2GQPA

N-domain of grp94 in complex with the novel ligand n-propyl carboxyamido adenosine
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
236
structure length
209
Chain Sequence
GSHMLREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTITSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin
publication title Adensine Scaffold inhibitors of GRP94
rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
total genus 65
structure length 209
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2gqpA00
1Z5AA 3R92A 4WUCA 2YE7A 2HG1A 5C93A 3Q5LA 2YE2A 4URMA 4EFUA 2YEHA 4YKWA 2BRCA 2EXLA 4XDMA 2YEDA 4CE1A 2YE4A 1BGQA 3BMYA 4AWQA 4MP7A 3VHDA 4CWNA 3T1KA 1TBWA 4XD8A 2IWSA 4O0BA 5FNDA 3T2SA 4P7AA 1S16A 3NMQA 2BYHA 4EM7A 3OWBA 5CF0A 3K60A 4KSGA 5M4PA 2XX4A 1TIDA 1Y4UA 2VCIA 4HY1A 2XDXA 5GGZA 5CTYA 1I5BA 2CG9A 4EEHA 3R4MA 3PEJA 4EGIA 5D7RA 5M4KA 2CH4A 3G7BA 3GIGA 4YKRA 3FT5A 4H7QA 4I3HA 4LWGA 1UY9A 2QG2A 2FXSA 3K98A 2YKCA 3U2DA 3FV5A 4E02A 1YT2A 4BAEA 2CCSA 2YE5A 2XABA 4CE3A 1ZXMA 4AS9A 1U2OA 3B28A 4CWSA 4O05A 1NHIA 2WI5A 3HZ5A 2ZDXA 3OW6A 4GCZA 4XE2A 3A0YA 1UYCA 3GIEA 1MU5A 4XIQA 3R4PA 3INXA 4KTNA 4PL9A 2BU5A 2GFDA 4R3MA 2O1VA 1EI1A 1QY8A 1UYHA 3TZ0A 4KFGA 4LPBA 2WEQA 5M4NA 4JAUA 1MX0A 1QYEA 1Z5CA 2YJXA 1PVGA 2YE3A 4FCPA 3LNUA 3K97A 1TC0A 1TILA 5F5RA 4JASA 3VHCA 5BODA 3D36A 2QF6A 4U7OA 3VADA 5IDMA 3ZKDA 1H7UA 2XJJA 1AH8A 4CWFA 3EHJA 5BOCA 4YKXA 2XHXA 4BQGA 4GQTA 2BU7A 1L0OA 4XCJA 1THNA 4WUBA 1JM6A 1B3QA 4O07A 3OWDA 4ASFA 1I5DA 4HXZA 4V25A 2FYPA 4XKKA 2YEIA 3O0IA 4BIUA 2E0AA 3HZ1A 1AMWA 4HYMA 2XDLA 4YKYA 4P8OA 1YESA 5CPHA 3A0TA 2QFOA 4XIRA 3EHGA 2WEPA 1UYFA 4XTJA 1H7SA 2YJWA 5D6PA 4MBCA 2O1UA 5FNCA 2UWDA 4XITA 2WI7A 4GGLA 3A0WA 2WI1A 5D7DA 1TC6A 4U93A 1UY8A 2BZ5A 4L94A 2YEBA 2YI5A 4UROA 2H8MA 2ZKJA 4HXWA 2BT0A 3O6OA 4KQVA 3G7EA 2WI6A 4B7PA 4CWRA 2WI4A 4B6CA 3TZ2A 1YETA 1AJ6A 2YI7A 2YKJA 4KP4A 3T0HA 2Q8GA 1UYLA 5J6AA 3G75A 4AWOA 4XKAA 3HEKA 2XX5A 5IN9A 3TTZA 4XCLA 3GIGB 1NHHA 2ZBKB 2WI3A 3U67A 4NH9A 4GFNA 5CTUA 1UYEA 4YKQA 2QG0A 3QDDA 4FCQA 2YK9A 3KE6A 2YKEA 3A0ZA 3VHAA 3R4NA 3K99A 2XD6A 2BU8A 1Y8PA 2HCHA 1UY6A 3TZ4A 3D0BA 3EHFA 2ESAA 2YE9A 2BTZA 5D6QA 3Q5JA 2YGEA 2VW5A 4R3AA 3RLPA 4EGHA 4BIZA 4ASAA 2WI2A 3HYZA 2IOQA 4R1FA 4MOTA 1Z5BA 4CWPA 2IWXA 2K5BA 3LPSA 2YE8A 2Q8FA 2AKPA 3PEHA 1AH6A 1S14A 2CCTA 1YT1A 2XDSA 2ZDYA 3EKOA 2YGFA 5M4EA 4LWFA 2XX2A 2XJGA 3OMUA 4QPJA 4EMVA 1GKZA 2YEJA 3IEDA 1GKXA 4HYPA 4EFTA 2FWYA 4URLA 1I59A 2YEGA 5F3KA 2BREA 1YS3A 1UYGA 1EA6A 4PRVA 5M4HA 4FMTA 4FCRA 1GJVA 1YSRA 4U7NA 4L90A 2XDKA 3ZM7A 2IORA 1Y8OA 3CGZA 4MB9A 1YC3A 5FWKA 2IWUA 5CTXA 4ZVIA 3T10A 1B62A 2BYIA 4QPKA 1I58A 4MPCA 3B25A 1US7A 1UY7A 4NH7A 2JKIA 2GQPA 3C0EA 4PRXA 2JJCA 4ZKIA 3C11A 3HHUA 1Y4SA 4GEEA 1KZNA 3GIFA 1YC1A 1A4HA 5L3JA 1BXDA 4E00A 5IDJA 4FPPA 4CE2A 1KIJA 2Q8IA 4WUDA 1B63A 3A0RA 3R91A 2XK2A 4V26A 1ZWHA 4H85A 4CWQA 4JAVA 1NHJA 4ASGA 4YKUA 3ZKBA 3RLQA 3B26A 3H80A 2XHRA 3RKZA 1OSFA 2XJXA 5D7CA 4X9LA 4CWOA 3D2RA 2H55A 1UYMA 2BSMA 2YGAA 3A0XA 2IOPA 3B24A 1YERA 4L8ZA 5CTWA 2C2AA 4GT8A 3SL2A 4HZ0A 2Q8HA 4NH8A 2VCJA 4LWHA 2YK2A 4H81A 4LWIA 3TUHA 3CRLA 4AWPA 1UYKA 4HY6A 3H4LA 3T0ZA 3B27A 3JZ3A 4MPEA 4W7TA 