scaffold inhibitors of GRP94
rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
molecule keywords Endoplasmin
total genus 65
structure length 209
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2gqpA00
3B28A 3SL2A 4DUHA 2CH4A 1UYMA 3O0IA 1TC0A 2IOQA 4XKOA 5IDJA 3EHJA 1I59A 1UYEA 4YKZA 2YEJA 4CWRA 2FWZA 4EM7A 2Q8GA 2BREA 1UYLA 4XD8A 3EHGA 4JAVA 4DZYA 4LWGA 3R91A 3B25A 4R3AA 4AWQA 3CRLA 3MNRP 2Q8IA 3HYYA 5D7DA 3H4LA 2BU6A 4LWHA 4E00A 2HG1A 2YKBA 2XD6A 2YI5A 3U2DA 3U67A 4XTJA 4CWNA 2YECA 3GIEA 1YS3A 4LWEA 3HZ1A 3CRKA 1I5AA 2CGFA 2C2AA 3CGZA 4K4OA 4EFTA 1S14A 3LNUA 2CG9A 4QPKA 1MX0A 2Q8HA 1S16A 4URLA 3VHCA 5GGZA 4EGKA 4MBCA 1U0ZA 5M4KA 4PU9A 3TTZA 4P7AA 4R3MA 1YC4A 1Y4UA 2WEQA 2Q2EB 1EI1A 2YEGA 1A4HA 1ZXNA 4AWOA 4CE3A 4XIPA 4ASGA 1Y8NA 4GCZA 2XDSA 5FWKA 4XIQA 2YE5A 2XX2A 2FYPA 4WUBA 2WI2A 2QFOA 3R4PA 4FCQA 4NH9A 4U7NA 4GT8A 3DGEA 4HY1A 2QF6A 3FV5A 1I5DA 1AJ6A 1Y8PA 4CWTA 1JM6A 5M4PA 4EMVA 2O1VA 2BYIA 3OPDA 3ZM7A 2ZDXA 3T10A 4BQJA 3HYZA 1ZXMA 1I5CA 3G75A 1TH8A 3T1KA 3WHAA 3VHAA 4BIUA 5CPHA 4V25A 4L91A 3ZXOA 4KSHA 1EA6A 2H55A 4HYPA 1TIDA 1YT1A 1BGQA 5BODA 3FT5A 3R4NA 3OMUA 3C0EA 5F5RA 1UYCA 1KZNA 4NH7A 2XJXA 1BKNA 3TUHA 3CGYA 3D36A 4U7OA 4L94A 4FMTA 1AM1A 2YJWA 1TILA 4ASFA 4HY6A 4GGLA 4WUDA 3VADA 3IEDA 4HZ0A 2H8MA 2VCJA 3HHUA 4I3HA 2ZDYA 3BM9A 1UY9A 1ZW9A 4UROA 1B3QA 3Q5LA 3RKZA 2BU5A 3OWDA 4XCJA 4ASBA 5IN9A 5CTUA 3K98A 3NMQA 2QG2A 4KSGA 3EHHA 2BYHA 2FWYA 2ZBKB 3T0ZA 1AH8A 2XDKA 2YE6A 1US7A 4L8ZA 4LPBA 2IWXA 3R92A 2WERA 2XX4A 4MP7A 2O1WA 4YKTA 4EFUA 2XDXA 2GFDA 3EHFA 2BU7A 4H81A 4HXZA 4HZ5A 3K97A 4MPCA 4BAEA 4NH8A 2UWDA 4O0BA 5IDMA 2YE9A 5J6AA 3K60A 3BMYA 4JQLA 5CF0A 1GKZA 2XJJA 2BZ5A 2YK2A 2YEBA 2YE7A 1GJVA 4LWFA 4O09A 3PEJA 3ZXQA 2VW5A 2XK2A 4MPNA 4MP2A 1TBWA 3EKOA 3Q5KA 1NHJA 2IWSA 3T2SA 2YEEA 2BU2A 1MU5A 1B62A 2YGAA 3B24A 2CCTA 2AKPA 5CTXA 1Z5CA 2WI6A 2XCMA 5D6QA 1BYQA 2YGEA 2VCIA 3Q5JA 2YEHA 1UYKA 5M4HA 1YC1A 4EGHA 4XKKA 2CCUA 3U2KA 1UY7A 3D2RA 3A0YA 5M4MA 2YEIA 3LPSA 2IOPA 1ZWHA 2BRCA 1PVGA 3QTFA 2WI5A 4FPPA 4R1FA 5F3KA 4WUCA 4ZVIA 4YKYA 2YE4A 4GEEA 4XIRA 5D7CA 4BIZA 3HEKA 4KTNA 5CTWA 4HYMA 4E02A 2XX5A 1YT2A 5M4NA 1YSZA 2PNRA 4YKQA 4GFNA 1YESA 3O6OA 2BT0A 4H7QA 1NHIA 1KIJA 1UYGA 2YE2A 4YKWA 2JJCA 3A0TA 4CWOA 2YEFA 1AH6A 1QY8A 3HZ5A 4QPJA 5D6PA 2WI3A 2YJXA 4P8OA 4MPEA 4FCRA 4U93A 4YKXA 2HKJA 3GIGB 4V26A 3ZKBA 4PRVA 2E0AA 2QG0A 3KE6A 4YKRA 1I58A 1H7UA 4CE2A 4CWFA 4LP0A 2YI0A 4E01A 1Z5BA 4KFGA 1Z5AA 1ID0A 4O04A 2YKEA 4JAUA 1QYEA 4AS9A 4KP4A 3ZKDA 5CTYA 2Q8FA 4BQGA 4CWQA 1Y8OA 2YEDA 4I5SA 2XHTA 2JKIA 4KQVA 4EEHA 2O1UA 2XABA 1I5BA 1UY8A 4B6CA 3R4MA 1THNA 4FCPA 4H85A 3TZ4A 4XCLA 5J71A 2YKJA 5L3JA 2ESAA 3T0HA 4CE1A 4EGIA 3O2FA 5C93A 4ZKIA 3TZ0A 1Y4SA 2BSMA 4O07A 1YC3A 4O05A 2HCHA 1OSFA 3EKRA 5M4EA 4XITA 2YI6A 3OWBA 3H80A 2BTZA 3R4OA 2YEAA 2YK9A 2XJGA 2YKIA 2YE3A 4URMA 3D0BA 2XDUA 3GIFA 1YT0A 1YETA 3G7BA 3RLQA 4CWSA 2IWUA 4L90A 2YGFA 2WI7A 3OW6A 4AWPA 1UYFA 4YKUA 2YKCA 3K99A 2YI7A 4ASAA 5FNFA 1U2OA 3G7EA 2CCSA 1UYDA 5FNCA 3GIGA 2VWCA 3CWVA 4CWPA 4BXIA 1UYHA 4MB9A 3TZ2A 1R62A 2XDLA 1B63A 3PEHA 2ZKJA 3QDDA 3RLPA 3B26A 3A0XA 4XKAA 3WQ9A 1UY6A 4HXWA 1BXDA 1TC6A 2EXLA 2FXSA 1L0OA 2K5BA 3A0WA 2IORA 3RLRA 1YERA 4PL9A 4XE2A 1H7SA 4MOTA 2XHXA 2WI1A 4PRXA 3C11A 5FNDA 5D7RA 4LWIA 2YE8A 4L93A 4XDMA 1GKXA 4XC0A 4B7PA 3A0ZA 4JASA 3JZ3A 2BU8A 4GQTA 1Z59A 3B27A 4X9LA 2GQPA 3TZ5A 4URNA 1AMWA 5BOCA 1UYIA 2WEPA 4Q20A 3FT8A 3VHDA 1YSRA 3INXA 1QZRA 1NHHA 2XHRA 2WI4A 3A0RA 4W7TA 3INWA
