2GQPA

N-domain of grp94 in complex with the novel ligand n-propyl carboxyamido adenosine
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
236
structure length
209
Chain Sequence
b'GSHMLREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTITSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTVWDWELMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin
publication title Adensine Scaffold inhibitors of GRP94
rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
total genus 65
structure length 209
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2gqpA00
2WI5A 2BZ5A 2O1UA 4P8OA 3QDDA 4MPEA 3R4MA 2ZKJA 4YKUA 1YT1A 3IEDA 4EFUA 4HXZA 4BQGA 2YEBA 3RKZA 2YK9A 4LP0A 4LWGA 4XIPA 2WI7A 4URNA 3H4LA 4NH7A 1YERA 5M4EA 3U2KA 1AJ6A 3D36A 3R92A 3T2SA 4GGLA 2YK2A 3TZ4A 4CWOA 3PEHA 2BYHA 4XCLA 2YJWA 3D0BA 4FCRA 1MX0A 2XX2A 3O2FA 4YKRA 2XJGA 4XIQA 4KP4A 5BODA 2WI2A 3TTZA 3WQ9A 2VCJA 3O6OA 4FMTA 2FYPA 1I58A 3T10A 1NHHA 4XTJA 2Q8HA 2VCIA 2XX5A 2IOPA 2IWSA 3O0IA 2YJXA 4XKAA 2YE3A 1US7A 4GCZA 2YI0A 5IDMA 2XABA 2YEDA 1Y4SA 1I5AA 3HZ5A 4BAEA 3A0RA 1ZXNA 4MPNA 2YEJA 3EHHA 3HYZA 4WUBA 4O09A 3U67A 2H8MA 1U0ZA 2Q8GA 5M4KA 2BSMA 3LNUA 3FT5A 3BMYA 4LWEA 3ZKDA 4EGKA 3EHGA 1QYEA 3ZM7A 3ZXOA 4ASAA 2YKIA 1GKZA 1GJVA 3CGYA 4MPCA 4CWTA 1YC4A 1Z5AA 5J6AA 3R91A 4L93A 4H85A 2GQPA 1I5CA 4ASBA 3A0ZA 3FT8A 4LPBA 4MOTA 4E02A 1H7UA 3G7EA 2IWXA 4H7QA 4EFTA 4KFGA 1ID0A 3TUHA 3CRKA 3A0TA 1YT0A 4E01A 2VWCA 2YE8A 3OPDA 2BTZA 3RLQA 4YKZA 2Q8FA 1QY8A 4E00A 1H7SA 1AH8A 1QZRA 4FCQA 4YKWA 4I3HA 2CCUA 4DUHA 4CE1A 1BXDA 3OW6A 4AS9A 4YKYA 4MP7A 4V26A 3D2RA 1UYDA 3H80A 2O1WA 5M4HA 3K98A 5F5RA 2BU7A 4BIUA 4URLA 4CWQA 2CCSA 5CTYA 3KE6A 4YKQA 3C11A 4AWOA 2Q2EB 2WEQA 1UYLA 4B7PA 1MU5A 4JAUA 4L94A 5GGZA 2CCTA 