3WHAA 4HZ5A 4CWTA 2CCUA 2YEEA 4I5SA 3ZXQA 1TH8A 5M4MA 4O09A 3CRKA 4DZYA 3R4OA 4ASBA 3ZXOA 4XIPA 2XDUA 4PU9A 4K4OA 3EKRA 2VWCA 3DGEA 1AM1A 3CGYA 1UYIA 1U0ZA 3TZ5A 1ID0A 2YKBA 3OPDA 1I5AA 3FT8A 4E01A 4BXIA 4Q20A 4O04A 4XKOA 2WERA 4DUHA 2YI6A 1BKNA 2YEAA 2Q2EB 1YT0A 2PNRA 3INWA 2YECA 2YEFA 4L93A 4BQJA 2O1WA 3HYYA 4XC0A 1I5CA 4JQLA 3O2FA 4YKZA 2XCMA 2FWZA 1QZRA 3EHHA 3BM9A 1ZW9A 2CGFA 1YC4A 1Z59A 2BU6A 3WQ9A 1Y8NA 5FNFA 5J71A 4LWEA 1BYQA 2YE6A 4MPNA 2YI0A 1YSZA 4URNA 3Q5KA 1UYDA 1ZXNA 2HKJA 3MNRP 3CWVA 4MP2A 2BU2A 4KSHA 3QTFA 1R62A 2XHTA 4YKTA 2YKIA 3RLRA 4L91A 3U2KA 4EGKA 4LP0A
chains in the Genus database with same CATH superfamily
1Z5AA 3R92A 4WUCA 2YE7A 2HG1A 5C93A 3Q5LA 2YE2A 4URMA 4EFUA 2YEHA 4YKWA 2BRCA 2EXLA 4XDMA 2YEDA 4CE1A 2YE4A 1BGQA 3BMYA 4AWQA 4MP7A 3VHDA 4CWNA 3T1KA 1TBWA 4XD8A 2IWSA 4O0BA 5FNDA 3T2SA 4P7AA 1S16A 3NMQA 2BYHA 4EM7A 3OWBA 5CF0A 3K60A 4KSGA 5M4PA 2XX4A 1TIDA 1Y4UA 2VCIA 4HY1A 2XDXA 5GGZA 5CTYA 1I5BA 2CG9A 4EEHA 3R4MA 3PEJA 4EGIA 5D7RA 5M4KA 2CH4A 3G7BA 3GIGA 4YKRA 3FT5A 4H7QA 4I3HA 4LWGA 1UY9A 2QG2A 2FXSA 3K98A 2YKCA 3U2DA 3FV5A 4E02A 1YT2A 4BAEA 2CCSA 2YE5A 2XABA 4CE3A 1ZXMA 4AS9A 1U2OA 3B28A 4CWSA 4O05A 1NHIA 2WI5A 3HZ5A 2ZDXA 3OW6A 4GCZA 4XE2A 3A0YA 1UYCA 3GIEA 1MU5A 4XIQA 3R4PA 3INXA 4KTNA 4PL9A 2BU5A 2GFDA 4R3MA 2O1VA 1EI1A 1QY8A 1UYHA 3TZ0A 4KFGA 4LPBA 2WEQA 5M4NA 4JAUA 1MX0A 1QYEA 1Z5CA 2YJXA 1PVGA 2YE3A 4FCPA 3LNUA 3K97A 1TC0A 1TILA 5F5RA 4JASA 3VHCA 5BODA 3D36A 2QF6A 4U7OA 3VADA 5IDMA 3ZKDA 1H7UA 2XJJA 1AH8A 4CWFA 3CYGA 3EHJA 5BOCA 4YKXA 2XHXA 4BQGA 4GQTA 2BU7A 1L0OA 4XCJA 1THNA 4WUBA 1JM6A 1B3QA 2FTKA 4O07A 3OWDA 4ASFA 1I5DA 4HXZA 4V25A 2FYPA 4XKKA 2YEIA 3O0IA 4BIUA 2E0AA 3HZ1A 1AMWA 4HYMA 2XDLA 4YKYA 4P8OA 1YESA 5CPHA 5JENA 3A0TA 2QFOA 4XIRA 3EHGA 2WEPA 1UYFA 4XTJA 1IXMA 1H7SA 2YJWA 5D6PA 4MBCA 2O1UA 5FNCA 2UWDA 4XITA 2WI7A 4GGLA 3A0WA 2WI1A 5D7DA 1TC6A 4U93A 1UY8A 2BZ5A 4L94A 2YEBA 2YI5A 4UROA 2H8MA 2ZKJA 4HXWA 2BT0A 3O6OA 1F51A 4KQVA 3G7EA 2WI6A 4B7PA 4CWRA 2WI4A 4B6CA 3TZ2A 1YETA 1AJ6A 2YI7A 2YKJA 3S5TA 4KP4A 3T0HA 2Q8GA 1UYLA 5J6AA 3G75A 2HHIA 4AWOA 4XKAA 3HEKA 2XX5A 5IN9A 3TTZA 4XCLA 3GIGB 1NHHA 2ZBKB 2WI3A 3U67A 4NH9A 4GFNA 5CTUA 1UYEA 4YKQA 2QG0A 3QDDA 4FCQA 2YK9A 3KE6A 2YKEA 3A0ZA 3VHAA 3R4NA 3K99A 2XD6A 2BU8A 1Y8PA 2HCHA 1UY6A 3TZ4A 3D0BA 3EHFA 2ESAA 2YE9A 2BTZA 5D6QA 3Q5JA 2YGEA 2VW5A 4R3AA 3RLPA 4EGHA 2C1IA 4ASAA 4BIZA 3HYZA 2WI2A 2IOQA 4R1FA 4MOTA 1Z5BA 4CWPA 2IWXA 2K5BA 3LPSA 2YE8A 2Q8FA 2AKPA 3PEHA 1AH6A 1S14A 2CCTA 1YT1A 2XDSA 2ZDYA 3EKOA 2YGFA 5M4EA 4LWFA 2XX2A 2XJGA 3OMUA 4QPJA 4EMVA 1GKZA 2YEJA 3IEDA 1GKXA 4HYPA 4EFTA 2FWYA 4URLA 1I59A 2YEGA 5F3KA 2BREA 1YS3A 1UYGA 1EA6A 4PRVA 5M4HA 4FMTA 4FCRA 1GJVA 1YSRA 4U7NA 4L90A 3LMMA 2XDKA 4E72A 3ZM7A 2IORA 1Y8OA 3CGZA 4MB9A 1YC3A 5FWKA 2IWUA 5CTXA 4ZVIA 3T10A 1B62A 2BYIA 4QPKA 1I58A 4MPCA 3B25A 1US7A 1UY7A 4NH7A 2JKIA 2GQPA 3C0EA 4PRXA 2JJCA 4ZKIA 3C11A 3HHUA 1Y4SA 4GEEA 1KZNA 3GIFA 1YC1A 1A4HA 5L3JA 1BXDA 4E00A 5IDJA 4FPPA 4CE2A 1KIJA 2Q8IA 4WUDA 1B63A 3A0RA 3R91A 2XK2A 4V26A 1ZWHA 4H85A 4CWQA 4JAVA 1NHJA 4ASGA 4YKUA 3ZKBA 3RLQA 3B26A 3H80A 2XHRA 3RKZA 1OSFA 2XJXA 5D7CA 4X9LA 4CWOA 3D2RA 2H55A 