chains in the Genus database with same CATH superfamily
3B28A 3SL2A 4DUHA 2CH4A 1UYMA 3O0IA 1TC0A 2IOQA 4XKOA 5IDJA 3EHJA 1I59A 1UYEA 4YKZA 2YEJA 4CWRA 2FWZA 4EM7A 2Q8GA 2BREA 1UYLA 4XD8A 3EHGA 4JAVA 4DZYA 4LWGA 3R91A 3B25A 4R3AA 4AWQA 3CRLA 3MNRP 2Q8IA 3HYYA 5D7DA 3H4LA 2BU6A 4LWHA 4E00A 2HG1A 2YKBA 2XD6A 2YI5A 3U2DA 3U67A 4XTJA 4CWNA 2YECA 3GIEA 1YS3A 4LWEA 3HZ1A 3CRKA 1I5AA 2CGFA 2C2AA 3CGZA 4K4OA 4EFTA 1S14A 3LNUA 2CG9A 4QPKA 1MX0A 2Q8HA 1S16A 4URLA 3VHCA 2C1GA 5GGZA 4EGKA 4MBCA 1U0ZA 5M4KA 4PU9A 3TTZA 4P7AA 4R3MA 1YC4A 1Y4UA 2WEQA 2Q2EB 1EI1A 2YEGA 4E72A 1A4HA 1ZXNA 4AWOA 4CE3A 4XIPA 4ASGA 1Y8NA 4GCZA 2XDSA 5FWKA 4XIQA 2YE5A 2XX2A 2FYPA 4WUBA 2WI2A 2QFOA 3R4PA 4FCQA 4NH9A 4U7NA 4GT8A 3DGEA 4HY1A 2QF6A 3FV5A 1I5DA 1AJ6A 1Y8PA 4CWTA 1JM6A 5M4PA 4EMVA 2O1VA 2BYIA 3OPDA 3ZM7A 2ZDXA 3T10A 4BQJA 3HYZA 1ZXMA 1I5CA 3G75A 1TH8A 3T1KA 3WHAA 3VHAA 4BIUA 5CPHA 4V25A 4L91A 3ZXOA 4KSHA 1EA6A 2H55A 4HYPA 2HHIA 1TIDA 1YT1A 1BGQA 5BODA 3FT5A 3R4NA 3OMUA 3C0EA 5F5RA 1UYCA 1KZNA 3S5TA 4NH7A 2XJXA 1BKNA 3TUHA 3CGYA 3D36A 4U7OA 4L94A 4FMTA 1AM1A 2YJWA 1TILA 4ASFA 4HY6A 4GGLA 4WUDA 3VADA 3IEDA 4HZ0A 2H8MA 2VCJA 3HHUA 4I3HA 2ZDYA 3BM9A 1IXMA 1UY9A 1ZW9A 1B3QA 3Q5LA 4UROA 3RKZA 2BU5A 3OWDA 4XCJA 4ASBA 5IN9A 5CTUA 3K98A 3NMQA 2QG2A 4KSGA 3EHHA 2BYHA 2FWYA 2ZBKB 3T0ZA 1AH8A 1F51A 2XDKA 2YE6A 1US7A 4L8ZA 4LPBA 2IWXA 3R92A 2WERA 2XX4A 4MP7A 2O1WA 4YKTA 4EFUA 2XDXA 2GFDA 3EHFA 2BU7A 4H81A 4HXZA 4HZ5A 3K97A 4MPCA 4BAEA 4NH8A 2UWDA 4O0BA 5IDMA 2YE9A 5J6AA 3K60A 2C1IA 3BMYA 4JQLA 5CF0A 1GKZA 2XJJA 2BZ5A 2YK2A 2YEBA 2YE7A 1GJVA 4LWFA 4O09A 3PEJA 3ZXQA 2VW5A 2XK2A 4MPNA 4MP2A 1TBWA 3EKOA 3Q5KA 1NHJA 2IWSA 3T2SA 2YEEA 2BU2A 1MU5A 1B62A 2YGAA 3B24A 2CCTA 2AKPA 5CTXA 1Z5CA 2WI6A 2XCMA 5D6QA 1BYQA 2YGEA 2VCIA 3Q5JA 2YEHA 1UYKA 5M4HA 1YC1A 4EGHA 4XKKA 2CCUA 3U2KA 1UY7A 3D2RA 3A0YA 5M4MA 2YEIA 3LPSA 2IOPA 1ZWHA 2BRCA 1PVGA 3QTFA 2WI5A 4FPPA 4R1FA 5F3KA 4WUCA 4ZVIA 4YKYA 2YE4A 4GEEA 3CYGA 4XIRA 5D7CA 4BIZA 3HEKA 4KTNA 5CTWA 4HYMA 4E02A 2XX5A 1YT2A 5M4NA 1YSZA 2PNRA 4YKQA 4GFNA 1YESA 3O6OA 2BT0A 4H7QA 1NHIA 1KIJA 1UYGA 2YE2A 4YKWA 2JJCA 3A0TA 4CWOA 2YEFA 1AH6A 1QY8A 3HZ5A 4QPJA 5D6PA 2WI3A 2YJXA 4P8OA 4MPEA 4FCRA 4U93A 4YKXA 2HKJA 3GIGB 4V26A 3ZKBA 4PRVA 2E0AA 2QG0A 3KE6A 4YKRA 1I58A 1H7UA 4CE2A 4CWFA 4LP0A 2YI0A 4E01A 1Z5BA 4KFGA 1Z5AA 1ID0A 4O04A 2YKEA 4JAUA 1QYEA 4AS9A 4KP4A 3ZKDA 5CTYA 2Q8FA 4BQGA 4CWQA 1Y8OA 2YEDA 4I5SA 2XHTA 2JKIA 4KQVA 4EEHA 2O1UA 2XABA 1I5BA 1UY8A 3LMMA 4B6CA 3R4MA 1THNA 4FCPA 2FTKA 4H85A 3TZ4A 4XCLA 5J71A 2YKJA 5L3JA 2ESAA 3T0HA 4CE1A 4EGIA 3O2FA 5C93A 4ZKIA 3TZ0A 1Y4SA 2BSMA 4O07A 1YC3A 4O05A 2HCHA 1OSFA 3EKRA 5M4EA 4XITA 2YI6A 3OWBA 3H80A 2BTZA 3R4OA 2YEAA 2YK9A 2XJGA 2YKIA 2YE3A 4URMA 3D0BA 2XDUA 5JENA 3GIFA 1YT0A 1YETA 3G7BA 3RLQA 4CWSA 2IWUA 4L90A 