4MB9A 4H81A 4PL9A 1I5BA 3BM9A 4R1FA 1YC1A 4HYPA 2ZBKB 3A0WA 3Q5KA 5FNCA 4QPKA 3T1KA 3SL2A 3GIGB 2YEGA 1TC6A 4CWSA 3R4NA 4U7OA 4O07A 1YC3A 3TZ2A 3LPSA 2VW5A 4PRVA 5C93A 1Y8OA 2YGEA 1GKXA 5F3KA 1Y4UA 4FPPA 2YE2A 2XDLA 2YKJA 3Q5JA 1UYFA 4HY6A 3HHUA 4V25A 1UY6A 4JAVA 2WI4A 2YKCA 3GIGA 3K97A 1UYEA 2XJXA 4WUCA 4WUDA 2WI3A 2BU8A 4P7AA 3Q5LA 4JASA 4UROA 4XCJA 4KSHA 1U2OA 2IORA 2IWUA 4O04A 1I5DA 3K60A 2E0AA 1NHJA 3FV5A 5CTWA 3B28A 4XE2A 2HCHA 1NHIA 1YT2A 4PRXA 4U7NA 1AM1A 4CWRA 2XX4A 2IOQA 4CE2A 4L91A 2FXSA 5M4PA 3VHCA 2CH4A 2GFDA 4GT8A 4GEEA 1TIDA 2BU2A 2HG1A 4L90A 2Q8IA 1PVGA 1BKNA 1BYQA 1OSFA 2YGFA 4L8ZA 4XC0A 2QG2A 3OWBA 1Z5CA 2BREA 5FNFA 2UWDA 2XDXA 4XKOA 5IDJA 2BRCA 3B25A 5D6PA 1UY8A 1TH8A 2QFOA 2XD6A 1UYHA 5CTUA 2XDKA 4HY1A 1THNA 5CTXA 1S16A 1UY9A 2WEPA 1EA6A 2CG9A 3EKOA 1Y8NA 4ASFA 4EGIA 4LWFA 3VADA 4XIRA 2XK2A 4XDMA 4XD8A 5M4NA 3G75A 4GQTA 3ZKBA 5BOCA 2BYIA 3QTFA 3A0YA 4HZ5A 4KQVA 1TILA 2O1VA 3CWVA 4Q20A 1BGQA 2ZDYA 5FNDA 3T0HA 1I59A 1B3QA 2JJCA 1YSZA 3CGZA 2YE6A 4B6CA 4HZ0A 4W7TA 2YE5A 2K5BA 2PNRA 3HZ1A 1B62A 4CWNA 5D7RA 1UYCA 2XHRA 2C2AA 2QG0A 2XDSA 4JQLA 3HYYA 2YE7A 4R3MA 4XKKA 1JM6A 3VHAA 2XHXA 2YEAA 3NMQA 2QF6A 3B27A 2ZDXA 4URMA 5D7CA 3ZXQA 1KIJA 2WI1A 3EHJA 3G7BA 4KTNA 4NH9A 2YE9A 4XITA 5D6QA 5D7DA 1AMWA 2WI6A 2JKIA 1YESA 1ZW9A 3GIFA 3EKRA 3HEKA 4LWHA 4MP2A 5L3JA 4HXWA 2XCMA 1UYIA 4YKTA 3T0ZA 1B63A 1UYMA 3DGEA 1YSRA 4KSGA 1UY7A 5CPHA 4EGHA 2YKEA 4BIZA 3TZ0A 1R62A 2YEHA 3OMUA 1YS3A 4AWQA 4MBCA 3PEJA 4O05A 2YEIA 4O0BA 1Z59A 2XDUA 3K99A 1UYKA 1ZWHA 2YI5A 3A0XA 3EHFA 3B26A 4EEHA 2ESAA 3INWA 4HYMA 4BQJA 2AKPA 2FWYA 5CF0A 3RLRA 2XJJA 4PU9A 3R4PA 1UYGA 3WHAA 2CGFA 2BU6A 2YGAA 4ZKIA 2EXLA 3OWDA 2YE4A 1A4HA 2H55A 4YKXA 4AWPA 4BXIA 2FWZA 1ZXMA 4ZVIA 4LWIA 4NH8A 4QPJA 1YETA 