1UYMA 2BSMA 2YGAA 3A0XA 2IOPA 3B24A 1YERA 4L8ZA 5CTWA 2C2AA 4GT8A 3SL2A 4HZ0A 2Q8HA 4NH8A 2VCJA 4LWHA 2YK2A 4H81A 4LWIA 3TUHA 3CRLA 4AWPA 1UYKA 4HY6A 3H4LA 3T0ZA 3B27A 3JZ3A 4MPEA 4W7TA 3WHAA 4HZ5A 4CWTA 2CCUA 2YEEA 4I5SA 3ZXQA 1TH8A 5M4MA 4O09A 3CRKA 4DZYA 3R4OA 4ASBA 3ZXOA 4XIPA 2XDUA 4PU9A 4K4OA 3EKRA 2VWCA 3DGEA 1AM1A 3CGYA 1UYIA 1U0ZA 3TZ5A 1ID0A 2YKBA 3OPDA 1I5AA 3FT8A 4E01A 4BXIA 4Q20A 4O04A 4XKOA 2WERA 4DUHA 2YI6A 1BKNA 2YEAA 2Q2EB 1YT0A 2PNRA 3INWA 2YECA 2YEFA 4L93A 4BQJA 2O1WA 3HYYA 4XC0A 1I5CA 2C1GA 4JQLA 3O2FA 4YKZA 2XCMA 2FWZA 1QZRA 3EHHA 3BM9A 1ZW9A 2CGFA 1YC4A 1Z59A 2BU6A 3WQ9A 1Y8NA 5FNFA 5J71A 4LWEA 1BYQA 2YE6A 4MPNA 2YI0A 1YSZA 4URNA 3Q5KA 1UYDA 1ZXNA 2HKJA 3MNRP 3CWVA 4MP2A 2BU2A 4KSHA 3QTFA 1R62A 2XHTA 4YKTA 2YKIA 3RLRA 4L91A 3U2KA 4EGKA 4LP0A
chains in the Genus database with same CATH topology
1Z5AA 3R92A 4WUCA 2YE7A 2HG1A 5C93A 3Q5LA 2YE2A 4URMA 4EFUA 2YEHA 4YKWA 2BRCA 2EXLA 4XDMA 2YEDA 4CE1A 2YE4A 1BGQA 3BMYA 4AWQA 4MP7A 3VHDA 4CWNA 3T1KA 1TBWA 4XD8A 2IWSA 4O0BA 5FNDA 3T2SA 4P7AA 1S16A 3NMQA 2BYHA 4EM7A 3OWBA 5CF0A 3K60A 4KSGA 5M4PA 2XX4A 1TIDA 1Y4UA 2VCIA 4HY1A 2XDXA 5GGZA 5CTYA 1I5BA 2CG9A 4EEHA 3R4MA 3PEJA 4EGIA 5D7RA 5M4KA 2CH4A 3G7BA 3GIGA 4YKRA 3FT5A 4H7QA 4I3HA 4LWGA 1UY9A 2QG2A 2FXSA 3K98A 2YKCA 3U2DA 3FV5A 4E02A 1YT2A 4BAEA 2CCSA 2YE5A 2XABA 4CE3A 1ZXMA 4AS9A 1U2OA 3B28A 4CWSA 4O05A 1NHIA 2WI5A 3HZ5A 2ZDXA 3OW6A 4GCZA 4XE2A 3A0YA 1UYCA 3GIEA 1MU5A 4XIQA 3R4PA 3INXA 4KTNA 4PL9A 2BU5A 2GFDA 4R3MA 2O1VA 1EI1A 1QY8A 1UYHA 3TZ0A 4KFGA 4LPBA 2WEQA 5M4NA 4JAUA 1MX0A 1QYEA 1Z5CA 2YJXA 1PVGA 2YE3A 4FCPA 3LNUA 3K97A 1TC0A 1TILA 5F5RA 4JASA 3VHCA 5BODA 3D36A 2QF6A 4U7OA 3VADA 5IDMA 3ZKDA 1H7UA 2XJJA 1AH8A 4CWFA 3EHJA 5BOCA 4YKXA 2XHXA 4BQGA 4GQTA 2BU7A 1L0OA 4XCJA 1THNA 4WUBA 1JM6A 1B3QA 4O07A 3OWDA 4ASFA 1I5DA 4HXZA 4V25A 2FYPA 4XKKA 2YEIA 3O0IA 4BIUA 2E0AA 3HZ1A 1AMWA 4HYMA 2XDLA 4YKYA 4P8OA 1YESA 5CPHA 3A0TA 2QFOA 4XIRA 3EHGA 2WEPA 1UYFA 4XTJA 1H7SA 2YJWA 5D6PA 4MBCA 2O1UA 5FNCA 2UWDA 4XITA 2WI7A 4GGLA 3A0WA 2WI1A 5D7DA 1TC6A 4U93A 1UY8A 2BZ5A 4L94A 2YEBA 2YI5A 4UROA 2H8MA 2ZKJA 4HXWA 2BT0A 3O6OA 4KQVA 3G7EA 2WI6A 4B7PA 4CWRA 2WI4A 4B6CA 3TZ2A 1YETA 1AJ6A 2YI7A 2YKJA 4KP4A 3T0HA 2Q8GA 1UYLA 5J6AA 3G75A 4AWOA 4XKAA 3HEKA 2XX5A 5IN9A 3TTZA 4XCLA 3GIGB 1NHHA 2ZBKB 2WI3A 3U67A 4NH9A 4GFNA 5CTUA 1UYEA 4YKQA 2QG0A 3QDDA 4FCQA 2YK9A 3KE6A 2YKEA 3A0ZA 3VHAA 3R4NA 3K99A 2XD6A 2BU8A 1Y8PA 2HCHA 1UY6A 3TZ4A 3D0BA 3EHFA 2ESAA 2YE9A 2BTZA 5D6QA 3Q5JA 2YGEA 2VW5A 4R3AA 3RLPA 4EGHA 4BIZA 4ASAA 2WI2A 3HYZA 2IOQA 4R1FA 4MOTA 1Z5BA 4CWPA 2IWXA 2K5BA 3LPSA 2YE8A 2Q8FA 2AKPA 3PEHA 1AH6A 1S14A 2CCTA 1YT1A 2XDSA 2ZDYA 3EKOA 2YGFA 5M4EA 4LWFA 2XX2A 2XJGA 3OMUA 4QPJA 4EMVA 1GKZA 2YEJA 3IEDA 1GKXA 4HYPA 4EFTA 2FWYA 4URLA 1I59A 2YEGA 5F3KA 2BREA 1YS3A 1UYGA 1EA6A 4PRVA 5M4HA 4FMTA 4FCRA 1GJVA 1YSRA 4U7NA 4L90A 2XDKA 3ZM7A 2IORA 1Y8OA 3CGZA 4MB9A 1YC3A 5FWKA 2IWUA 5CTXA 4ZVIA 3T10A 1B62A 2BYIA 4QPKA 1I58A 4MPCA 3B25A 1US7A 1UY7A 4NH7A 2JKIA 2GQPA 3C0EA 4PRXA 2JJCA 4ZKIA 3C11A 3HHUA 1Y4SA 4GEEA 1KZNA 3GIFA 1YC1A 1A4HA 5L3JA 1BXDA 4E00A 5IDJA 4FPPA 4CE2A 1KIJA 2Q8IA 4WUDA 1B63A 3A0RA 3R91A 