2GQPA

N-domain of grp94 in complex with the novel ligand n-propyl carboxyamido adenosine
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
236
structure length
209
Chain Sequence
GSHMLREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTITSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adensine Scaffold inhibitors of GRP94
rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
molecule keywords Endoplasmin
total genus 65
structure length 209
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2gqpA00
3QDDA 3HHUA 2GQPA 4YKQA 2BU7A 2YEDA 1S16A 4EGIA 3HYYA 2YGAA 3G75A 4NH8A 3R92A 3H80A 4B7PA 1A4HA 2C2AA 4CWTA 4EMVA 2Q2EB 2IWSA 4XKAA 2WEQA 2WI7A 2XJGA 4QPJA 2WI5A 3A0ZA 2XK2A 4YKZA 3EHGA 4O05A 1TIDA 4FCPA 2XX5A 1UYLA 3CRKA 4GGLA 4YKRA 2O1VA 2O1WA 3K97A 4GEEA 4YKTA 4BIZA 4KSGA 4XTJA 3BM9A 5C93A 4Q20A 4WUCA 1US7A 1YSRA 3TZ2A 1UYDA 1UY8A 4MP2A 2YGEA 4GT8A 1KIJA 3A0WA 4AWOA 1Z59A 2XDLA 3G7EA 3TUHA 5M4KA 3OMUA 1QYEA 1UYHA 3HYZA 1UY9A 3CWVA 4YKXA 4URLA 3T0ZA 4V26A 3K60A 4U7OA 4XDMA 2BU6A 4ASAA 1UYGA 4EEHA 2HKJA 4FPPA 3LNUA 2XX2A 4JAVA 2YKEA 2Q8GA 1I5DA 1UYCA 4H85A 1EI1A 4HY6A 5F3KA 2CG9A 4UROA 3R4MA 3HZ1A 3B27A 4XE2A 1H7SA 1EA6A 1Y8OA 3WHAA 2YEJA 1YT2A 2VW5A 5BOCA 2HCHA 2CGFA 2YEIA 2HG1A 3TZ5A 3EHFA 4LWEA 2JJCA 4MOTA 4WUDA 4L94A 1NHHA 4GCZA 3GIEA 2H55A 1R62A 2YEHA 3VADA 5M4HA 1YETA 1ZWHA 3A0YA 2WI6A 4I3HA 2ZKJA 5D6PA 2YJWA 4XD8A 4CWNA 2BU5A 2YE3A 2YEGA 3IEDA 4P8OA 3EHHA 3MNRP 5D7RA 5D7DA 1AH6A 1Z5AA 3A0RA 4BAEA 4H7QA 2BSMA 3OWDA 2BYHA 4QPKA 1UYFA 1NHJA 1Y8PA 4MPNA 3Q5JA 3CGYA 4XIPA 4YKYA 2EXLA 3D0BA 5L3JA 4FCRA 4FMTA 3ZXOA 3PEHA 3HZ5A 4E00A 1UYIA 4XCJA 3HEKA 4L8ZA 5IDJA 1AM1A 3NMQA 2CCSA 4YKWA 4MBCA 3T10A 1YSZA 4PU9A 4DZYA 3OW6A 2YE2A 4X9LA 4CE3A 2QF6A 1ZW9A 4WUBA 4URNA 5CTWA 4XCLA 1TC0A 1BYQA 3ZM7A 1I59A 4ZKIA 3A0XA 4YKUA 3U2KA 4CWRA 2UWDA 2BU2A 2GFDA 1QZRA 2K5BA 4LPBA 4H81A 4BXIA 2BTZA 2JKIA 1Y8NA 2XHRA 2IWXA 3FV5A 3O0IA 2XCMA 4XKKA 1Y4SA 4JQLA 4EGHA 2YE7A 1KZNA 2YE5A 4E01A 5M4NA 1UYKA 1YC3A 1Z5BA 2WI1A 4LWGA 4LWFA 3C11A 3ZXQA 2VWCA 2XDKA 2YKJA 5CF0A 1TILA 2XJXA 5FNDA 3U2DA 4BQJA 5M4EA 4JASA 3R4NA 2YEBA 4CWOA 4L90A 3K99A 4AS9A 2CCUA 4URMA 1TC6A 1BGQA 1L0OA 3FT8A 4ZVIA 2QG0A 4DUHA 5J6AA 1S14A 4KQVA 1YESA 2WEPA 2AKPA 1BKNA 3R4PA 3OWBA 3VHCA 2YI6A 2WI4A 3B28A 4XITA 4CWSA 4HXWA 4O09A 1NHIA 4LWIA 1YS3A 5M4MA 2XDXA 2YK9A 3R91A 3Q5LA 2YKCA 2YI5A 4XIRA 2IWUA 2CCTA 2VCJA 2BZ5A 4LWHA 2YE9A 1GKZA 4V25A 2CH4A 4EM7A 3RKZA 5CPHA 5J71A 4NH9A 3B24A 4CWPA 4BQGA 4GFNA 4KTNA 4XKOA 2YE8A 2XX4A 5GGZA 2VCIA 2YEFA 3RLPA 2XJJA 3TTZA 3FT5A 3OPDA 4MP7A 3B26A 1UY7A 2WI2A 4KP4A 3T2SA 4AWQA 3BMYA 2IORA 2PNRA 4XC0A 1GJVA 2ZBKB 4ASGA 3TZ4A 2YKIA 1AMWA 2IOPA 4R1FA 4CWQA 3D2RA 3GIFA 5CTYA 1B3QA 3H4LA 2Q8IA 3VHDA 2WI3A 1JM6A 3INXA 3GIGA 4HYPA 1B63A 2QFOA 3A0TA 3RLQA 1I5CA 3C0EA 3K98A 1MX0A 1GKXA 4ASBA 2Q8HA 1UY6A 3PEJA 4I5SA 3QTFA 2BREA 3Q5KA 2YE4A 4AWPA 3B25A 3INWA 1UYEA 1I5BA 2YKBA 5F5RA 1U0ZA 4MPCA 4EFUA 4L91A 2YEAA 2YI0A 3CRLA 3LPSA 3O6OA 4GQTA 4LP0A 4KFGA 1OSFA 4ASFA 4W7TA 4CE1A 2YE6A 2WERA 1TH8A 1ZXMA 3CGZA 4EGKA 1YT1A 3DGEA 3KE6A 2ESAA 1THNA 4JAUA 2BYIA 4L93A 4HZ5A 1AJ6A 1UYMA 2ZDXA 2YGFA 3GIGB 4EFTA 1PVGA 4PRXA 