2YGFA 2WI7A 3OW6A 4AWPA 1UYFA 4YKUA 2YKCA 3K99A 2YI7A 4ASAA 5FNFA 1U2OA 3G7EA 2CCSA 1UYDA 5FNCA 3GIGA 2VWCA 3CWVA 4CWPA 4BXIA 1UYHA 4MB9A 3TZ2A 1R62A 2XDLA 1B63A 3PEHA 2ZKJA 3QDDA 3RLPA 3B26A 3A0XA 4XKAA 3WQ9A 1UY6A 4HXWA 1BXDA 1TC6A 2EXLA 2FXSA 1L0OA 2K5BA 3A0WA 2IORA 3RLRA 1YERA 4PL9A 4XE2A 1H7SA 4MOTA 2XHXA 2WI1A 4PRXA 3C11A 5FNDA 5D7RA 4LWIA 2YE8A 4L93A 4XDMA 1GKXA 4XC0A 4B7PA 3A0ZA 4JASA 3JZ3A 2BU8A 4GQTA 1Z59A 3B27A 4X9LA 2GQPA 3TZ5A 4URNA 1AMWA 5BOCA 1UYIA 2WEPA 4Q20A 3FT8A 3VHDA 1YSRA 3INXA 1QZRA 1NHHA 2XHRA 2WI4A 3A0RA 4W7TA 3INWA
chains in the Genus database with same CATH topology
3B28A 3SL2A 4DUHA 2CH4A 1UYMA 3O0IA 1TC0A 2IOQA 4XKOA 5IDJA 3EHJA 1I59A 1UYEA 4YKZA 2YEJA 4CWRA 2FWZA 4EM7A 2Q8GA 2BREA 1UYLA 4XD8A 3EHGA 4JAVA 4DZYA 4LWGA 3R91A 3B25A 4R3AA 4AWQA 3CRLA 3MNRP 2Q8IA 3HYYA 5D7DA 3H4LA 2BU6A 4LWHA 4E00A 2HG1A 2YKBA 2XD6A 2YI5A 3U2DA 3U67A 4XTJA 4CWNA 2YECA 3GIEA 1YS3A 4LWEA 3HZ1A 3CRKA 1I5AA 2CGFA 2C2AA 3CGZA 4K4OA 4EFTA 1S14A 3LNUA 2CG9A 4QPKA 1MX0A 2Q8HA 1S16A 4URLA 3VHCA 5GGZA 4EGKA 4MBCA 1U0ZA 5M4KA 4PU9A 3TTZA 4P7AA 4R3MA 1YC4A 1Y4UA 2WEQA 2Q2EB 1EI1A 2YEGA 1A4HA 1ZXNA 4AWOA 4CE3A 4XIPA 4ASGA 1Y8NA 4GCZA 2XDSA 5FWKA 4XIQA 2YE5A 2XX2A 2FYPA 4WUBA 2WI2A 2QFOA 3R4PA 4FCQA 4NH9A 4U7NA 4GT8A 3DGEA 4HY1A 2QF6A 3FV5A 1I5DA 1AJ6A 1Y8PA 4CWTA 1JM6A 5M4PA 4EMVA 2O1VA 2BYIA 3OPDA 3ZM7A 2ZDXA 3T10A 4BQJA 3HYZA 1ZXMA 1I5CA 3G75A 1TH8A 3T1KA 3WHAA 3VHAA 4BIUA 5CPHA 4V25A 4L91A 3ZXOA 4KSHA 1EA6A 2H55A 4HYPA 1TIDA 1YT1A 1BGQA 5BODA 3FT5A 3R4NA 3OMUA 3C0EA 5F5RA 1UYCA 1KZNA 4NH7A 2XJXA 1BKNA 3TUHA 3CGYA 3D36A 4U7OA 4L94A 4FMTA 1AM1A 2YJWA 1TILA 4ASFA 4HY6A 4GGLA 4WUDA 3VADA 3IEDA 4HZ0A 2H8MA 2VCJA 3HHUA 4I3HA 2ZDYA 3BM9A 1UY9A 1ZW9A 4UROA 1B3QA 3Q5LA 3RKZA 2BU5A 3OWDA 4XCJA 4ASBA 5IN9A 5CTUA 3K98A 3NMQA 2QG2A 4KSGA 3EHHA 2BYHA 2FWYA 2ZBKB 3T0ZA 1AH8A 2XDKA 2YE6A 1US7A 4L8ZA 4LPBA 2IWXA 3R92A 2WERA 2XX4A 4MP7A 2O1WA 4YKTA 4EFUA 2XDXA 2GFDA 3EHFA 2BU7A 4H81A 4HXZA 4HZ5A 3K97A 4MPCA 4BAEA 4NH8A 2UWDA 4O0BA 5IDMA 2YE9A 5J6AA 3K60A 3BMYA 4JQLA 5CF0A 1GKZA 2XJJA 2BZ5A 2YK2A 2YEBA 2YE7A 1GJVA 4LWFA 4O09A 3PEJA 3ZXQA 2VW5A 2XK2A 4MPNA 4MP2A 1TBWA 3EKOA 3Q5KA 1NHJA 2IWSA 3T2SA 2YEEA 2BU2A 1MU5A 1B62A 2YGAA 3B24A 2CCTA 2AKPA 5CTXA 1Z5CA 2WI6A 2XCMA 5D6QA 1BYQA 2YGEA 2VCIA 3Q5JA 2YEHA 1UYKA 5M4HA 1YC1A 4EGHA 4XKKA 2CCUA 3U2KA 1UY7A 3D2RA 3A0YA 5M4MA 2YEIA 3LPSA 2IOPA 1ZWHA 2BRCA 1PVGA 3QTFA 2WI5A 4FPPA 4R1FA 5F3KA 4WUCA 4ZVIA 4YKYA 2YE4A 4GEEA 4XIRA 5D7CA 4BIZA 3HEKA 4KTNA 5CTWA 4HYMA 4E02A 2XX5A 1YT2A 5M4NA 1YSZA 2PNRA 4YKQA 4GFNA 1YESA 3O6OA 2BT0A 4H7QA 1NHIA 1KIJA 1UYGA 2YE2A 4YKWA 2JJCA 3A0TA 4CWOA 2YEFA 1AH6A 1QY8A 3HZ5A 4QPJA 5D6PA 2WI3A 2YJXA 4P8OA 4MPEA 4FCRA 4U93A 4YKXA 2HKJA 3GIGB 4V26A 3ZKBA 4PRVA 2E0AA 2QG0A 3KE6A 4YKRA 1I58A 1H7UA 4CE2A 4CWFA 4LP0A 2YI0A 4E01A 1Z5BA 4KFGA 1Z5AA 1ID0A 4O04A 2YKEA 4JAUA 1QYEA 4AS9A 4KP4A 3ZKDA 5CTYA 2Q8FA 4BQGA 4CWQA 1Y8OA 2YEDA 4I5SA 2XHTA 2JKIA 4KQVA 4EEHA 2O1UA 2XABA 1I5BA 1UY8A 4B6CA 3R4MA 1THNA 4FCPA 4H85A 3TZ4A 4XCLA 5J71A 2YKJA 5L3JA 2ESAA 3T0HA 4CE1A 4EGIA 3O2FA 5C93A 4ZKIA 3TZ0A 1Y4SA 2BSMA 4O07A 1YC3A 