2XK2A 4V26A 1ZWHA 4H85A 4CWQA 4JAVA 1NHJA 4ASGA 4YKUA 3ZKBA 3RLQA 3B26A 3H80A 2XHRA 3RKZA 1OSFA 2XJXA 5D7CA 4X9LA 4CWOA 3D2RA 2H55A 1UYMA 2BSMA 2YGAA 3A0XA 2IOPA 3B24A 1YERA 4L8ZA 5CTWA 2C2AA 4GT8A 3SL2A 4HZ0A 2Q8HA 4NH8A 2VCJA 4LWHA 2YK2A 4H81A 4LWIA 3TUHA 3CRLA 4AWPA 1UYKA 4HY6A 3H4LA 3T0ZA 3B27A 3JZ3A 4MPEA 4W7TA 3WHAA 4HZ5A 4CWTA 2CCUA 2YEEA 4I5SA 3ZXQA 1TH8A 5M4MA 4O09A 3CRKA 4DZYA 3R4OA 4ASBA 3ZXOA 4XIPA 2XDUA 4PU9A 4K4OA 3EKRA 2VWCA 3DGEA 1AM1A 3CGYA 1UYIA 1U0ZA 3TZ5A 1ID0A 2YKBA 3OPDA 1I5AA 3FT8A 4E01A 4BXIA 4Q20A 4O04A 4XKOA 2WERA 4DUHA 2YI6A 1BKNA 2YEAA 2Q2EB 1YT0A 2PNRA 3INWA 2YECA 2YEFA 4L93A 4BQJA 2O1WA 3HYYA 4XC0A 1I5CA 4JQLA 3O2FA 4YKZA 2XCMA 2FWZA 1QZRA 3EHHA 3BM9A 1ZW9A 2CGFA 1YC4A 1Z59A 2BU6A 3WQ9A 1Y8NA 5FNFA 5J71A 4LWEA 1BYQA 2YE6A 4MPNA 2YI0A 1YSZA 4URNA 3Q5KA 1UYDA 1ZXNA 2HKJA 3MNRP 3CWVA 4MP2A 2BU2A 4KSHA 3QTFA 1R62A 2XHTA 4YKTA 2YKIA 3RLRA 4L91A 3U2KA 4EGKA 4LP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5A A;  3R92 A;  4WUC A;  2YE7 A;  2HG1 A;  5C93 A;  3Q5L A;  2YE2 A;  4URM A;  4EFU A;  2YEH A;  4YKW A;  2BRC A;  2EXL A;  4XDM A;  2YED A;  4CE1 A;  2YE4 A;  1BGQ A;  3BMY A;  4AWQ A;  4MP7 A;  3VHD A;  4CWN A;  3T1K A;  1TBW A;  4XD8 A;  2IWS A;  4O0B A;  5FND A;  3T2S A;  4P7A A;  1S16 A;  3NMQ A;  2BYH A;  4EM7 A;  3OWB A;  5CF0 A;  3K60 A;  4KSG A;  5M4P A;  2XX4 A;  1TID A;  1Y4U A;  2VCI A;  4HY1 A;  2XDX A;  5GGZ A;  5CTY A;  1I5B A;  2CG9 A;  4EEH A;  3R4M A;  3PEJ A;  4EGI A;  5D7R A;  5M4K A;  2CH4 A;  3G7B A;  3GIG A;  4YKR A;  3FT5 A;  4H7Q A;  4I3H A;  4LWG A;  1UY9 A;  2QG2 A;  2FXS A;  3K98 A;  2YKC A;  3U2D A;  3FV5 A;  4E02 A;  1YT2 A;  4BAE A;  2CCS A;  2YE5 A;  2XAB A;  4CE3 A;  1ZXM A;  4AS9 A;  1U2O A;  3B28 A;  4CWS A;  4O05 A;  1NHI A;  2WI5 A;  3HZ5 A;  2ZDX A;  3OW6 A;  4GCZ A;  4XE2 A;  3A0Y A;  1UYC A;  3GIE A;  1MU5 A;  4XIQ A;  3R4P A;  3INX A;  4KTN A;  4PL9 A;  2BU5 A;  2GFD A;  4R3M A;  2O1V A;  1EI1 A;  1QY8 A;  1UYH A;  3TZ0 A;  4KFG A;  4LPB A;  2WEQ A;  5M4N A;  4JAU A;  1MX0 A;  1QYE A;  1Z5C A;  2YJX A;  1PVG A;  2YE3 A;  4FCP A;  3LNU A;  3K97 A;  1TC0 A;  1TIL A;  5F5R A;  4JAS A;  3VHC A;  5BOD A;  3D36 A;  2QF6 A;  4U7O A;  3VAD A;  5IDM A;  3ZKD A;  1H7U A;  2XJJ A;  1AH8 A;  4CWF A;  3EHJ A;  5BOC A;  4YKX A;  2XHX A;  4BQG A;  4GQT A;  2BU7 A;  1L0O A;  4XCJ A;  1THN A;  4WUB A;  1JM6 A;  1B3Q A;  4O07 A;  3OWD A;  4ASF A;  1I5D A;  4HXZ A;  4V25 A;  2FYP A;  4XKK A;  2YEI A;  3O0I A;  4BIU A;  2E0A A;  3HZ1 A;  1AMW A;  4HYM A;  2XDL A;  4YKY A;  4P8O A;  1YES A;  5CPH A;  3A0T A;  2QFO A;  4XIR A;  3EHG A;  2WEP A;  1UYF A;  4XTJ A;  1H7S A;  2YJW A;  5D6P A;  4MBC A;  2O1U A;  5FNC A;  2UWD A;  4XIT A;  2WI7 A;  4GGL A;  3A0W A;  2WI1 A;  5D7D A;  1TC6 A;  4U93 A;  1UY8 A;  2BZ5 A;  4L94 A;  2YEB A;  2YI5 A;  4URO A;  2H8M A;  2ZKJ A;  4HXW A;  2BT0 A;  3O6O A;  4KQV A;  3G7E A;  2WI6 A;  4B7P A;  4CWR A;  2WI4 A;  4B6C A;  3TZ2 A;  1YET A;  1AJ6 A;  2YI7 A;  2YKJ A;  4KP4 A;  3T0H A;  2Q8G A;  1UYL A;  5J6A A;  3G75 A;  4AWO A;  4XKA A;  3HEK A;  2XX5 A;  5IN9 A;  3TTZ A;  4XCL A;  3GIG B;  1NHH A;  2ZBK B;  