4KSHA 5IN9A 3SL2A 5CTXA 3EKRA 4HXZA 2O1UA 4P7AA 4MPEA 4HZ0A 1B62A 2XHXA 3JZ3A 2YECA 1ID0A 2FWZA 5D6QA 2FYPA 4E02A 4B6CA 2BT0A 5CTUA 1I58A 4XIQA 4K4OA 1YERA 1BXDA 3R4OA 5FNFA 1YC1A 5D7CA 3T0HA 3EHJA 3T1KA 3TZ0A 3O2FA 1YC4A 3WQ9A 2QG2A 2YK2A 4MB9A 4BIUA 3ZKDA 2BRCA 2E0AA 4U7NA 5BODA 1MU5A 2XDSA 2YEEA 2ZDYA 3VHAA 1QY8A 1AH8A 1ZXNA 2XHTA 4NH7A 4CE2A 4FCQA 3U67A 1Z5CA 4PL9A 3RLRA 2XD6A 1YT0A 2YJXA 4O07A 4CWFA 4PRVA 3D36A 2Q8FA 2FXSA 1H7UA 5FNCA 5IDMA 3G7BA 1I5AA 4U93A 2YI7A 4O04A 2IOQA 3EKOA 4R3MA 4HYMA 4R3AA 3ZKBA 1TBWA 2H8MA 2BU8A 1U2OA 2XDUA 2FWYA 4HY1A 1Y4UA 2XABA 5M4PA 5FWKA 4O0BA
chains in the Genus database with same CATH superfamily
3QDDA 3HHUA 2GQPA 4YKQA 5JENA 2BU7A 2YEDA 1S16A 4EGIA 3HYYA 2YGAA 3G75A 4NH8A 3R92A 3H80A 4B7PA 1A4HA 2C2AA 4CWTA 4EMVA 2Q2EB 2IWSA 4XKAA 2WEQA 2WI7A 2XJGA 4QPJA 2WI5A 3A0ZA 2XK2A 4YKZA 3EHGA 4O05A 1TIDA 4FCPA 2XX5A 1UYLA 3CRKA 4GGLA 4YKRA 2O1VA 2O1WA 3K97A 4GEEA 4YKTA 4BIZA 4KSGA 4XTJA 3BM9A 5C93A 4Q20A 4WUCA 1US7A 1YSRA 3TZ2A 1UYDA 1UY8A 4MP2A 2YGEA 4GT8A 1KIJA 3A0WA 4AWOA 1Z59A 2XDLA 3G7EA 3TUHA 5M4KA 3OMUA 1QYEA 1UYHA 3HYZA 1UY9A 3CWVA 4YKXA 4URLA 3T0ZA 4V26A 3K60A 4U7OA 4XDMA 2BU6A 4ASAA 1UYGA 4EEHA 2HKJA 4FPPA 3LNUA 2XX2A 4JAVA 2FTKA 2YKEA 2Q8GA 1I5DA 1UYCA 4H85A 1EI1A 4HY6A 5F3KA 2CG9A 4UROA 3R4MA 3HZ1A 3B27A 4XE2A 1H7SA 1EA6A 1Y8OA 3WHAA 2YEJA 1YT2A 2VW5A 5BOCA 2HCHA 1IXMA 2CGFA 2YEIA 2HG1A 3TZ5A 1F51A 3EHFA 4LWEA 2JJCA 4MOTA 3S5TA 4WUDA 4L94A 1NHHA 4GCZA 3GIEA 2H55A 1R62A 2YEHA 3VADA 5M4HA 1YETA 1ZWHA 3A0YA 2WI6A 4I3HA 2ZKJA 5D6PA 2YJWA 4XD8A 4CWNA 2BU5A 2YE3A 2YEGA 3IEDA 4P8OA 3EHHA 3MNRP 5D7RA 5D7DA 1AH6A 1Z5AA 3A0RA 4BAEA 4H7QA 2BSMA 3OWDA 2BYHA 4E72A 4QPKA 1UYFA 1NHJA 1Y8PA 4MPNA 3Q5JA 3CGYA 4XIPA 4YKYA 2EXLA 3D0BA 5L3JA 4FCRA 4FMTA 3ZXOA 3PEHA 3HZ5A 4E00A 1UYIA 4XCJA 3HEKA 4L8ZA 5IDJA 1AM1A 3NMQA 2CCSA 4YKWA 4MBCA 3T10A 1YSZA 4PU9A 4DZYA 3OW6A 2YE2A 4X9LA 4CE3A 2QF6A 1ZW9A 4WUBA 4URNA 5CTWA 4XCLA 1TC0A 1BYQA 3ZM7A 1I59A 4ZKIA 3A0XA 4YKUA 3U2KA 4CWRA 2UWDA 2C1GA 3CYGA 2BU2A 2GFDA 1QZRA 2K5BA 4LPBA 4H81A 4BXIA 2BTZA 2JKIA 1Y8NA 2XHRA 2IWXA 3FV5A 3O0IA 2XCMA 4XKKA 1Y4SA 4JQLA 4EGHA 2YE7A 1KZNA 2YE5A 4E01A 5M4NA 1UYKA 1YC3A 1Z5BA 2WI1A 4LWGA 4LWFA 3C11A 3ZXQA 2VWCA 2XDKA 2YKJA 5CF0A 1TILA 2XJXA 5FNDA 3U2DA 4BQJA 5M4EA 4JASA 3R4NA 2YEBA 4CWOA 4L90A 3K99A 4AS9A 2CCUA 4URMA 1TC6A 1BGQA 1L0OA 3FT8A 4ZVIA 2QG0A 4DUHA 5J6AA 1S14A 4KQVA 1YESA 2WEPA 2AKPA 1BKNA 3R4PA 3OWBA 3VHCA 2YI6A 2WI4A 3B28A 4XITA 4CWSA 4HXWA 4O09A 1NHIA 4LWIA 1YS3A 5M4MA 2XDXA 2YK9A 3R91A 3Q5LA 2YKCA 2YI5A 4XIRA 2IWUA 2CCTA 2C1IA 2VCJA 2BZ5A 4LWHA 2YE9A 1GKZA 4V25A 2CH4A 4EM7A 3RKZA 5CPHA 5J71A 4NH9A 3B24A 4CWPA 4BQGA 4GFNA 4KTNA 4XKOA 2YE8A 2XX4A 5GGZA 2VCIA 2YEFA 3RLPA 2XJJA 3TTZA 3FT5A 3OPDA 4MP7A 3B26A 1UY7A 2WI2A 4KP4A 3T2SA 4AWQA 3BMYA 2IORA 2PNRA 4XC0A 1GJVA 2ZBKB 4ASGA 3TZ4A 2YKIA 1AMWA 2IOPA 4R1FA 4CWQA 3D2RA 3GIFA 5CTYA 1B3QA 3H4LA 2Q8IA 3VHDA 2WI3A 1JM6A 3INXA 3GIGA 4HYPA 1B63A 2QFOA 3A0TA 3RLQA 1I5CA 3C0EA 3K98A 1MX0A 1GKXA 4ASBA 2Q8HA 1UY6A 3PEJA 4I5SA 3QTFA 2BREA 3Q5KA 2YE4A 4AWPA 3B25A 3INWA 1UYEA 1I5BA 2YKBA 5F5RA 1U0ZA 4MPCA 4EFUA 2YEAA 2YI0A 3CRLA 3LPSA 3O6OA 4GQTA 