4O05A 2HCHA 1OSFA 3EKRA 5M4EA 4XITA 2YI6A 3OWBA 3H80A 2BTZA 3R4OA 2YEAA 2YK9A 2XJGA 2YKIA 2YE3A 4URMA 3D0BA 2XDUA 3GIFA 1YT0A 1YETA 3G7BA 3RLQA 4CWSA 2IWUA 4L90A 2YGFA 2WI7A 3OW6A 4AWPA 1UYFA 4YKUA 2YKCA 3K99A 2YI7A 4ASAA 5FNFA 1U2OA 3G7EA 2CCSA 1UYDA 5FNCA 3GIGA 2VWCA 3CWVA 4CWPA 4BXIA 1UYHA 4MB9A 3TZ2A 1R62A 2XDLA 1B63A 3PEHA 2ZKJA 3QDDA 3RLPA 3B26A 3A0XA 4XKAA 3WQ9A 1UY6A 4HXWA 1BXDA 1TC6A 2EXLA 2FXSA 1L0OA 2K5BA 3A0WA 2IORA 3RLRA 1YERA 4PL9A 4XE2A 1H7SA 4MOTA 2XHXA 2WI1A 4PRXA 3C11A 5FNDA 5D7RA 4LWIA 2YE8A 4L93A 4XDMA 1GKXA 4XC0A 4B7PA 3A0ZA 4JASA 3JZ3A 2BU8A 4GQTA 1Z59A 3B27A 4X9LA 2GQPA 3TZ5A 4URNA 1AMWA 5BOCA 1UYIA 2WEPA 4Q20A 3FT8A 3VHDA 1YSRA 3INXA 1QZRA 1NHHA 2XHRA 2WI4A 3A0RA 4W7TA 3INWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B28 A;  3SL2 A;  4DUH A;  2CH4 A;  1UYM A;  3O0I A;  1TC0 A;  2IOQ A;  4XKO A;  5IDJ A;  3EHJ A;  1I59 A;  1UYE A;  4YKZ A;  2YEJ A;  4CWR A;  2FWZ A;  4EM7 A;  2Q8G A;  2BRE A;  1UYL A;  4XD8 A;  3EHG A;  4JAV A;  4DZY A;  4LWG A;  3R91 A;  3B25 A;  4R3A A;  4AWQ A;  3CRL A;  3MNR P;  2Q8I A;  3HYY A;  5D7D A;  3H4L A;  2BU6 A;  4LWH A;  4E00 A;  2HG1 A;  2YKB A;  2XD6 A;  2YI5 A;  3U2D A;  3U67 A;  4XTJ A;  4CWN A;  2YEC A;  3GIE A;  1YS3 A;  4LWE A;  3HZ1 A;  3CRK A;  1I5A A;  2CGF A;  2C2A A;  3CGZ A;  4K4O A;  4EFT A;  1S14 A;  3LNU A;  2CG9 A;  4QPK A;  1MX0 A;  2Q8H A;  1S16 A;  4URL A;  3VHC A;  5GGZ A;  4EGK A;  4MBC A;  1U0Z A;  5M4K A;  4PU9 A;  3TTZ A;  4P7A A;  4R3M A;  1YC4 A;  1Y4U A;  2WEQ A;  2Q2E B;  1EI1 A;  2YEG A;  1A4H A;  1ZXN A;  4AWO A;  4CE3 A;  4XIP A;  4ASG A;  1Y8N A;  4GCZ A;  2XDS A;  5FWK A;  4XIQ A;  2YE5 A;  2XX2 A;  2FYP A;  4WUB A;  2WI2 A;  2QFO A;  3R4P A;  4FCQ A;  4NH9 A;  4U7N A;  4GT8 A;  3DGE A;  4HY1 A;  2QF6 A;  3FV5 A;  1I5D A;  1AJ6 A;  1Y8P A;  4CWT A;  1JM6 A;  5M4P A;  4EMV A;  2O1V A;  2BYI A;  3OPD A;  3ZM7 A;  2ZDX A;  3T10 A;  4BQJ A;  3HYZ A;  1ZXM A;  1I5C A;  3G75 A;  1TH8 A;  3T1K A;  3WHA A;  3VHA A;  4BIU A;  5CPH A;  4V25 A;  4L91 A;  3ZXO A;  4KSH A;  1EA6 A;  2H55 A;  4HYP A;  1TID A;  1YT1 A;  1BGQ A;  5BOD A;  3FT5 A;  3R4N A;  3OMU A;  3C0E A;  5F5R A;  1UYC A;  1KZN A;  4NH7 A;  2XJX A;  1BKN A;  3TUH A;  3CGY A;  3D36 A;  4U7O A;  4L94 A;  4FMT A;  1AM1 A;  2YJW A;  1TIL A;  4ASF A;  4HY6 A;  4GGL A;  4WUD A;  3VAD A;  3IED A;  4HZ0 A;  2H8M A;  2VCJ A;  3HHU A;  4I3H A;  2ZDY A;  3BM9 A;  1UY9 A;  1ZW9 A;  4URO A;  1B3Q A;  3Q5L A;  3RKZ A;  2BU5 A;  3OWD A;  4XCJ A;  4ASB A;  5IN9 A;  5CTU A;  3K98 A;  3NMQ A;  2QG2 A;  4KSG A;  3EHH A;  2BYH A;  2FWY A;  2ZBK B;  3T0Z A;  1AH8 A;  2XDK A;  2YE6 A;  1US7 A;  4L8Z A;  4LPB A;  2IWX A;  3R92 A;  2WER A;  2XX4 A;  4MP7 A;  2O1W A;  4YKT A;  4EFU A;  2XDX A;  2GFD A;  3EHF A;  2BU7 A;  4H81 A;  4HXZ A;  4HZ5 A;  3K97 A;  4MPC A;  4BAE A;  4NH8 A;  2UWD A;  4O0B A;  5IDM A;  2YE9 A;  5J6A A;  3K60 A;  3BMY A;  4JQL A;  5CF0 A;  1GKZ A;  2XJJ A;  2BZ5 A;  2YK2 A;  2YEB A;  2YE7 A;  1GJV A;  4LWF A;  4O09 A;  3PEJ A;  3ZXQ A;  2VW5 A;  2XK2 A;  4MPN A;  4MP2 A;  1TBW A;  3EKO A;  3Q5K A;  1NHJ A;  2IWS A;  3T2S A;  2YEE A;  2BU2 A;  1MU5 A;  1B62 A;  2YGA A;  3B24 A;  2CCT A;  2AKP A;  5CTX A;  1Z5C A;  2WI6 A;  2XCM A;  5D6Q A;  1BYQ A;  2YGE A;  2VCI A;  3Q5J A;  2YEH A;  1UYK A;  5M4H A;  1YC1 A;  4EGH A;  4XKK A;  2CCU A;  3U2K A;  1UY7 A;  3D2R A;  3A0Y A;  5M4M A;  2YEI A;  3LPS A;  2IOP A;  1ZWH A;  2BRC A;  1PVG A;  3QTF A;  2WI5 A;  4FPP A;  4R1F A;  5F3K A;  4WUC A;  4ZVI A;  4YKY A;  2YE4 A;  4GEE A;  4XIR A;  5D7C A;  4BIZ A;  3HEK A;  4KTN A;  5CTW A;  4HYM A;  4E02 A;  2XX5 A;  1YT2 A;  5M4N A;  1YSZ A;  2PNR A;  4YKQ A;  4GFN A;  1YES A;  3O6O A;  2BT0 A;  4H7Q A;  1NHI A;  1KIJ A;  1UYG A;  2YE2 A;  4YKW A;  2JJC A;  3A0T A;  4CWO A;  2YEF A;  1AH6 A;  1QY8 A;  3HZ5 A;  4QPJ A;  5D6P A;  2WI3 A;  2YJX A;  4P8O A;  4MPE A;  4FCR A;  4U93 A;  4YKX A;  2HKJ A;  3GIG B;  4V26 A;  3ZKB A;  4PRV A;  2E0A A;  2QG0 A;  3KE6 A;  4YKR A;  1I58 A;  1H7U A;  4CE2 A;  4CWF A;  4LP0 A;  2YI0 A;  4E01 A;  1Z5B A;  4KFG A;  1Z5A A;  1ID0 A;  4O04 A;  2YKE A;  4JAU A;  1QYE A;  4AS9 A;  4KP4 A;  3ZKD A;  5CTY A;  2Q8F A;  4BQG A;  4CWQ A;  1Y8O A;  2YED A;  4I5S A;  2XHT A;  2JKI A;  4KQV A;  4EEH A;  2O1U A;  2XAB A;  1I5B A;  1UY8 A;  4B6C A;  3R4M A;  1THN A;  4FCP A;  4H85 A;  3TZ4 A;  4XCL A;  5J71 A;  2YKJ A;  5L3J A;  2ESA A;  3T0H A;  4CE1 A;  4EGI A;  3O2F A;  5C93 A;  4ZKI A;  3TZ0 A;  1Y4S A;  2BSM A;  4O07 A;  1YC3 A;  4O05 A;  2HCH A;  1OSF A;  3EKR A;  5M4E A;  4XIT A;  2YI6 A;  3OWB A;  3H80 A;  2BTZ A;  3R4O A;  2YEA A;  2YK9 A;  2XJG A;  2YKI A;  2YE3 A;  4URM A;  3D0B A;  2XDU A;  3GIF A;  1YT0 A;  1YET A;  3G7B A;  3RLQ A;  4CWS A;  2IWU A;  4L90 A;  2YGF A;  2WI7 A;  3OW6 A;  4AWP A;  1UYF A;  4YKU A;  2YKC A;  3K99 A;  2YI7 A;  4ASA A;  5FNF A;  1U2O A;  3G7E A;  2CCS A;  1UYD A;  5FNC A;  3GIG A;  2VWC A;  3CWV A;  4CWP A;  4BXI A;  1UYH A;  4MB9 A;  3TZ2 A;  1R62 A;  2XDL A;  1B63 A;  3PEH A;  2ZKJ A;  3QDD A;  3RLP A;  3B26 A;  3A0X A;  4XKA A;  3WQ9 A;  1UY6 A;  4HXW A;  1BXD A;  1TC6 A;  2EXL A;  2FXS A;  1L0O A;  2K5B A;  3A0W A;  2IOR A;  3RLR A;  1YER A;  4PL9 A;  4XE2 A;  1H7S A;  4MOT A;  2XHX A;  2WI1 A;  4PRX A;  3C11 A;  5FND A;  5D7R A;  4LWI A;  2YE8 A;  4L93 A;  4XDM A;  1GKX A;  4XC0 A;  4B7P A;  3A0Z A;  4JAS A;  3JZ3 A;  2BU8 A;  4GQT A;  1Z59 A;  3B27 A;  4X9L A;  2GQP A;  3TZ5 A;  4URN A;  1AMW A;  5BOC A;  1UYI A;  2WEP A;  4Q20 A;  3FT8 A;  3VHD A;  1YSR A;  3INX A;  1QZR A;  1NHH A;  2XHR A;  2WI4 A;  3A0R A;  4W7T A;  3INW A; 
#chains in the Genus database with same CATH topology
 3B28 A;  3SL2 A;  4DUH A;  2CH4 A;  1UYM A;  3O0I A;  1TC0 A;  2IOQ A;  4XKO A;  5IDJ A;  3EHJ A;  1I59 A;  1UYE A;  4YKZ A;  2YEJ A;  4CWR A;  2FWZ A;  4EM7 A;  2Q8G A;  2BRE A;  1UYL A;  4XD8 A;  3EHG A;  4JAV A;  4DZY A;  4LWG A;  3R91 A;  3B25 A;  4R3A A;  4AWQ A;  3CRL A;  3MNR P;  2Q8I A;  3HYY A;  5D7D A;  3H4L A;  2BU6 A;  4LWH A;  4E00 A;  2HG1 A;  2YKB A;  2XD6 A;  2YI5 A;  3U2D A;  3U67 A;  4XTJ A;  4CWN A;  2YEC A;  3GIE A;  1YS3 A;  4LWE A;  3HZ1 A;  3CRK A;  1I5A A;  2CGF A;  2C2A A;  3CGZ A;  4K4O A;  4EFT