2WI3 A;  3U67 A;  4NH9 A;  4GFN A;  5CTU A;  1UYE A;  4YKQ A;  2QG0 A;  3QDD A;  4FCQ A;  2YK9 A;  3KE6 A;  2YKE A;  3A0Z A;  3VHA A;  3R4N A;  3K99 A;  2XD6 A;  2BU8 A;  1Y8P A;  2HCH A;  1UY6 A;  3TZ4 A;  3D0B A;  3EHF A;  2ESA A;  2YE9 A;  2BTZ A;  5D6Q A;  3Q5J A;  2YGE A;  2VW5 A;  4R3A A;  3RLP A;  4EGH A;  4BIZ A;  4ASA A;  2WI2 A;  3HYZ A;  2IOQ A;  4R1F A;  4MOT A;  1Z5B A;  4CWP A;  2IWX A;  2K5B A;  3LPS A;  2YE8 A;  2Q8F A;  2AKP A;  3PEH A;  1AH6 A;  1S14 A;  2CCT A;  1YT1 A;  2XDS A;  2ZDY A;  3EKO A;  2YGF A;  5M4E A;  4LWF A;  2XX2 A;  2XJG A;  3OMU A;  4QPJ A;  4EMV A;  1GKZ A;  2YEJ A;  3IED A;  1GKX A;  4HYP A;  4EFT A;  2FWY A;  4URL A;  1I59 A;  2YEG A;  5F3K A;  2BRE A;  1YS3 A;  1UYG A;  1EA6 A;  4PRV A;  5M4H A;  4FMT A;  4FCR A;  1GJV A;  1YSR A;  4U7N A;  4L90 A;  2XDK A;  3ZM7 A;  2IOR A;  1Y8O A;  3CGZ A;  4MB9 A;  1YC3 A;  5FWK A;  2IWU A;  5CTX A;  4ZVI A;  3T10 A;  1B62 A;  2BYI A;  4QPK A;  1I58 A;  4MPC A;  3B25 A;  1US7 A;  1UY7 A;  4NH7 A;  2JKI A;  2GQP A;  3C0E A;  4PRX A;  2JJC A;  4ZKI A;  3C11 A;  3HHU A;  1Y4S A;  4GEE A;  1KZN A;  3GIF A;  1YC1 A;  1A4H A;  5L3J A;  1BXD A;  4E00 A;  5IDJ A;  4FPP A;  4CE2 A;  1KIJ A;  2Q8I A;  4WUD A;  1B63 A;  3A0R A;  3R91 A;  2XK2 A;  4V26 A;  1ZWH A;  4H85 A;  4CWQ A;  4JAV A;  1NHJ A;  4ASG A;  4YKU A;  3ZKB A;  3RLQ A;  3B26 A;  3H80 A;  2XHR A;  3RKZ A;  1OSF A;  2XJX A;  5D7C A;  4X9L A;  4CWO A;  3D2R A;  2H55 A;  1UYM A;  2BSM A;  2YGA A;  3A0X A;  2IOP A;  3B24 A;  1YER A;  4L8Z A;  5CTW A;  2C2A A;  4GT8 A;  3SL2 A;  4HZ0 A;  2Q8H A;  4NH8 A;  2VCJ A;  4LWH A;  2YK2 A;  4H81 A;  4LWI A;  3TUH A;  3CRL A;  4AWP A;  1UYK A;  4HY6 A;  3H4L A;  3T0Z A;  3B27 A;  3JZ3 A;  4MPE A;  4W7T A;  3WHA A;  4HZ5 A;  4CWT A;  2CCU A;  2YEE A;  4I5S A;  3ZXQ A;  1TH8 A;  5M4M A;  4O09 A;  3CRK A;  4DZY A;  3R4O A;  4ASB A;  3ZXO A;  4XIP A;  2XDU A;  4PU9 A;  4K4O A;  3EKR A;  2VWC A;  3DGE A;  1AM1 A;  3CGY A;  1UYI A;  1U0Z A;  3TZ5 A;  1ID0 A;  2YKB A;  3OPD A;  1I5A A;  3FT8 A;  4E01 A;  4BXI A;  4Q20 A;  4O04 A;  4XKO A;  2WER A;  4DUH A;  2YI6 A;  1BKN A;  2YEA A;  2Q2E B;  1YT0 A;  2PNR A;  3INW A;  2YEC A;  2YEF A;  4L93 A;  4BQJ A;  2O1W A;  3HYY A;  4XC0 A;  1I5C A;  4JQL A;  3O2F A;  4YKZ A;  2XCM A;  2FWZ A;  1QZR A;  3EHH A;  3BM9 A;  1ZW9 A;  2CGF A;  1YC4 A;  1Z59 A;  2BU6 A;  3WQ9 A;  1Y8N A;  5FNF A;  5J71 A;  4LWE A;  1BYQ A;  2YE6 A;  4MPN A;  2YI0 A;  1YSZ A;  4URN A;  3Q5K A;  1UYD A;  1ZXN A;  2HKJ A;  3MNR P;  3CWV A;  4MP2 A;  2BU2 A;  4KSH A;  3QTF A;  1R62 A;  2XHT A;  4YKT A;  2YKI A;  3RLR A;  4L91 A;  3U2K A;  4EGK A;  4LP0 A; 
#chains in the Genus database with same CATH topology