1S14A 2HKJA 4EM7A 3GIEA 5J71A 4CE3A 1AH6A 3INXA 2YEEA 3U2DA 1TC0A 4R3AA 2YECA 2XHTA 4CWPA 4GFNA 4ASGA 4EMVA 3R4OA 1Y8PA 4X9LA 2YI7A 1Z5BA 3VHDA 1KZNA 4CWFA 2YI6A 4FCPA 2YEFA 2WERA 2YKBA 5IN9A 2BU5A 4I5SA 4U93A 3C0EA 4DZYA 1EI1A 3B24A 5FWKA 3JZ3A 4K4OA 3RLPA 2BT0A 5M4MA 3TZ5A 1L0OA 3CRLA 1TBWA 3MNRP
chains in the Genus database with same CATH superfamily
2WI5A 2BZ5A 2O1UA 4P8OA 3QDDA 4MPEA 3R4MA 2ZKJA 4YKUA 1YT1A 3IEDA 4EFUA 4HXZA 4BQGA 2YEBA 3RKZA 2YK9A 4LP0A 4LWGA 4XIPA 2WI7A 4URNA 3H4LA 4NH7A 1YERA 5M4EA 3U2KA 1AJ6A 3D36A 3R92A 3T2SA 4GGLA 2YK2A 3TZ4A 4CWOA 3PEHA 2BYHA 4XCLA 2YJWA 3D0BA 4FCRA 1MX0A 2XX2A 3O2FA 4YKRA 2XJGA 4XIQA 4KP4A 5BODA 2WI2A 3TTZA 3WQ9A 2VCJA 3O6OA 4FMTA 2FYPA 1I58A 3T10A 1NHHA 4XTJA 2Q8HA 2VCIA 2XX5A 2IOPA 2IWSA 3O0IA 2YJXA 4XKAA 2YE3A 1US7A 4GCZA 2YI0A 5IDMA 2XABA 2YEDA 1Y4SA 1I5AA 3HZ5A 4BAEA 3A0RA 1ZXNA 4MPNA 2YEJA 3EHHA 3HYZA 4WUBA 4O09A 3U67A 2H8MA 1U0ZA 2Q8GA 5M4KA 2BSMA 3LNUA 3FT5A 3BMYA 4LWEA 3ZKDA 4EGKA 3EHGA 1QYEA 3ZM7A 3ZXOA 4ASAA 2YKIA 1GKZA 1GJVA 3CGYA 4MPCA 1IXMA 4CWTA 1YC4A 1Z5AA 5J6AA 3R91A 4L93A 4H85A 2GQPA 1I5CA 4ASBA 3A0ZA 3FT8A 4LPBA 4MOTA 4E02A 1H7UA 3CYGA 3G7EA 2IWXA 4H7QA 4EFTA 4KFGA 1ID0A 3TUHA 3CRKA 3A0TA 1YT0A 4E01A 2VWCA 2YE8A 3OPDA 2BTZA 3RLQA 4YKZA 2Q8FA 1QY8A 4E00A 1H7SA 1AH8A 1QZRA 4FCQA 4YKWA 4I3HA 2CCUA 4DUHA 4CE1A 1BXDA 3OW6A 4AS9A 4YKYA 4MP7A 2C1GA 4V26A 3D2RA 1UYDA 3H80A 2O1WA 5M4HA 3K98A 5F5RA 2BU7A 4BIUA 4URLA 4CWQA 2CCSA 5CTYA 3KE6A 4YKQA 3C11A 4AWOA 2Q2EB 2WEQA 1UYLA 4B7PA 1MU5A 4JAUA 4L94A 5GGZA 2CCTA 4MB9A 4H81A 4PL9A 1I5BA 3BM9A 4R1FA 1YC1A 4HYPA 2ZBKB 3A0WA 3Q5KA 5FNCA 4QPKA 3T1KA 3SL2A 3GIGB 2YEGA 1TC6A 4CWSA 3R4NA 4U7OA 4O07A 1YC3A 3TZ2A 3LPSA 2VW5A 4PRVA 5C93A 1Y8OA 2YGEA 1GKXA 5F3KA 1Y4UA 4FPPA 2YE2A 2XDLA 2YKJA 3Q5JA 1UYFA 4HY6A 3HHUA 4V25A 1UY6A 4JAVA 2WI4A 2YKCA 3GIGA 3K97A 1UYEA 2XJXA 4WUCA 4WUDA 2WI3A 2BU8A 4P7AA 3Q5LA 4JASA 4UROA 4XCJA 4KSHA 1U2OA 2IORA 2IWUA 4O04A 3LMMA 2C1IA 1I5DA 3K60A 2E0AA 1NHJA 3FV5A 4E72A 5JENA 5CTWA 3B28A 4XE2A 2HCHA 1NHIA 1YT2A 4PRXA 4U7NA 1AM1A 4CWRA 2XX4A 2IOQA 4CE2A 4L91A 2FXSA 5M4PA 3VHCA 2CH4A 2GFDA 4GT8A 4GEEA 1TIDA 2BU2A 2HG1A 4L90A 2Q8IA 1PVGA 1BKNA 1BYQA 1OSFA 2YGFA 4L8ZA 4XC0A 2HHIA 2QG2A 3OWBA 1Z5CA 2BREA 5FNFA 2UWDA 2XDXA 4XKOA 5IDJA 2BRCA 3B25A 5D6PA 1UY8A 1TH8A 2QFOA 2XD6A 1UYHA 5CTUA 2XDKA 4HY1A 1THNA 5CTXA 1S16A 1UY9A 2WEPA 1EA6A 2CG9A 3EKOA 1Y8NA 4ASFA 4EGIA 4LWFA 3VADA 4XIRA 2XK2A 4XDMA 4XD8A 5M4NA 3G75A 4GQTA 3ZKBA 5BOCA 2BYIA 3QTFA 3A0YA 4HZ5A 4KQVA 1TILA 2O1VA 3CWVA 4Q20A 1BGQA 2ZDYA 5FNDA 3T0HA 1I59A 1B3QA 2JJCA 1YSZA 3S5TA 3CGZA 2YE6A 4B6CA 4HZ0A 4W7TA 2YE5A 2K5BA 2PNRA 3HZ1A 1B62A 4CWNA 5D7RA 1UYCA 2XHRA 2C2AA 2QG0A 2XDSA 4JQLA 3HYYA 2YE7A 4R3MA 4XKKA 1F51A 1JM6A 3VHAA 2XHXA 2YEAA 3NMQA 2QF6A 3B27A 2ZDXA 4URMA 5D7CA 3ZXQA 1KIJA 2WI1A 3EHJA 2FTKA 3G7BA 4KTNA 2YE9A 4NH9A 4XITA 5D6QA 5D7DA 1AMWA 2WI6A 2JKIA 1YESA 1ZW9A 3GIFA 3EKRA 3HEKA 4LWHA 4MP2A 5L3JA 4HXWA 2XCMA 1UYIA 4YKTA 3T0ZA 1B63A 1UYMA 3DGEA 1YSRA 4KSGA 1UY7A 5CPHA 4EGHA 2YKEA 4BIZA 3TZ0A 1R62A 2YEHA 3OMUA 1YS3A 4AWQA 4MBCA 3PEJA 4O05A 2YEIA 4O0BA 1Z59A 2XDUA 3K99A 1UYKA 1ZWHA 2YI5A 3A0XA 3EHFA 3B26A 4EEHA 2ESAA 3INWA 4HYMA 4BQJA 2AKPA 2FWYA 5CF0A 3RLRA 2XJJA 4PU9A 3R4PA 1UYGA 3WHAA 2CGFA 2BU6A 2YGAA 4ZKIA 2EXLA 3OWDA 2YE4A 1A4HA 2H55A 4YKXA 4AWPA 4BXIA 2FWZA 1ZXMA 4ZVIA 4LWIA 4NH8A 4QPJA 1YETA 1S14A 2HKJA 4EM7A 3GIEA 5J71A 4CE3A 1AH6A 3INXA 2YEEA 3U2DA 1TC0A 4R3AA 2YECA 2XHTA 4CWPA 4GFNA 4ASGA 4EMVA 3R4OA 1Y8PA 4X9LA 2YI7A 1Z5BA 3VHDA 1KZNA 4CWFA 2YI6A 4FCPA 2YEFA 2WERA 2YKBA 5IN9A 2BU5A 4I5SA 4U93A 3C0EA 4DZYA 1EI1A 3B24A 5FWKA 3JZ3A 4K4OA 3RLPA 2BT0A 5M4MA 3TZ5A 1L0OA 3CRLA 1TBWA 3MNRP