4L91A 4LP0A 4KFGA 1OSFA 4ASFA 4W7TA 3LMMA 4CE1A 2YE6A 2WERA 1TH8A 1ZXMA 3CGZA 4EGKA 1YT1A 3DGEA 3KE6A 2ESAA 1THNA 4JAUA 2BYIA 4L93A 4HZ5A 1AJ6A 1UYMA 2ZDXA 2YGFA 3GIGB 4EFTA 1PVGA 4PRXA 4KSHA 5IN9A 3SL2A 5CTXA 3EKRA 4HXZA 2O1UA 4P7AA 4MPEA 4HZ0A 1B62A 2XHXA 3JZ3A 2YECA 1ID0A 2FWZA 5D6QA 2FYPA 4E02A 4B6CA 2BT0A 5CTUA 1I58A 4XIQA 2HHIA 4K4OA 1YERA 1BXDA 3R4OA 5FNFA 1YC1A 5D7CA 3T0HA 3EHJA 3T1KA 3TZ0A 3O2FA 1YC4A 3WQ9A 2QG2A 2YK2A 4MB9A 4BIUA 3ZKDA 2BRCA 2E0AA 4U7NA 5BODA 1MU5A 2XDSA 2YEEA 2ZDYA 3VHAA 1QY8A 1AH8A 1ZXNA 2XHTA 4NH7A 4CE2A 4FCQA 3U67A 1Z5CA 4PL9A 3RLRA 2XD6A 1YT0A 2YJXA 4O07A 4CWFA 4PRVA 3D36A 2Q8FA 2FXSA 1H7UA 5FNCA 5IDMA 3G7BA 1I5AA 4U93A 2YI7A 4O04A 2IOQA 3EKOA 4R3MA 4HYMA 4R3AA 3ZKBA 1TBWA 2H8MA 2BU8A 1U2OA 2XDUA 2FWYA 4HY1A 1Y4UA 2XABA 5M4PA 5FWKA 4O0BA
chains in the Genus database with same CATH topology
3QDDA 3HHUA 2GQPA 4YKQA 2BU7A 2YEDA 1S16A 4EGIA 3HYYA 2YGAA 3G75A 4NH8A 3R92A 3H80A 4B7PA 1A4HA 2C2AA 4CWTA 4EMVA 2Q2EB 2IWSA 4XKAA 2WEQA 2WI7A 2XJGA 4QPJA 2WI5A 3A0ZA 2XK2A 4YKZA 3EHGA 4O05A 1TIDA 4FCPA 2XX5A 1UYLA 3CRKA 4GGLA 4YKRA 2O1VA 2O1WA 3K97A 4GEEA 4YKTA 4BIZA 4KSGA 4XTJA 3BM9A 5C93A 4Q20A 4WUCA 1US7A 1YSRA 3TZ2A 1UYDA 1UY8A 4MP2A 2YGEA 4GT8A 1KIJA 3A0WA 4AWOA 1Z59A 2XDLA 3G7EA 3TUHA 5M4KA 3OMUA 1QYEA 1UYHA 3HYZA 1UY9A 3CWVA 4YKXA 4URLA 3T0ZA 4V26A 3K60A 4U7OA 4XDMA 2BU6A 4ASAA 1UYGA 4EEHA 2HKJA 4FPPA 3LNUA 2XX2A 4JAVA 2YKEA 2Q8GA 1I5DA 1UYCA 4H85A 1EI1A 4HY6A 5F3KA 2CG9A 4UROA 3R4MA 3HZ1A 3B27A 4XE2A 1H7SA 1EA6A 1Y8OA 3WHAA 2YEJA 1YT2A 2VW5A 5BOCA 2HCHA 2CGFA 2YEIA 2HG1A 3TZ5A 3EHFA 4LWEA 2JJCA 4MOTA 4WUDA 4L94A 1NHHA 4GCZA 3GIEA 2H55A 1R62A 2YEHA 3VADA 5M4HA 1YETA 1ZWHA 3A0YA 2WI6A 4I3HA 2ZKJA 5D6PA 2YJWA 4XD8A 4CWNA 2BU5A 2YE3A 2YEGA 3IEDA 4P8OA 3EHHA 3MNRP 5D7RA 5D7DA 1AH6A 1Z5AA 3A0RA 4BAEA 4H7QA 2BSMA 3OWDA 2BYHA 4QPKA 1UYFA 1NHJA 1Y8PA 4MPNA 3Q5JA 3CGYA 4XIPA 4YKYA 2EXLA 3D0BA 5L3JA 4FCRA 4FMTA 3ZXOA 3PEHA 3HZ5A 4E00A 1UYIA 4XCJA 3HEKA 4L8ZA 5IDJA 1AM1A 3NMQA 2CCSA 4YKWA 4MBCA 3T10A 1YSZA 4PU9A 4DZYA 3OW6A 2YE2A 4X9LA 4CE3A 2QF6A 1ZW9A 4WUBA 4URNA 5CTWA 4XCLA 1TC0A 1BYQA 3ZM7A 1I59A 4ZKIA 3A0XA 4YKUA 3U2KA 4CWRA 2UWDA 2BU2A 2GFDA 1QZRA 2K5BA 4LPBA 4H81A 4BXIA 2BTZA 2JKIA 1Y8NA 2XHRA 2IWXA 3FV5A 3O0IA 2XCMA 4XKKA 1Y4SA 4JQLA 4EGHA 2YE7A 1KZNA 2YE5A 4E01A 5M4NA 1UYKA 1YC3A 1Z5BA 2WI1A 4LWGA 4LWFA 3C11A 3ZXQA 2VWCA 2XDKA 2YKJA 5CF0A 1TILA 2XJXA 5FNDA 3U2DA 4BQJA 5M4EA 4JASA 3R4NA 2YEBA 4CWOA 4L90A 3K99A 4AS9A 2CCUA 4URMA 1TC6A 1BGQA 1L0OA 3FT8A 4ZVIA 2QG0A 4DUHA 5J6AA 1S14A 4KQVA 1YESA 2WEPA 2AKPA 1BKNA 3R4PA 3OWBA 3VHCA 2YI6A 2WI4A 3B28A 4XITA 4CWSA 4HXWA 4O09A 1NHIA 4LWIA 1YS3A 5M4MA 2XDXA 2YK9A 3R91A 3Q5LA 2YKCA 2YI5A 4XIRA 2IWUA 2CCTA 2VCJA 2BZ5A 4LWHA 2YE9A 1GKZA 4V25A 2CH4A 4EM7A 3RKZA 5CPHA 5J71A 4NH9A 3B24A 4CWPA 4BQGA 4GFNA 4KTNA 4XKOA 2YE8A 2XX4A 5GGZA 2VCIA 2YEFA 3RLPA 2XJJA 3TTZA 3FT5A 3OPDA 4MP7A 3B26A 1UY7A 2WI2A 4KP4A 3T2SA 4AWQA 3BMYA 2IORA 2PNRA 4XC0A 1GJVA 2ZBKB 4ASGA 3TZ4A 2YKIA 1AMWA 2IOPA 4R1FA 4CWQA 3D2RA 3GIFA 5CTYA 1B3QA 3H4LA 2Q8IA 3VHDA 2WI3A 1JM6A 3INXA 3GIGA 4HYPA 1B63A 2QFOA 3A0TA 3RLQA 1I5CA 3C0EA 3K98A 1MX0A 1GKXA 4ASBA 2Q8HA 