 1Z5A A;  3R92 A;  4WUC A;  2YE7 A;  2HG1 A;  5C93 A;  3Q5L A;  2YE2 A;  4URM A;  4EFU A;  2YEH A;  4YKW A;  2BRC A;  2EXL A;  4XDM A;  2YED A;  4CE1 A;  2YE4 A;  1BGQ A;  3BMY A;  4AWQ A;  4MP7 A;  3VHD A;  4CWN A;  3T1K A;  1TBW A;  4XD8 A;  2IWS A;  4O0B A;  5FND A;  3T2S A;  4P7A A;  1S16 A;  3NMQ A;  2BYH A;  4EM7 A;  3OWB A;  5CF0 A;  3K60 A;  4KSG A;  5M4P A;  2XX4 A;  1TID A;  1Y4U A;  2VCI A;  4HY1 A;  2XDX A;  5GGZ A;  5CTY A;  1I5B A;  2CG9 A;  4EEH A;  3R4M A;  3PEJ A;  4EGI A;  5D7R A;  5M4K A;  2CH4 A;  3G7B A;  3GIG A;  4YKR A;  3FT5 A;  4H7Q A;  4I3H A;  4LWG A;  1UY9 A;  2QG2 A;  2FXS A;  3K98 A;  2YKC A;  3U2D A;  3FV5 A;  4E02 A;  1YT2 A;  4BAE A;  2CCS A;  2YE5 A;  2XAB A;  4CE3 A;  1ZXM A;  4AS9 A;  1U2O A;  3B28 A;  4CWS A;  4O05 A;  1NHI A;  2WI5 A;  3HZ5 A;  2ZDX A;  3OW6 A;  4GCZ A;  4XE2 A;  3A0Y A;  1UYC A;  3GIE A;  1MU5 A;  4XIQ A;  3R4P A;  3INX A;  4KTN A;  4PL9 A;  2BU5 A;  2GFD A;  4R3M A;  2O1V A;  1EI1 A;  1QY8 A;  1UYH A;  3TZ0 A;  4KFG A;  4LPB A;  2WEQ A;  5M4N A;  4JAU A;  1MX0 A;  1QYE A;  1Z5C A;  2YJX A;  1PVG A;  2YE3 A;  4FCP A;  3LNU A;  3K97 A;  1TC0 A;  1TIL A;  5F5R A;  4JAS A;  3VHC A;  5BOD A;  3D36 A;  2QF6 A;  4U7O A;  3VAD A;  5IDM A;  3ZKD A;  1H7U A;  2XJJ A;  1AH8 A;  4CWF A;  3CYG A;  3EHJ A;  5BOC A;  4YKX A;  2XHX A;  4BQG A;  4GQT A;  2BU7 A;  1L0O A;  4XCJ A;  1THN A;  4WUB A;  1JM6 A;  1B3Q A;  2FTK A;  4O07 A;  3OWD A;  4ASF A;  1I5D A;  4HXZ A;  4V25 A;  2FYP A;  4XKK A;  2YEI A;  3O0I A;  4BIU A;  2E0A A;  3HZ1 A;  1AMW A;  4HYM A;  2XDL A;  4YKY A;  4P8O A;  1YES A;  5CPH A;  5JEN A;  3A0T A;  2QFO A;  4XIR A;  3EHG A;  2WEP A;  1UYF A;  4XTJ A;  1IXM A;  1H7S A;  2YJW A;  5D6P A;  4MBC A;  2O1U A;  5FNC A;  2UWD A;  4XIT A;  2WI7 A;  4GGL A;  3A0W A;  2WI1 A;  5D7D A;  1TC6 A;  4U93 A;  1UY8 A;  2BZ5 A;  4L94 A;  2YEB A;  2YI5 A;  4URO A;  2H8M A;  2ZKJ A;  4HXW A;  2BT0 A;  3O6O A;  1F51 A;  4KQV A;  3G7E A;  2WI6 A;  4B7P A;  4CWR A;  2WI4 A;  4B6C A;  3TZ2 A;  1YET A;  1AJ6 A;  2YI7 A;  2YKJ A;  3S5T A;  4KP4 A;  3T0H A;  2Q8G A;  1UYL A;  5J6A A;  3G75 A;  2HHI A;  4AWO A;  4XKA A;  3HEK A;  2XX5 A;  5IN9 A;  3TTZ A;  4XCL A;  3GIG B;  1NHH A;  2ZBK B;  2WI3 A;  3U67 A;  4NH9 A;  4GFN A;  5CTU A;  1UYE A;  4YKQ A;  2QG0 A;  3QDD A;  4FCQ A;  2YK9 A;  3KE6 A;  2YKE A;  3A0Z A;  3VHA A;  3R4N A;  3K99 A;  2XD6 A;  2BU8 A;  1Y8P A;  2HCH A;  1UY6 A;  3TZ4 A;  3D0B A;  3EHF A;  2ESA A;  2YE9 A;  2BTZ A;  5D6Q A;  3Q5J A;  2YGE A;  2VW5 A;  4R3A A;  3RLP A;  4EGH A;  2C1I A;  4ASA A;  4BIZ A;  3HYZ A;  2WI2 A;  2IOQ A;  4R1F A;  4MOT A;  1Z5B A;  4CWP A;  2IWX A;  2K5B A;  3LPS A;  2YE8 A;  2Q8F A;  2AKP A;  3PEH A;  1AH6 A;  1S14 A;  2CCT A;  1YT1 A;  2XDS A;  2ZDY A;  3EKO A;  2YGF A;  5M4E A;  4LWF A;  2XX2 A;  2XJG A;  3OMU A;  4QPJ A;  4EMV A;  1GKZ A;  2YEJ A;  3IED A;  1GKX A;  4HYP A;  4EFT A;  2FWY A;  4URL A;  1I59 A;  2YEG A;  5F3K A;  2BRE A;  1YS3 A;  1UYG A;  1EA6 A;  4PRV A;  5M4H A;  4FMT A;  4FCR A;  1GJV A;  1YSR A;  4U7N A;  4L90 A;  3LMM A;  2XDK A;  4E72 A;  3ZM7 A;  2IOR A;  1Y8O A;  3CGZ A;  4MB9 A;  1YC3 A;  5FWK A;  2IWU A;  5CTX A;  4ZVI A;  3T10 A;  1B62 A;  2BYI A;  4QPK A;  1I58 A;  4MPC A;  3B25 A;  1US7 A;  1UY7 A;  4NH7 A;  2JKI A;  2GQP A;  3C0E A;  4PRX A;  2JJC A;  4ZKI A;  3C11 A;  3HHU A;  1Y4S A;  4GEE A;  1KZN A;  3GIF A;  1YC1 A;  1A4H A;  5L3J A;  1BXD A;  4E00 A;  5IDJ A;  4FPP A;  4CE2 A;  1KIJ A;  2Q8I A;  4WUD A;  1B63 A;  3A0R A;  3R91 A;  2XK2 A;  4V26 A;  1ZWH A;  4H85 A;  4CWQ A;  4JAV