A;  1S14 A;  3LNU A;  2CG9 A;  4QPK A;  1MX0 A;  2Q8H A;  1S16 A;  4URL A;  3VHC A;  2C1G A;  5GGZ A;  4EGK A;  4MBC A;  1U0Z A;  5M4K A;  4PU9 A;  3TTZ A;  4P7A A;  4R3M A;  1YC4 A;  1Y4U A;  2WEQ A;  2Q2E B;  1EI1 A;  2YEG A;  4E72 A;  1A4H A;  1ZXN A;  4AWO A;  4CE3 A;  4XIP A;  4ASG A;  1Y8N A;  4GCZ A;  2XDS A;  5FWK A;  4XIQ A;  2YE5 A;  2XX2 A;  2FYP A;  4WUB A;  2WI2 A;  2QFO A;  3R4P A;  4FCQ A;  4NH9 A;  4U7N A;  4GT8 A;  3DGE A;  4HY1 A;  2QF6 A;  3FV5 A;  1I5D A;  1AJ6 A;  1Y8P A;  4CWT A;  1JM6 A;  5M4P A;  4EMV A;  2O1V A;  2BYI A;  3OPD A;  3ZM7 A;  2ZDX A;  3T10 A;  4BQJ A;  3HYZ A;  1ZXM A;  1I5C A;  3G75 A;  1TH8 A;  3T1K A;  3WHA A;  3VHA A;  4BIU A;  5CPH A;  4V25 A;  4L91 A;  3ZXO A;  4KSH A;  1EA6 A;  2H55 A;  4HYP A;  2HHI A;  1TID A;  1YT1 A;  1BGQ A;  5BOD A;  3FT5 A;  3R4N A;  3OMU A;  3C0E A;  5F5R A;  1UYC A;  1KZN A;  3S5T A;  4NH7 A;  2XJX A;  1BKN A;  3TUH A;  3CGY A;  3D36 A;  4U7O A;  4L94 A;  4FMT A;  1AM1 A;  2YJW A;  1TIL A;  4ASF A;  4HY6 A;  4GGL A;  4WUD A;  3VAD A;  3IED A;  4HZ0 A;  2H8M A;  2VCJ A;  3HHU A;  4I3H A;  2ZDY A;  3BM9 A;  1IXM A;  1UY9 A;  1ZW9 A;  1B3Q A;  3Q5L A;  4URO A;  3RKZ A;  2BU5 A;  3OWD A;  4XCJ A;  4ASB A;  5IN9 A;  5CTU A;  3K98 A;  3NMQ A;  2QG2 A;  4KSG A;  3EHH A;  2BYH A;  2FWY A;  2ZBK B;  3T0Z A;  1AH8 A;  1F51 A;  2XDK A;  2YE6 A;  1US7 A;  4L8Z A;  4LPB A;  2IWX A;  3R92 A;  2WER A;  2XX4 A;  4MP7 A;  2O1W A;  4YKT A;  4EFU A;  2XDX A;  2GFD A;  3EHF A;  2BU7 A;  4H81 A;  4HXZ A;  4HZ5 A;  3K97 A;  4MPC A;  4BAE A;  4NH8 A;  2UWD A;  4O0B A;  5IDM A;  2YE9 A;  5J6A A;  3K60 A;  2C1I A;  3BMY A;  4JQL A;  5CF0 A;  1GKZ A;  2XJJ A;  2BZ5 A;  2YK2 A;  2YEB A;  2YE7 A;  1GJV A;  4LWF A;  4O09 A;  3PEJ A;  3ZXQ A;  2VW5 A;  2XK2 A;  4MPN A;  4MP2 A;  1TBW A;  3EKO A;  3Q5K A;  1NHJ A;  2IWS A;  3T2S A;  2YEE A;  2BU2 A;  1MU5 A;  1B62 A;  2YGA A;  3B24 A;  2CCT A;  2AKP A;  5CTX A;  1Z5C A;  2WI6 A;  2XCM A;  5D6Q A;  1BYQ A;  2YGE A;  2VCI A;  3Q5J A;  2YEH A;  1UYK A;  5M4H A;  1YC1 A;  4EGH A;  4XKK A;  2CCU A;  3U2K A;  1UY7 A;  3D2R A;  3A0Y A;  5M4M A;  2YEI A;  3LPS A;  2IOP A;  1ZWH A;  2BRC A;  1PVG A;  3QTF A;  2WI5 A;  4FPP A;  4R1F A;  5F3K A;  4WUC A;  4ZVI A;  4YKY A;  2YE4 A;  4GEE A;  3CYG A;  4XIR A;  5D7C A;  4BIZ A;  3HEK A;  4KTN A;  5CTW A;  4HYM A;  4E02 A;  2XX5 A;  1YT2 A;  5M4N A;  1YSZ A;  2PNR A;  4YKQ A;  4GFN A;  1YES A;  3O6O A;  2BT0 A;  4H7Q A;  1NHI A;  1KIJ A;  1UYG A;  2YE2 A;  4YKW A;  2JJC A;  3A0T A;  4CWO A;  2YEF A;  1AH6 A;  1QY8 A;  3HZ5 A;  4QPJ A;  5D6P A;  2WI3 A;  2YJX A;  4P8O A;  4MPE A;  4FCR A;  4U93 A;  4YKX A;  2HKJ A;  3GIG B;  4V26 A;  3ZKB A;  4PRV A;  2E0A A;  2QG0 A;  3KE6 A;  4YKR A;  1I58 A;  1H7U A;  4CE2 A;  4CWF A;  4LP0 A;  2YI0 A;  4E01 A;  1Z5B A;  4KFG A;  1Z5A A;  1ID0 A;  4O04 A;  2YKE A;  4JAU A;  1QYE A;  4AS9 A;  4KP4 A;  3ZKD A;  5CTY A;  2Q8F A;  4BQG A;  4CWQ A;  1Y8O A;  2YED A;  4I5S A;  2XHT A;  2JKI A;  4KQV A;  4EEH A;  2O1U A;  2XAB A;  1I5B A;  1UY8 A;  3LMM A;  4B6C A;  3R4M A;  1THN A;  4FCP A;  2FTK