chains in the Genus database with same CATH topology
2WI5A 2BZ5A 2O1UA 4P8OA 3QDDA 4MPEA 3R4MA 2ZKJA 4YKUA 1YT1A 3IEDA 4EFUA 4HXZA 4BQGA 2YEBA 3RKZA 2YK9A 4LP0A 4LWGA 4XIPA 2WI7A 4URNA 3H4LA 4NH7A 1YERA 5M4EA 3U2KA 1AJ6A 3D36A 3R92A 3T2SA 4GGLA 2YK2A 3TZ4A 4CWOA 3PEHA 2BYHA 4XCLA 2YJWA 3D0BA 4FCRA 1MX0A 2XX2A 3O2FA 4YKRA 2XJGA 4XIQA 4KP4A 5BODA 2WI2A 3TTZA 3WQ9A 2VCJA 3O6OA 4FMTA 2FYPA 1I58A 3T10A 1NHHA 4XTJA 2Q8HA 2VCIA 2XX5A 2IOPA 2IWSA 3O0IA 2YJXA 4XKAA 2YE3A 1US7A 4GCZA 2YI0A 5IDMA 2XABA 2YEDA 1Y4SA 1I5AA 3HZ5A 4BAEA 3A0RA 1ZXNA 4MPNA 2YEJA 3EHHA 3HYZA 4WUBA 4O09A 3U67A 2H8MA 1U0ZA 2Q8GA 5M4KA 2BSMA 3LNUA 3FT5A 3BMYA 4LWEA 3ZKDA 4EGKA 3EHGA 1QYEA 3ZM7A 3ZXOA 4ASAA 2YKIA 1GKZA 1GJVA 3CGYA 4MPCA 4CWTA 1YC4A 1Z5AA 5J6AA 3R91A 4L93A 4H85A 2GQPA 1I5CA 4ASBA 3A0ZA 3FT8A 4LPBA 4MOTA 4E02A 1H7UA 3G7EA 2IWXA 4H7QA 4EFTA 4KFGA 1ID0A 3TUHA 3CRKA 3A0TA 1YT0A 4E01A 2VWCA 2YE8A 3OPDA 2BTZA 3RLQA 4YKZA 2Q8FA 1QY8A 4E00A 1H7SA 1AH8A 1QZRA 4FCQA 4YKWA 4I3HA 2CCUA 4DUHA 4CE1A 1BXDA 3OW6A 4AS9A 4YKYA 4MP7A 4V26A 3D2RA 1UYDA 3H80A 2O1WA 5M4HA 3K98A 5F5RA 2BU7A 4BIUA 4URLA 4CWQA 2CCSA 5CTYA 3KE6A 4YKQA 3C11A 4AWOA 2Q2EB 2WEQA 1UYLA 4B7PA 1MU5A 4JAUA 4L94A 5GGZA 2CCTA 4MB9A 4H81A 4PL9A 1I5BA 3BM9A 4R1FA 1YC1A 4HYPA 2ZBKB 3A0WA 3Q5KA 5FNCA 4QPKA 3T1KA 3SL2A 3GIGB 2YEGA 1TC6A 4CWSA 3R4NA 4U7OA 4O07A 1YC3A 3TZ2A 3LPSA 2VW5A 4PRVA 5C93A 1Y8OA 2YGEA 1GKXA 5F3KA 1Y4UA 4FPPA 2YE2A 2XDLA 2YKJA 3Q5JA 1UYFA 4HY6A 3HHUA 4V25A 1UY6A 4JAVA 2WI4A 2YKCA 3GIGA 3K97A 1UYEA 2XJXA 4WUCA 4WUDA 2WI3A 2BU8A 4P7AA 3Q5LA 4JASA 4UROA 4XCJA 4KSHA 1U2OA 2IORA 