A;  1NHJ A;  4ASG A;  4YKU A;  3ZKB A;  3RLQ A;  3B26 A;  3H80 A;  2XHR A;  3RKZ A;  1OSF A;  2XJX A;  5D7C A;  4X9L A;  4CWO A;  3D2R A;  2H55 A;  1UYM A;  2BSM A;  2YGA A;  3A0X A;  2IOP A;  3B24 A;  1YER A;  4L8Z A;  5CTW A;  2C2A A;  4GT8 A;  3SL2 A;  4HZ0 A;  2Q8H A;  4NH8 A;  2VCJ A;  4LWH A;  2YK2 A;  4H81 A;  4LWI A;  3TUH A;  3CRL A;  4AWP A;  1UYK A;  4HY6 A;  3H4L A;  3T0Z A;  3B27 A;  3JZ3 A;  4MPE A;  4W7T A;  3WHA A;  4HZ5 A;  4CWT A;  2CCU A;  2YEE A;  4I5S A;  3ZXQ A;  1TH8 A;  5M4M A;  4O09 A;  3CRK A;  4DZY A;  3R4O A;  4ASB A;  3ZXO A;  4XIP A;  2XDU A;  4PU9 A;  4K4O A;  3EKR A;  2VWC A;  3DGE A;  1AM1 A;  3CGY A;  1UYI A;  1U0Z A;  3TZ5 A;  1ID0 A;  2YKB A;  3OPD A;  1I5A A;  3FT8 A;  4E01 A;  4BXI A;  4Q20 A;  4O04 A;  4XKO A;  2WER A;  4DUH A;  2YI6 A;  1BKN A;  2YEA A;  2Q2E B;  1YT0 A;  2PNR A;  3INW A;  2YEC A;  2YEF A;  4L93 A;  4BQJ A;  2O1W A;  3HYY A;  4XC0 A;  1I5C A;  2C1G A;  4JQL A;  3O2F A;  4YKZ A;  2XCM A;  2FWZ A;  1QZR A;  3EHH A;  3BM9 A;  1ZW9 A;  2CGF A;  1YC4 A;  1Z59 A;  2BU6 A;  3WQ9 A;  1Y8N A;  5FNF A;  5J71 A;  4LWE A;  1BYQ A;  2YE6 A;  4MPN A;  2YI0 A;  1YSZ A;  4URN A;  3Q5K A;  1UYD A;  1ZXN A;  2HKJ A;  3MNR P;  3CWV A;  4MP2 A;  2BU2 A;  4KSH A;  3QTF A;  1R62 A;  2XHT A;  4YKT A;  2YKI A;  3RLR A;  4L91 A;  3U2K A;  4EGK A;  4LP0 A; 
#chains in the Genus database with same CATH homology
 1Z5A A;  3R92 A;  4WUC A;  2YE7 A;  2HG1 A;  5C93 A;  3Q5L A;  2YE2 A;  4URM A;  4EFU A;  2YEH A;  4YKW A;  2BRC A;  2EXL A;  4XDM A;  2YED A;  4CE1 A;  2YE4 A;  1BGQ A;  3BMY A;  4AWQ A;  4MP7 A;  3VHD A;  4CWN A;  3T1K A;  1TBW A;  4XD8 A;  2IWS A;  4O0B A;  5FND A;  3T2S A;  4P7A A;  1S16 A;  3NMQ A;  2BYH A;  4EM7 A;  3OWB A;  5CF0 A;  3K60 A;  4KSG A;  5M4P A;  2XX4 A;  1TID A;  1Y4U A;  2VCI A;  4HY1 A;  2XDX A;  5GGZ A;  5CTY A;  1I5B A;  2CG9 A;  4EEH A;  3R4M A;  3PEJ A;  4EGI A;  5D7R A;  5M4K A;  2CH4 A;  3G7B A;  3GIG A;  4YKR A;  3FT5 A;  4H7Q A;  4I3H A;  4LWG A;  1UY9 A;  2QG2 A;  2FXS A;  3K98 A;  2YKC A;  3U2D A;  3FV5 A;  4E02 A;  1YT2 A;  4BAE A;  2CCS A;  2YE5 A;  2XAB A;  4CE3 A;  1ZXM A;  4AS9 A;  1U2O A;  3B28 A;  4CWS A;  4O05 A;  1NHI A;  2WI5 A;  3HZ5 A;  2ZDX A;  3OW6 A;  4GCZ A;  4XE2 A;  3A0Y A;  1UYC A;  3GIE A;  1MU5 A;  4XIQ A;  3R4P A;  3INX A;  4KTN A;  4PL9 A;  2BU5 A;  2GFD A;  4R3M A;  2O1V A;  1EI1 A;  1QY8 A;  1UYH A;  3TZ0 A;  4KFG A;  4LPB A;  2WEQ A;  5M4N A;  4JAU A;  1MX0 A;  1QYE A;  1Z5C A;  2YJX A;  1PVG A;  2YE3 A;  4FCP A;  3LNU A;  3K97 A;  1TC0 A;  1TIL A;  5F5R A;  4JAS A;  3VHC A;  5BOD A;  3D36 A;  2QF6 A;  4U7O A;  3VAD A;  5IDM A;  3ZKD A;  1H7U A;  2XJJ A;  1AH8 A;  4CWF A;  3EHJ A;  5BOC A;  4YKX A;  2XHX A;  4BQG A;  4GQT A;  2BU7 A;  1L0O A;  4XCJ A;  1THN A;  4WUB A;  1JM6 A;  1B3Q A;  4O07 A;  3OWD A;  4ASF A;  1I5D A;  4HXZ A;  4V25 A;  2FYP A;  4XKK A;  2YEI A;  3O0I A;  4BIU A;  2E0A A;  3HZ1 A;  1AMW A;  4HYM A;  2XDL A;  4YKY A;  4P8O A;  1YES A;  5CPH A;  3A0T A;  2QFO A;  4XIR A;  3EHG A;  2WEP A;  1UYF A;  4XTJ A;  1H7S A;  2YJW A;  5D6P A;  4MBC A;  2O1U A;  5FNC A;  2UWD A;  4XIT