1UY6A 3PEJA 4I5SA 3QTFA 2BREA 3Q5KA 2YE4A 4AWPA 3B25A 3INWA 1UYEA 1I5BA 2YKBA 5F5RA 1U0ZA 4MPCA 4EFUA 4L91A 2YEAA 2YI0A 3CRLA 3LPSA 3O6OA 4GQTA 4LP0A 4KFGA 1OSFA 4ASFA 4W7TA 4CE1A 2YE6A 2WERA 1TH8A 1ZXMA 3CGZA 4EGKA 1YT1A 3DGEA 3KE6A 2ESAA 1THNA 4JAUA 2BYIA 4L93A 4HZ5A 1AJ6A 1UYMA 2ZDXA 2YGFA 3GIGB 4EFTA 1PVGA 4PRXA 4KSHA 5IN9A 3SL2A 5CTXA 3EKRA 4HXZA 2O1UA 4P7AA 4MPEA 4HZ0A 1B62A 2XHXA 3JZ3A 2YECA 1ID0A 2FWZA 5D6QA 2FYPA 4E02A 4B6CA 2BT0A 5CTUA 1I58A 4XIQA 4K4OA 1YERA 1BXDA 3R4OA 5FNFA 1YC1A 5D7CA 3T0HA 3EHJA 3T1KA 3TZ0A 3O2FA 1YC4A 3WQ9A 2QG2A 2YK2A 4MB9A 4BIUA 3ZKDA 2BRCA 2E0AA 4U7NA 5BODA 1MU5A 2XDSA 2YEEA 2ZDYA 3VHAA 1QY8A 1AH8A 1ZXNA 2XHTA 4NH7A 4CE2A 4FCQA 3U67A 1Z5CA 4PL9A 3RLRA 2XD6A 1YT0A 2YJXA 4O07A 4CWFA 4PRVA 3D36A 2Q8FA 2FXSA 1H7UA 5FNCA 5IDMA 3G7BA 1I5AA 4U93A 2YI7A 4O04A 2IOQA 3EKOA 4R3MA 4HYMA 4R3AA 3ZKBA 1TBWA 2H8MA 2BU8A 1U2OA 2XDUA 2FWYA 4HY1A 1Y4UA 2XABA 5M4PA 5FWKA 4O0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QDD A;  3HHU A;  2GQP A;  4YKQ A;  2BU7 A;  2YED A;  1S16 A;  4EGI A;  3HYY A;  2YGA A;  3G75 A;  4NH8 A;  3R92 A;  3H80 A;  4B7P A;  1A4H A;  2C2A A;  4CWT A;  4EMV A;  2Q2E B;  2IWS A;  4XKA A;  2WEQ A;  2WI7 A;  2XJG A;  4QPJ A;  2WI5 A;  3A0Z A;  2XK2 A;  4YKZ A;  3EHG A;  4O05 A;  1TID A;  4FCP A;  2XX5 A;  1UYL A;  3CRK A;  4GGL A;  4YKR A;  2O1V A;  2O1W A;  3K97 A;  4GEE A;  4YKT A;  4BIZ A;  4KSG A;  4XTJ A;  3BM9 A;  5C93 A;  4Q20 A;  4WUC A;  1US7 A;  1YSR A;  3TZ2 A;  1UYD A;  1UY8 A;  4MP2 A;  2YGE A;  4GT8 A;  1KIJ A;  3A0W A;  4AWO A;  1Z59 A;  2XDL A;  3G7E A;  3TUH A;  5M4K A;  3OMU A;  1QYE A;  1UYH A;  3HYZ A;  1UY9 A;  3CWV A;  4YKX A;  4URL A;  3T0Z A;  4V26 A;  3K60 A;  4U7O A;  4XDM A;  2BU6 A;  4ASA A;  1UYG A;  4EEH A;  2HKJ A;  4FPP A;  3LNU A;  2XX2 A;  4JAV A;  2YKE A;  2Q8G A;  1I5D A;  1UYC A;  4H85 A;  1EI1 A;  4HY6 A;  5F3K A;  2CG9 A;  4URO A;  3R4M A;  3HZ1 A;  3B27 A;  4XE2 A;  1H7S A;  1EA6 A;  1Y8O A;  3WHA A;  2YEJ A;  1YT2 A;  2VW5 A;  5BOC A;  2HCH A;  2CGF A;  2YEI A;  2HG1 A;  3TZ5 A;  3EHF A;  4LWE A;  2JJC A;  4MOT A;  4WUD A;  4L94 A;  1NHH A;  4GCZ A;  3GIE A;  2H55 A;  1R62 A;  2YEH A;  3VAD A;  5M4H A;  1YET A;  1ZWH A;  3A0Y A;  2WI6 A;  4I3H A;  2ZKJ A;  5D6P A;  2YJW A;  4XD8 A;  4CWN A;  2BU5 A;  2YE3 A;  2YEG A;  3IED A;  4P8O A;  3EHH A;  3MNR P;  5D7R A;  5D7D A;  1AH6 A;  1Z5A A;  3A0R A;  4BAE A;  4H7Q A;  2BSM A;  3OWD A;  2BYH A;  4QPK A;  1UYF A;  1NHJ A;  1Y8P A;  4MPN A;  3Q5J A;  3CGY A;  4XIP A;  4YKY A;  2EXL A;  3D0B A;  5L3J A;  4FCR A;  4FMT A;  3ZXO A;  3PEH A;  3HZ5 A;  4E00 A;  1UYI A;  4XCJ A;  3HEK A;  4L8Z A;  5IDJ A;  1AM1 A;  3NMQ A;  2CCS A;  4YKW A;  4MBC A;  3T10 A;  1YSZ A;  4PU9 A;  4DZY A;  3OW6 A;  2YE2 A;  4X9L A;  4CE3 A;  2QF6 A;  1ZW9 A;  4WUB A;  4URN A;  5CTW A;  4XCL A;  1TC0 A;  1BYQ A;  3ZM7 A;  1I59 A;  4ZKI A;  3A0X A;  4YKU A;  3U2K A;  4CWR A;  2UWD A;  2BU2 A;  2GFD A;  1QZR A;  2K5B A;  4LPB A;  4H81 A;  4BXI A;  2BTZ A;  2JKI A;  1Y8N A;  2XHR A;  2IWX A;  3FV5 A;  3O0I A;  2XCM A;  4XKK A;  1Y4S A;  4JQL A;  4EGH A;  2YE7 A;  1KZN A;  2YE5 A;  4E01 A;  5M4N