A;  4H85 A;  3TZ4 A;  4XCL A;  5J71 A;  2YKJ A;  5L3J A;  2ESA A;  3T0H A;  4CE1 A;  4EGI A;  3O2F A;  5C93 A;  4ZKI A;  3TZ0 A;  1Y4S A;  2BSM A;  4O07 A;  1YC3 A;  4O05 A;  2HCH A;  1OSF A;  3EKR A;  5M4E A;  4XIT A;  2YI6 A;  3OWB A;  3H80 A;  2BTZ A;  3R4O A;  2YEA A;  2YK9 A;  2XJG A;  2YKI A;  2YE3 A;  4URM A;  3D0B A;  2XDU A;  5JEN A;  3GIF A;  1YT0 A;  1YET A;  3G7B A;  3RLQ A;  4CWS A;  2IWU A;  4L90 A;  2YGF A;  2WI7 A;  3OW6 A;  4AWP A;  1UYF A;  4YKU A;  2YKC A;  3K99 A;  2YI7 A;  4ASA A;  5FNF A;  1U2O A;  3G7E A;  2CCS A;  1UYD A;  5FNC A;  3GIG A;  2VWC A;  3CWV A;  4CWP A;  4BXI A;  1UYH A;  4MB9 A;  3TZ2 A;  1R62 A;  2XDL A;  1B63 A;  3PEH A;  2ZKJ A;  3QDD A;  3RLP A;  3B26 A;  3A0X A;  4XKA A;  3WQ9 A;  1UY6 A;  4HXW A;  1BXD A;  1TC6 A;  2EXL A;  2FXS A;  1L0O A;  2K5B A;  3A0W A;  2IOR A;  3RLR A;  1YER A;  4PL9 A;  4XE2 A;  1H7S A;  4MOT A;  2XHX A;  2WI1 A;  4PRX A;  3C11 A;  5FND A;  5D7R A;  4LWI A;  2YE8 A;  4L93 A;  4XDM A;  1GKX A;  4XC0 A;  4B7P A;  3A0Z A;  4JAS A;  3JZ3 A;  2BU8 A;  4GQT A;  1Z59 A;  3B27 A;  4X9L A;  2GQP A;  3TZ5 A;  4URN A;  1AMW A;  5BOC A;  1UYI A;  2WEP A;  4Q20 A;  3FT8 A;  3VHD A;  1YSR A;  3INX A;  1QZR A;  1NHH A;  2XHR A;  2WI4 A;  3A0R A;  4W7T A;  3INW A; 
#chains in the Genus database with same CATH homology
 3B28 A;  3SL2 A;  4DUH A;  2CH4 A;  1UYM A;  3O0I A;  1TC0 A;  2IOQ A;  4XKO A;  5IDJ A;  3EHJ A;  1I59 A;  1UYE A;  4YKZ A;  2YEJ A;  4CWR A;  2FWZ A;  4EM7 A;  2Q8G A;  2BRE A;  1UYL A;  4XD8 A;  3EHG A;  4JAV A;  4DZY A;  4LWG A;  3R91 A;  3B25 A;  4R3A A;  4AWQ A;  3CRL A;  3MNR P;  2Q8I A;  3HYY A;  5D7D A;  3H4L A;  2BU6 A;  4LWH A;  4E00 A;  2HG1 A;  2YKB A;  2XD6 A;  2YI5 A;  3U2D A;  3U67 A;  4XTJ A;  4CWN A;  2YEC A;  3GIE A;  1YS3 A;  4LWE A;  3HZ1 A;  3CRK A;  1I5A A;  2CGF A;  2C2A A;  3CGZ A;  4K4O A;  4EFT A;  1S14 A;  3LNU A;  2CG9 A;  4QPK A;  1MX0 A;  2Q8H A;  1S16 A;  4URL A;  3VHC A;  5GGZ A;  4EGK A;  4MBC A;  1U0Z A;  5M4K A;  4PU9 A;  3TTZ A;  4P7A A;  4R3M A;  1YC4 A;  1Y4U A;  2WEQ A;  2Q2E B;  1EI1 A;  2YEG A;  1A4H A;  1ZXN A;  4AWO A;  4CE3 A;  4XIP A;  4ASG A;  1Y8N A;  4GCZ A;  2XDS A;  5FWK A;  4XIQ A;  2YE5 A;  2XX2 A;  2FYP A;  4WUB A;  2WI2 A;  2QFO A;  3R4P A;  4FCQ A;  4NH9 A;  4U7N A;  4GT8 A;  3DGE A;  4HY1 A;  2QF6 A;  3FV5 A;  1I5D A;  1AJ6 A;  1Y8P A;  4CWT A;  1JM6 A;  5M4P A;  4EMV A;  2O1V A;  2BYI A;  3OPD A;  3ZM7 A;  2ZDX A;  3T10 A;  4BQJ A;  3HYZ A;  1ZXM A;  1I5C A;  3G75 A;  1TH8 A;  3T1K A;  3WHA A;  3VHA A;  4BIU A;  5CPH A;  4V25 A;  4L91 A;  3ZXO A;  4KSH A;  1EA6 A;  2H55 A;  4HYP A;  1TID A;  1YT1 A;  1BGQ A;  5BOD A;  3FT5 A;  3R4N A;  3OMU A;  3C0E A;  5F5R A;  1UYC A;  1KZN A;  4NH7 A;  2XJX A;  1BKN A;  3TUH A;  3CGY A;  3D36 A;  4U7O A;  4L94 A;  4FMT A;  1AM1 A;  2YJW A;  1TIL A;  4ASF A;  4HY6 A;  4GGL A;  4WUD A;  3VAD A;  3IED A;  4HZ0 A;  2H8M A;  2VCJ A;  3HHU A;  4I3H A;  2ZDY A;  3BM9 A;  1UY9 A;  1ZW9 A;  4URO A;  1B3Q A;  3Q5L A;  3RKZ A;  2BU5 A;  3OWD A;  4XCJ A;  4ASB A;  5IN9 A;  5CTU A;  3K98 A;  3NMQ A;  2QG2 