2IWUA 4O04A 1I5DA 3K60A 2E0AA 1NHJA 3FV5A 5CTWA 3B28A 4XE2A 2HCHA 1NHIA 1YT2A 4PRXA 4U7NA 1AM1A 4CWRA 2XX4A 2IOQA 4CE2A 4L91A 2FXSA 5M4PA 3VHCA 2CH4A 2GFDA 4GT8A 4GEEA 1TIDA 2BU2A 2HG1A 4L90A 2Q8IA 1PVGA 1BKNA 1BYQA 1OSFA 2YGFA 4L8ZA 4XC0A 2QG2A 3OWBA 1Z5CA 2BREA 5FNFA 2UWDA 2XDXA 4XKOA 5IDJA 2BRCA 3B25A 5D6PA 1UY8A 1TH8A 2QFOA 2XD6A 1UYHA 5CTUA 2XDKA 4HY1A 1THNA 5CTXA 1S16A 1UY9A 2WEPA 1EA6A 2CG9A 3EKOA 1Y8NA 4ASFA 4EGIA 4LWFA 3VADA 4XIRA 2XK2A 4XDMA 4XD8A 5M4NA 3G75A 4GQTA 3ZKBA 5BOCA 2BYIA 3QTFA 3A0YA 4HZ5A 4KQVA 1TILA 2O1VA 3CWVA 4Q20A 1BGQA 2ZDYA 5FNDA 3T0HA 1I59A 1B3QA 2JJCA 1YSZA 3CGZA 2YE6A 4B6CA 4HZ0A 4W7TA 2YE5A 2K5BA 2PNRA 3HZ1A 1B62A 4CWNA 5D7RA 1UYCA 2XHRA 2C2AA 2QG0A 2XDSA 4JQLA 3HYYA 2YE7A 4R3MA 4XKKA 1JM6A 3VHAA 2XHXA 2YEAA 3NMQA 2QF6A 3B27A 2ZDXA 4URMA 5D7CA 3ZXQA 1KIJA 2WI1A 3EHJA 3G7BA 4KTNA 4NH9A 2YE9A 4XITA 5D6QA 5D7DA 1AMWA 2WI6A 2JKIA 1YESA 1ZW9A 3GIFA 3EKRA 3HEKA 4LWHA 4MP2A 5L3JA 4HXWA 2XCMA 1UYIA 4YKTA 3T0ZA 1B63A 1UYMA 3DGEA 1YSRA 4KSGA 1UY7A 5CPHA 4EGHA 2YKEA 4BIZA 3TZ0A 1R62A 2YEHA 3OMUA 1YS3A 4AWQA 4MBCA 3PEJA 4O05A 2YEIA 4O0BA 1Z59A 2XDUA 3K99A 1UYKA 1ZWHA 2YI5A 3A0XA 3EHFA 3B26A 4EEHA 2ESAA 3INWA 4HYMA 4BQJA 2AKPA 2FWYA 5CF0A 3RLRA 2XJJA 4PU9A 3R4PA 1UYGA 3WHAA 2CGFA 2BU6A 2YGAA 4ZKIA 2EXLA 3OWDA 2YE4A 1A4HA 2H55A 4YKXA 4AWPA 4BXIA 2FWZA 1ZXMA 4ZVIA 4LWIA 4NH8A 4QPJA 1YETA 1S14A 2HKJA 4EM7A 3GIEA 5J71A 4CE3A 1AH6A 3INXA 2YEEA 3U2DA 1TC0A 4R3AA 2YECA 2XHTA 4CWPA 4GFNA 4ASGA 4EMVA 3R4OA 1Y8PA 4X9LA 2YI7A 1Z5BA 3VHDA 1KZNA 4CWFA 2YI6A 4FCPA 2YEFA 2WERA 2YKBA 5IN9A 2BU5A 4I5SA 4U93A 3C0EA 4DZYA 1EI1A 3B24A 5FWKA 3JZ3A 4K4OA 3RLPA 2BT0A 5M4MA 3TZ5A 1L0OA 3CRLA 1TBWA 3MNRP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WI5 A;  2BZ5 A;  