A;  1UYK A;  1YC3 A;  1Z5B A;  2WI1 A;  4LWG A;  4LWF A;  3C11 A;  3ZXQ A;  2VWC A;  2XDK A;  2YKJ A;  5CF0 A;  1TIL A;  2XJX A;  5FND A;  3U2D A;  4BQJ A;  5M4E A;  4JAS A;  3R4N A;  2YEB A;  4CWO A;  4L90 A;  3K99 A;  4AS9 A;  2CCU A;  4URM A;  1TC6 A;  1BGQ A;  1L0O A;  3FT8 A;  4ZVI A;  2QG0 A;  4DUH A;  5J6A A;  1S14 A;  4KQV A;  1YES A;  2WEP A;  2AKP A;  1BKN A;  3R4P A;  3OWB A;  3VHC A;  2YI6 A;  2WI4 A;  3B28 A;  4XIT A;  4CWS A;  4HXW A;  4O09 A;  1NHI A;  4LWI A;  1YS3 A;  5M4M A;  2XDX A;  2YK9 A;  3R91 A;  3Q5L A;  2YKC A;  2YI5 A;  4XIR A;  2IWU A;  2CCT A;  2VCJ A;  2BZ5 A;  4LWH A;  2YE9 A;  1GKZ A;  4V25 A;  2CH4 A;  4EM7 A;  3RKZ A;  5CPH A;  5J71 A;  4NH9 A;  3B24 A;  4CWP A;  4BQG A;  4GFN A;  4KTN A;  4XKO A;  2YE8 A;  2XX4 A;  5GGZ A;  2VCI A;  2YEF A;  3RLP A;  2XJJ A;  3TTZ A;  3FT5 A;  3OPD A;  4MP7 A;  3B26 A;  1UY7 A;  2WI2 A;  4KP4 A;  3T2S A;  4AWQ A;  3BMY A;  2IOR A;  2PNR A;  4XC0 A;  1GJV A;  2ZBK B;  4ASG A;  3TZ4 A;  2YKI A;  1AMW A;  2IOP A;  4R1F A;  4CWQ A;  3D2R A;  3GIF A;  5CTY A;  1B3Q A;  3H4L A;  2Q8I A;  3VHD A;  2WI3 A;  1JM6 A;  3INX A;  3GIG A;  4HYP A;  1B63 A;  2QFO A;  3A0T A;  3RLQ A;  1I5C A;  3C0E A;  3K98 A;  1MX0 A;  1GKX A;  4ASB A;  2Q8H A;  1UY6 A;  3PEJ A;  4I5S A;  3QTF A;  2BRE A;  3Q5K A;  2YE4 A;  4AWP A;  3B25 A;  3INW A;  1UYE A;  1I5B A;  2YKB A;  5F5R A;  1U0Z A;  4MPC A;  4EFU A;  4L91 A;  2YEA A;  2YI0 A;  3CRL A;  3LPS A;  3O6O A;  4GQT A;  4LP0 A;  4KFG A;  1OSF A;  4ASF A;  4W7T A;  4CE1 A;  2YE6 A;  2WER A;  1TH8 A;  1ZXM A;  3CGZ A;  4EGK A;  1YT1 A;  3DGE A;  3KE6 A;  2ESA A;  1THN A;  4JAU A;  2BYI A;  4L93 A;  4HZ5 A;  1AJ6 A;  1UYM A;  2ZDX A;  2YGF A;  3GIG B;  4EFT A;  1PVG A;  4PRX A;  4KSH A;  5IN9 A;  3SL2 A;  5CTX A;  3EKR A;  4HXZ A;  2O1U A;  4P7A A;  4MPE A;  4HZ0 A;  1B62 A;  2XHX A;  3JZ3 A;  2YEC A;  1ID0 A;  2FWZ A;  5D6Q A;  2FYP A;  4E02 A;  4B6C A;  2BT0 A;  5CTU A;  1I58 A;  4XIQ A;  4K4O A;  1YER A;  1BXD A;  3R4O A;  5FNF A;  1YC1 A;  5D7C A;  3T0H A;  3EHJ A;  3T1K A;  3TZ0 A;  3O2F A;  1YC4 A;  3WQ9 A;  2QG2 A;  2YK2 A;  4MB9 A;  4BIU A;  3ZKD A;  2BRC A;  2E0A A;  4U7N A;  5BOD A;  1MU5 A;  2XDS A;  2YEE A;  2ZDY A;  3VHA A;  1QY8 A;  1AH8 A;  1ZXN A;  2XHT A;  4NH7 A;  4CE2 A;  4FCQ A;  3U67 A;  1Z5C A;  4PL9 A;  3RLR A;  2XD6 A;  1YT0 A;  2YJX A;  4O07 A;  4CWF A;  4PRV A;  3D36 A;  2Q8F A;  2FXS A;  1H7U A;  5FNC A;  5IDM A;  3G7B A;  1I5A A;  4U93 A;  2YI7 A;  4O04 A;  2IOQ A;  3EKO A;  4R3M A;  4HYM A;  4R3A A;  3ZKB A;  1TBW A;  2H8M A;  2BU8 A;  1U2O A;  2XDU A;  2FWY A;  4HY1 A;  1Y4U A;  2XAB A;  5M4P A;  5FWK A;  4O0B A; 
#chains in the Genus database with same CATH topology