A;  2WI7 A;  4GGL A;  3A0W A;  2WI1 A;  5D7D A;  1TC6 A;  4U93 A;  1UY8 A;  2BZ5 A;  4L94 A;  2YEB A;  2YI5 A;  4URO A;  2H8M A;  2ZKJ A;  4HXW A;  2BT0 A;  3O6O A;  4KQV A;  3G7E A;  2WI6 A;  4B7P A;  4CWR A;  2WI4 A;  4B6C A;  3TZ2 A;  1YET A;  1AJ6 A;  2YI7 A;  2YKJ A;  4KP4 A;  3T0H A;  2Q8G A;  1UYL A;  5J6A A;  3G75 A;  4AWO A;  4XKA A;  3HEK A;  2XX5 A;  5IN9 A;  3TTZ A;  4XCL A;  3GIG B;  1NHH A;  2ZBK B;  2WI3 A;  3U67 A;  4NH9 A;  4GFN A;  5CTU A;  1UYE A;  4YKQ A;  2QG0 A;  3QDD A;  4FCQ A;  2YK9 A;  3KE6 A;  2YKE A;  3A0Z A;  3VHA A;  3R4N A;  3K99 A;  2XD6 A;  2BU8 A;  1Y8P A;  2HCH A;  1UY6 A;  3TZ4 A;  3D0B A;  3EHF A;  2ESA A;  2YE9 A;  2BTZ A;  5D6Q A;  3Q5J A;  2YGE A;  2VW5 A;  4R3A A;  3RLP A;  4EGH A;  4BIZ A;  4ASA A;  2WI2 A;  3HYZ A;  2IOQ A;  4R1F A;  4MOT A;  1Z5B A;  4CWP A;  2IWX A;  2K5B A;  3LPS A;  2YE8 A;  2Q8F A;  2AKP A;  3PEH A;  1AH6 A;  1S14 A;  2CCT A;  1YT1 A;  2XDS A;  2ZDY A;  3EKO A;  2YGF A;  5M4E A;  4LWF A;  2XX2 A;  2XJG A;  3OMU A;  4QPJ A;  4EMV A;  1GKZ A;  2YEJ A;  3IED A;  1GKX A;  4HYP A;  4EFT A;  2FWY A;  4URL A;  1I59 A;  2YEG A;  5F3K A;  2BRE A;  1YS3 A;  1UYG A;  1EA6 A;  4PRV A;  5M4H A;  4FMT A;  4FCR A;  1GJV A;  1YSR A;  4U7N A;  4L90 A;  2XDK A;  3ZM7 A;  2IOR A;  1Y8O A;  3CGZ A;  4MB9 A;  1YC3 A;  5FWK A;  2IWU A;  5CTX A;  4ZVI A;  3T10 A;  1B62 A;  2BYI A;  4QPK A;  1I58 A;  4MPC A;  3B25 A;  1US7 A;  1UY7 A;  4NH7 A;  2JKI A;  2GQP A;  3C0E A;  4PRX A;  2JJC A;  4ZKI A;  3C11 A;  3HHU A;  1Y4S A;  4GEE A;  1KZN A;  3GIF A;  1YC1 A;  1A4H A;  5L3J A;  1BXD A;  4E00 A;  5IDJ A;  4FPP A;  4CE2 A;  1KIJ A;  2Q8I A;  4WUD A;  1B63 A;  3A0R A;  3R91 A;  2XK2 A;  4V26 A;  1ZWH A;  4H85 A;  4CWQ A;  4JAV A;  1NHJ A;  4ASG A;  4YKU A;  3ZKB A;  3RLQ A;  3B26 A;  3H80 A;  2XHR A;  3RKZ A;  1OSF A;  2XJX A;  5D7C A;  4X9L A;  4CWO A;  3D2R A;  2H55 A;  1UYM A;  2BSM A;  2YGA A;  3A0X A;  2IOP A;  3B24 A;  1YER A;  4L8Z A;  5CTW A;  2C2A A;  4GT8 A;  3SL2 A;  4HZ0 A;  2Q8H A;  4NH8 A;  2VCJ A;  4LWH A;  2YK2 A;  4H81 A;  4LWI A;  3TUH A;  3CRL A;  4AWP A;  1UYK A;  4HY6 A;  3H4L A;  3T0Z A;  3B27 A;  3JZ3 A;  4MPE A;  4W7T A;  3WHA A;  4HZ5 A;  4CWT A;  2CCU A;  2YEE A;  4I5S A;  3ZXQ A;  1TH8 A;  5M4M A;  4O09 A;  3CRK A;  4DZY A;  3R4O A;  4ASB A;  3ZXO A;  4XIP A;  2XDU A;  4PU9 A;  4K4O A;  3EKR A;  2VWC A;  3DGE A;  1AM1 A;  3CGY A;  1UYI A;  1U0Z A;  3TZ5 A;  1ID0 A;  2YKB A;  3OPD A;  1I5A A;  3FT8 A;  4E01 A;  4BXI A;  4Q20 A;  4O04 A;  4XKO A;  2WER A;  4DUH A;  2YI6 A;  1BKN A;  2YEA A;  2Q2E B;  1YT0 A;  2PNR A;  3INW A;  2YEC A;  2YEF A;  4L93 A;  4BQJ A;  2O1W A;  3HYY A;  4XC0 A;  1I5C A;  4JQL A;  3O2F A;  4YKZ A;  2XCM A;  2FWZ A;  1QZR A;  3EHH A;  3BM9 A;  1ZW9 A;  2CGF A;  1YC4 A;  1Z59 A;  2BU6 A;  3WQ9 A;  1Y8N A;  5FNF A;  5J71 A;  4LWE A;  1BYQ A;  2YE6 A;  4MPN A;  2YI0 A;  1YSZ A;  4URN A;  3Q5K A;  1UYD A;  1ZXN A;  2HKJ A;  3MNR P;  3CWV A;  4MP2 A;  2BU2 A;  4KSH A;  3QTF A;  1R62 A;  2XHT A;  4YKT A;  2YKI A;  3RLR A;  4L91 A;  3U2K A;  4EGK A;  4LP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...