A;  4KSG A;  3EHH A;  2BYH A;  2FWY A;  2ZBK B;  3T0Z A;  1AH8 A;  2XDK A;  2YE6 A;  1US7 A;  4L8Z A;  4LPB A;  2IWX A;  3R92 A;  2WER A;  2XX4 A;  4MP7 A;  2O1W A;  4YKT A;  4EFU A;  2XDX A;  2GFD A;  3EHF A;  2BU7 A;  4H81 A;  4HXZ A;  4HZ5 A;  3K97 A;  4MPC A;  4BAE A;  4NH8 A;  2UWD A;  4O0B A;  5IDM A;  2YE9 A;  5J6A A;  3K60 A;  3BMY A;  4JQL A;  5CF0 A;  1GKZ A;  2XJJ A;  2BZ5 A;  2YK2 A;  2YEB A;  2YE7 A;  1GJV A;  4LWF A;  4O09 A;  3PEJ A;  3ZXQ A;  2VW5 A;  2XK2 A;  4MPN A;  4MP2 A;  1TBW A;  3EKO A;  3Q5K A;  1NHJ A;  2IWS A;  3T2S A;  2YEE A;  2BU2 A;  1MU5 A;  1B62 A;  2YGA A;  3B24 A;  2CCT A;  2AKP A;  5CTX A;  1Z5C A;  2WI6 A;  2XCM A;  5D6Q A;  1BYQ A;  2YGE A;  2VCI A;  3Q5J A;  2YEH A;  1UYK A;  5M4H A;  1YC1 A;  4EGH A;  4XKK A;  2CCU A;  3U2K A;  1UY7 A;  3D2R A;  3A0Y A;  5M4M A;  2YEI A;  3LPS A;  2IOP A;  1ZWH A;  2BRC A;  1PVG A;  3QTF A;  2WI5 A;  4FPP A;  4R1F A;  5F3K A;  4WUC A;  4ZVI A;  4YKY A;  2YE4 A;  4GEE A;  4XIR A;  5D7C A;  4BIZ A;  3HEK A;  4KTN A;  5CTW A;  4HYM A;  4E02 A;  2XX5 A;  1YT2 A;  5M4N A;  1YSZ A;  2PNR A;  4YKQ A;  4GFN A;  1YES A;  3O6O A;  2BT0 A;  4H7Q A;  1NHI A;  1KIJ A;  1UYG A;  2YE2 A;  4YKW A;  2JJC A;  3A0T A;  4CWO A;  2YEF A;  1AH6 A;  1QY8 A;  3HZ5 A;  4QPJ A;  5D6P A;  2WI3 A;  2YJX A;  4P8O A;  4MPE A;  4FCR A;  4U93 A;  4YKX A;  2HKJ A;  3GIG B;  4V26 A;  3ZKB A;  4PRV A;  2E0A A;  2QG0 A;  3KE6 A;  4YKR A;  1I58 A;  1H7U A;  4CE2 A;  4CWF A;  4LP0 A;  2YI0 A;  4E01 A;  1Z5B A;  4KFG A;  1Z5A A;  1ID0 A;  4O04 A;  2YKE A;  4JAU A;  1QYE A;  4AS9 A;  4KP4 A;  3ZKD A;  5CTY A;  2Q8F A;  4BQG A;  4CWQ A;  1Y8O A;  2YED A;  4I5S A;  2XHT A;  2JKI A;  4KQV A;  4EEH A;  2O1U A;  2XAB A;  1I5B A;  1UY8 A;  4B6C A;  3R4M A;  1THN A;  4FCP A;  4H85 A;  3TZ4 A;  4XCL A;  5J71 A;  2YKJ A;  5L3J A;  2ESA A;  3T0H A;  4CE1 A;  4EGI A;  3O2F A;  5C93 A;  4ZKI A;  3TZ0 A;  1Y4S A;  2BSM A;  4O07 A;  1YC3 A;  4O05 A;  2HCH A;  1OSF A;  3EKR A;  5M4E A;  4XIT A;  2YI6 A;  3OWB A;  3H80 A;  2BTZ A;  3R4O A;  2YEA A;  2YK9 A;  2XJG A;  2YKI A;  2YE3 A;  4URM A;  3D0B A;  2XDU A;  3GIF A;  1YT0 A;  1YET A;  3G7B A;  3RLQ A;  4CWS A;  2IWU A;  4L90 A;  2YGF A;  2WI7 A;  3OW6 A;  4AWP A;  1UYF A;  4YKU A;  2YKC A;  3K99 A;  2YI7 A;  4ASA A;  5FNF A;  1U2O A;  3G7E A;  2CCS A;  1UYD A;  5FNC A;  3GIG A;  2VWC A;  3CWV A;  4CWP A;  4BXI A;  1UYH A;  4MB9 A;  3TZ2 A;  1R62 A;  2XDL A;  1B63 A;  3PEH A;  2ZKJ A;  3QDD A;  3RLP A;  3B26 A;  3A0X A;  4XKA A;  3WQ9 A;  1UY6 A;  4HXW A;  1BXD A;  1TC6 A;  2EXL A;  2FXS A;  1L0O A;  2K5B A;  3A0W A;  2IOR A;  3RLR A;  1YER A;  4PL9 A;  4XE2 A;  1H7S A;  4MOT A;  2XHX A;  2WI1 A;  4PRX A;  3C11 A;  5FND A;  5D7R A;  4LWI A;  2YE8 A;  4L93 A;  4XDM A;  1GKX A;  4XC0 A;  4B7P A;  3A0Z A;  4JAS A;  3JZ3 A;  2BU8 A;  4GQT A;  1Z59 A;  3B27 A;  4X9L A;  2GQP A;  3TZ5 A;  4URN A;  1AMW A;  5BOC A;  1UYI A;  2WEP A;  4Q20 A;  3FT8 A;  3VHD A;  1YSR A;  3INX A;  1QZR A;  1NHH A;  2XHR A;  2WI4 A;  3A0R A;  4W7T A;  3INW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...