 3QDD A;  3HHU A;  2GQP A;  4YKQ A;  5JEN A;  2BU7 A;  2YED A;  1S16 A;  4EGI A;  3HYY A;  2YGA A;  3G75 A;  4NH8 A;  3R92 A;  3H80 A;  4B7P A;  1A4H A;  2C2A A;  4CWT A;  4EMV A;  2Q2E B;  2IWS A;  4XKA A;  2WEQ A;  2WI7 A;  2XJG A;  4QPJ A;  2WI5 A;  3A0Z A;  2XK2 A;  4YKZ A;  3EHG A;  4O05 A;  1TID A;  4FCP A;  2XX5 A;  1UYL A;  3CRK A;  4GGL A;  4YKR A;  2O1V A;  2O1W A;  3K97 A;  4GEE A;  4YKT A;  4BIZ A;  4KSG A;  4XTJ A;  3BM9 A;  5C93 A;  4Q20 A;  4WUC A;  1US7 A;  1YSR A;  3TZ2 A;  1UYD A;  1UY8 A;  4MP2 A;  2YGE A;  4GT8 A;  1KIJ A;  3A0W A;  4AWO A;  1Z59 A;  2XDL A;  3G7E A;  3TUH A;  5M4K A;  3OMU A;  1QYE A;  1UYH A;  3HYZ A;  1UY9 A;  3CWV A;  4YKX A;  4URL A;  3T0Z A;  4V26 A;  3K60 A;  4U7O A;  4XDM A;  2BU6 A;  4ASA A;  1UYG A;  4EEH A;  2HKJ A;  4FPP A;  3LNU A;  2XX2 A;  4JAV A;  2FTK A;  2YKE A;  2Q8G A;  1I5D A;  1UYC A;  4H85 A;  1EI1 A;  4HY6 A;  5F3K A;  2CG9 A;  4URO A;  3R4M A;  3HZ1 A;  3B27 A;  4XE2 A;  1H7S A;  1EA6 A;  1Y8O A;  3WHA A;  2YEJ A;  1YT2 A;  2VW5 A;  5BOC A;  2HCH A;  1IXM A;  2CGF A;  2YEI A;  2HG1 A;  3TZ5 A;  1F51 A;  3EHF A;  4LWE A;  2JJC A;  4MOT A;  3S5T A;  4WUD A;  4L94 A;  1NHH A;  4GCZ A;  3GIE A;  2H55 A;  1R62 A;  2YEH A;  3VAD A;  5M4H A;  1YET A;  1ZWH A;  3A0Y A;  2WI6 A;  4I3H A;  2ZKJ A;  5D6P A;  2YJW A;  4XD8 A;  4CWN A;  2BU5 A;  2YE3 A;  2YEG A;  3IED A;  4P8O A;  3EHH A;  3MNR P;  5D7R A;  5D7D A;  1AH6 A;  1Z5A A;  3A0R A;  4BAE A;  4H7Q A;  2BSM A;  3OWD A;  2BYH A;  4E72 A;  4QPK A;  1UYF A;  1NHJ A;  1Y8P A;  4MPN A;  3Q5J A;  3CGY A;  4XIP A;  4YKY A;  2EXL A;  3D0B A;  5L3J A;  4FCR A;  4FMT A;  3ZXO A;  3PEH A;  3HZ5 A;  4E00 A;  1UYI A;  4XCJ A;  3HEK A;  4L8Z A;  5IDJ A;  1AM1 A;  3NMQ A;  2CCS A;  4YKW A;  4MBC A;  3T10 A;  1YSZ A;  4PU9 A;  4DZY A;  3OW6 A;  2YE2 A;  4X9L A;  4CE3 A;  2QF6 A;  1ZW9 A;  4WUB A;  4URN A;  5CTW A;  4XCL A;  1TC0 A;  1BYQ A;  3ZM7 A;  1I59 A;  4ZKI A;  3A0X A;  4YKU A;  3U2K A;  4CWR A;  2UWD A;  2C1G A;  3CYG A;  2BU2 A;  2GFD A;  1QZR A;  2K5B A;  4LPB A;  4H81 A;  4BXI A;  2BTZ A;  2JKI A;  1Y8N A;  2XHR A;  2IWX A;  3FV5 A;  3O0I A;  2XCM A;  4XKK A;  1Y4S A;  4JQL A;  4EGH A;  2YE7 A;  1KZN A;  2YE5 A;  4E01 A;  5M4N A;  1UYK A;  1YC3 A;  1Z5B A;  2WI1 A;  4LWG A;  4LWF A;  3C11 A;  3ZXQ A;  2VWC A;  2XDK A;  2YKJ A;  5CF0 A;  1TIL A;  2XJX A;  5FND A;  3U2D A;  4BQJ A;  5M4E A;  4JAS A;  3R4N A;  2YEB A;  4CWO A;  4L90 A;  3K99 A;  4AS9 A;  2CCU A;  4URM A;  1TC6 A;  1BGQ A;  1L0O A;  3FT8 A;  4ZVI A;  2QG0 A;  4DUH A;  5J6A A;  1S14 A;  4KQV A;  1YES A;  2WEP A;  2AKP A;  1BKN A;  3R4P A;  3OWB A;  3VHC A;  2YI6 A;  2WI4 A;  3B28 A;  4XIT A;  4CWS A;  4HXW A;  4O09 A;  1NHI A;  4LWI A;  1YS3 A;  5M4M A;  2XDX A;  2YK9 A;  3R91 A;  3Q5L A;  2YKC A;  2YI5 A;  4XIR A;  2IWU A;  2CCT A;  2C1I A;  2VCJ A;  2BZ5 A;  4LWH A;  2YE9 A;  1GKZ A;  4V25 A;  2CH4 A;  4EM7 A;  3RKZ A;  5CPH A;  5J71 A;  4NH9 A;  3B24 A;  4CWP A;  4BQG A;  4GFN A;  4KTN A;  4XKO A;  2YE8 A;  2XX4 A;  5GGZ A;  2VCI A;  2YEF A;  3RLP A;  2XJJ A;  3TTZ A;  3FT5 A;  3OPD A;  4MP7 A;  3B26 A;  1UY7 A;  2WI2 A;  4KP4 A;  3T2S A;  4AWQ A;  3BMY A;  2IOR A;  2PNR A;  4XC0 A;  1GJV A;  2ZBK B;  4ASG A;  3TZ4 A;  2YKI A;  1AMW A;  2IOP A;  4R1F A;  4CWQ A;  3D2R A;  3GIF A;  5CTY A;  1B3Q A;  3H4L A;  2Q8I A;  3VHD A;  2WI3 A;  1JM6 A;  3INX A;  3GIG A;  4HYP A;  1B63 A;  2QFO A;  3A0T A;  3RLQ A;  1I5C A;  3C0E A;  3K98 A;  1MX0 A;  1GKX A;  4ASB A;  2Q8H A;  1UY6 A;  3PEJ A;  4I5S A;  3QTF A;  2BRE A;  3Q5K A;  2YE4 A;  4AWP A;  3B25 A;  3INW A;  1UYE A;  1I5B A;  2YKB A;  5F5R A;  1U0Z A;  4MPC A;  4EFU A;  2YEA A;  2YI0 A;  3CRL A;  3LPS A;  3O6O A;  4GQT A;  4L91 A;  4LP0 A;  4KFG A;  1OSF A;  4ASF A;  4W7T A;  3LMM A;  4CE1 A;  2YE6 A;  2WER A;  1TH8 A;  1ZXM A;  3CGZ A;  4EGK A;  1YT1 A;  3DGE A;  3KE6 A;  2ESA A;  1THN A;  4JAU A;  2BYI A;  4L93 A;  4HZ5 A;  1AJ6 A;  1UYM A;  2ZDX A;  2YGF A;  3GIG B;  4EFT A;  1PVG A;  4PRX A;  4KSH A;  5IN9 A;  3SL2 A;  5CTX A;  3EKR A;  4HXZ A;  2O1U A;  4P7A A;  4MPE A;  4HZ0 A;  1B62 A;  2XHX A;  3JZ3 A;  2YEC A;  1ID0 A;  2FWZ A;  5D6Q A;  2FYP A;  4E02 A;  4B6C A;  2BT0 A;  5CTU A;  1I58 A;  4XIQ A;  2HHI A;  4K4O A;  1YER A;  1BXD A;  3R4O A;  5FNF A;  1YC1 A;  5D7C A;  3T0H A;  3EHJ A;  3T1K A;  3TZ0 A;  3O2F A;  1YC4 A;  3WQ9 A;  2QG2 A;  2YK2 A;  4MB9 A;  4BIU A;  3ZKD A;  2BRC A;  2E0A A;  4U7N A;  5BOD A;  1MU5 A;  2XDS A;  2YEE A;  2ZDY A;  3VHA A;  1QY8 A;  1AH8 A;  1ZXN A;  2XHT A;  4NH7 A;  4CE2 A;  4FCQ A;  3U67 A;  1Z5C A;  4PL9 A;  3RLR A;  2XD6 A;  1YT0 A;  2YJX A;  4O07 A;  4CWF A;  4PRV A;  3D36 A;  2Q8F A;  2FXS A;  1H7U A;  5FNC A;  5IDM A;  3G7B A;  1I5A A;  4U93 A;  2YI7 A;  4O04 A;  2IOQ A;  3EKO A;  4R3M A;  4HYM A;  4R3A A;  3ZKB A;  1TBW A;  2H8M A;  2BU8 A;  1U2O A;  2XDU A;  2FWY A;  4HY1 A;  1Y4U A;  2XAB A;  5M4P A;  5FWK A;  4O0B A; 
#chains in the Genus database with same CATH homology
 3QDD A;  3HHU A;  2GQP A;  4YKQ A;  2BU7 A;  2YED A;  1S16 A;  4EGI A;  3HYY A;  2YGA A;  3G75 A;  4NH8 A;  3R92 A;  3H80 A;  4B7P A;  1A4H A;  2C2A A;  4CWT A;  4EMV A;  2Q2E B;  2IWS A;  4XKA A;  2WEQ A;  2WI7 A;  2XJG A;  4QPJ A;  2WI5 A;  3A0Z A;  2XK2 A;  4YKZ A;  3EHG A;  4O05 A;  1TID A;  4FCP A;  2XX5 A;  1UYL A;  3CRK A;  4GGL A;  4YKR A;  2O1V A;  2O1W A;  3K97 A;  4GEE A;  4YKT A;  4BIZ A;  4KSG A;  4XTJ A;  3BM9 A;  5C93 A;  4Q20 A;  4WUC A;  1US7 A;  1YSR A;  3TZ2 A;  1UYD A;  1UY8 A;  4MP2 A;  2YGE A;  4GT8 A;  1KIJ A;  3A0W A;  4AWO A;  1Z59 A;  2XDL A;  3G7E A;  3TUH A;  5M4K A;  3OMU A;  1QYE A;  1UYH A;  3HYZ A;  1UY9 A;  3CWV A;  4YKX A;  4URL A;  3T0Z A;  4V26 A;  3K60 A;  4U7O A;  4XDM A;  2BU6 A;  4ASA A;  1UYG A;  4EEH A;  2HKJ A;  4FPP A;  3LNU A;  2XX2 A;  4JAV A;  2YKE A;  2Q8G A;  1I5D A;  1UYC A;  4H85 A;  1EI1 A;  4HY6 A;  5F3K A;  2CG9 A;  4URO A;  3R4M A;  3HZ1 A;  3B27 A;  4XE2 A;  1H7S A;  1EA6 A;  1Y8O A;  3WHA A;  2YEJ A;  1YT2 A;  2VW5 A;  5BOC A;  2HCH A;  2CGF A;  2YEI A;  2HG1 A;  3TZ5 A;  3EHF A;  4LWE A;  2JJC A;  4MOT A;  4WUD A;  4L94 A;  1NHH A;  4GCZ A;  3GIE A;  2H55 A;  1R62 A;  2YEH A;  3VAD A;  5M4H A;  1YET A;  1ZWH A;  3A0Y A;  2WI6 A;  4I3H A;  2ZKJ A;  5D6P A;  2YJW A;  4XD8 A;  4CWN A;  2BU5 A;  2YE3 A;  2YEG A;  3IED A;  4P8O A;  3EHH A;  3MNR P;  5D7R A;  5D7D A;  1AH6 A;  1Z5A A;  3A0R A;  4BAE A;  4H7Q A;  2BSM A;  3OWD A;  2BYH A;  4QPK A;  1UYF A;  1NHJ A;  1Y8P A;  4MPN A;  3Q5J A;  3CGY A;  4XIP A;  4YKY A;  2EXL A;  3D0B A;  5L3J A;  4FCR A;  4FMT A;  3ZXO A;  3PEH A;  3HZ5 A;  4E00 A;  1UYI A;  4XCJ A;  3HEK A;  4L8Z A;  5IDJ A;  1AM1 A;  3NMQ A;  2CCS A;  4YKW A;  4MBC A;  3T10 A;  1YSZ A;  4PU9 A;  4DZY A;  3OW6 A;  2YE2 A;  4X9L A;  4CE3 A;  2QF6 A;  1ZW9 A;  4WUB A;  4URN A;  5CTW A;  4XCL A;  1TC0 A;  1BYQ A;  3ZM7 A;  1I59 A;  4ZKI A;  3A0X A;  4YKU A;  3U2K A;  4CWR A;  2UWD A;  2BU2 A;  2GFD A;  1QZR A;  2K5B A;  4LPB A;  4H81 A;  4BXI A;  2BTZ A;  2JKI A;  1Y8N A;  2XHR A;  2IWX A;  3FV5 A;  3O0I A;  2XCM A;  4XKK A;  1Y4S A;  4JQL A;  4EGH A;  2YE7 A;  1KZN A;  2YE5 A;  4E01 A;  5M4N A;  1UYK A;  1YC3 A;  1Z5B A;  2WI1 A;  4LWG A;  4LWF A;  3C11 A;  3ZXQ A;  2VWC A;  2XDK A;  2YKJ A;  5CF0 A;  1TIL A;  2XJX A;  5FND A;  3U2D A;  4BQJ A;  5M4E A;  4JAS A;  3R4N A;  2YEB A;  4CWO A;  4L90 A;  3K99 A;  4AS9 A;  2CCU A;  4URM A;  1TC6 A;  1BGQ A;  1L0O A;  3FT8 A;  4ZVI A;  2QG0 A;  4DUH A;  5J6A A;  1S14 A;  4KQV A;  1YES A;  2WEP A;  2AKP A;  1BKN A;  3R4P A;  3OWB A;  3VHC A;  2YI6 A;  2WI4 A;  3B28 A;  4XIT A;  4CWS A;  4HXW A;  4O09 A;  1NHI A;  4LWI A;  1YS3 A;  5M4M A;  2XDX A;  2YK9 A;  3R91 A;  3Q5L A;  2YKC A;  2YI5 A;  4XIR A;  2IWU A;  2CCT A;  2VCJ A;  2BZ5 A;  4LWH A;  2YE9 A;  1GKZ A;  4V25 A;  2CH4 A;  4EM7 A;  3RKZ A;  5CPH A;  5J71 A;  4NH9 A;  3B24 A;  4CWP A;  4BQG A;  4GFN A;  4KTN A;  4XKO A;  2YE8 A;  2XX4 A;  5GGZ A;  2VCI A;  2YEF A;  3RLP A;  2XJJ A;  3TTZ A;  3FT5 A;  3OPD A;  4MP7 A;  3B26 A;  1UY7 A;  2WI2 A;  4KP4 A;  3T2S A;  4AWQ A;  3BMY A;  2IOR A;  2PNR A;  4XC0 A;  1GJV A;  2ZBK B;  4ASG A;  3TZ4 A;  2YKI A;  1AMW A;  2IOP A;  4R1F A;  4CWQ A;  3D2R A;  3GIF A;  5CTY A;  1B3Q A;  3H4L A;  2Q8I A;  3VHD A;  2WI3 A;  1JM6 A;  3INX A;  3GIG A;  4HYP A;  1B63 A;  2QFO A;  3A0T A;  3RLQ A;  1I5C A;  3C0E A;  3K98 A;  1MX0 A;  1GKX A;  4ASB A;  2Q8H A;  1UY6 A;  3PEJ A;  4I5S A;  3QTF A;  2BRE A;  3Q5K A;  2YE4 A;  4AWP A;  3B25 A;  3INW A;  1UYE A;  1I5B A;  2YKB A;  5F5R A;  1U0Z A;  4MPC A;  4EFU A;  4L91 A;  2YEA A;  2YI0 A;  3CRL A;  3LPS A;  3O6O A;  4GQT A;  4LP0 A;  4KFG A;  1OSF A;  4ASF A;  4W7T A;  4CE1 A;  2YE6 A;  2WER A;  1TH8 A;  1ZXM A;  3CGZ A;  4EGK A;  1YT1 A;  3DGE A;  3KE6 A;  2ESA A;  1THN A;  4JAU A;  2BYI A;  4L93 A;  4HZ5 A;  1AJ6 A;  1UYM A;  2ZDX A;  2YGF A;  3GIG B;  4EFT A;  1PVG A;  4PRX A;  4KSH A;  5IN9 A;  3SL2 A;  5CTX A;  3EKR A;  4HXZ A;  2O1U A;  4P7A A;  4MPE A;  4HZ0 A;  1B62 A;  2XHX A;  3JZ3 A;  2YEC A;  1ID0 A;  2FWZ A;  5D6Q A;  2FYP A;  4E02 A;  4B6C A;  2BT0 A;  5CTU A;  1I58 A;  4XIQ A;  4K4O A;  1YER A;  1BXD A;  3R4O A;  5FNF A;  1YC1 A;  5D7C A;  3T0H A;  3EHJ A;  3T1K A;  3TZ0 A;  3O2F A;  1YC4 A;  3WQ9 A;  2QG2 A;  2YK2 A;  4MB9 A;  4BIU A;  3ZKD A;  2BRC A;  2E0A A;  4U7N A;  5BOD A;  1MU5 A;  2XDS A;  2YEE A;  2ZDY A;  3VHA A;  1QY8 A;  1AH8 A;  1ZXN A;  2XHT A;  4NH7 A;  4CE2 A;  4FCQ A;  3U67 A;  1Z5C A;  4PL9 A;  3RLR A;  2XD6 A;  1YT0 A;  2YJX A;  4O07 A;  4CWF A;  4PRV A;  3D36 A;  2Q8F A;  2FXS A;  1H7U A;  5FNC A;  5IDM A;  3G7B A;  1I5A A;  4U93 A;  2YI7 A;  4O04 A;  2IOQ A;  3EKO A;  4R3M A;  4HYM A;  4R3A A;  3ZKB A;  1TBW A;  2H8M A;  2BU8 A;  1U2O A;  2XDU A;  2FWY A;  4HY1 A;  1Y4U A;  2XAB A;  5M4P A;  5FWK A;  4O0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...