2O1U A;  4P8O A;  3QDD A;  4MPE A;  3R4M A;  2ZKJ A;  4YKU A;  1YT1 A;  3IED A;  4EFU A;  4HXZ A;  4BQG A;  2YEB A;  3RKZ A;  2YK9 A;  4LP0 A;  4LWG A;  4XIP A;  2WI7 A;  4URN A;  3H4L A;  4NH7 A;  1YER A;  5M4E A;  3U2K A;  1AJ6 A;  3D36 A;  3R92 A;  3T2S A;  4GGL A;  2YK2 A;  3TZ4 A;  4CWO A;  3PEH A;  2BYH A;  4XCL A;  2YJW A;  3D0B A;  4FCR A;  1MX0 A;  2XX2 A;  3O2F A;  4YKR A;  2XJG A;  4XIQ A;  4KP4 A;  5BOD A;  2WI2 A;  3TTZ A;  3WQ9 A;  2VCJ A;  3O6O A;  4FMT A;  2FYP A;  1I58 A;  3T10 A;  1NHH A;  4XTJ A;  2Q8H A;  2VCI A;  2XX5 A;  2IOP A;  2IWS A;  3O0I A;  2YJX A;  4XKA A;  2YE3 A;  1US7 A;  4GCZ A;  2YI0 A;  5IDM A;  2XAB A;  2YED A;  1Y4S A;  1I5A A;  3HZ5 A;  4BAE A;  3A0R A;  1ZXN A;  4MPN A;  2YEJ A;  3EHH A;  3HYZ A;  4WUB A;  4O09 A;  3U67 A;  2H8M A;  1U0Z A;  2Q8G A;  5M4K A;  2BSM A;  3LNU A;  3FT5 A;  3BMY A;  4LWE A;  3ZKD A;  4EGK A;  3EHG A;  1QYE A;  3ZM7 A;  3ZXO A;  4ASA A;  2YKI A;  1GKZ A;  1GJV A;  3CGY A;  4MPC A;  4CWT A;  1YC4 A;  1Z5A A;  5J6A A;  3R91 A;  4L93 A;  4H85 A;  2GQP A;  1I5C A;  4ASB A;  3A0Z A;  3FT8 A;  4LPB A;  4MOT A;  4E02 A;  1H7U A;  3G7E A;  2IWX A;  4H7Q A;  4EFT A;  4KFG A;  1ID0 A;  3TUH A;  3CRK A;  3A0T A;  1YT0 A;  4E01 A;  2VWC A;  2YE8 A;  3OPD A;  2BTZ A;  3RLQ A;  4YKZ A;  2Q8F A;  1QY8 A;  4E00 A;  1H7S A;  1AH8 A;  1QZR A;  4FCQ A;  4YKW A;  4I3H A;  2CCU A;  4DUH A;  4CE1 A;  1BXD A;  3OW6 A;  4AS9 A;  4YKY A;  4MP7 A;  4V26 A;  3D2R A;  1UYD A;  3H80 A;  2O1W A;  5M4H A;  3K98 A;  5F5R A;  2BU7 A;  4BIU A;  4URL A;  4CWQ A;  2CCS A;  5CTY A;  3KE6 A;  4YKQ A;  3C11 A;  4AWO A;  2Q2E B;  2WEQ A;  1UYL A;  4B7P A;  1MU5 A;  4JAU A;  4L94 A;  5GGZ A;  2CCT A;  4MB9 A;  4H81 A;  4PL9 A;  1I5B A;  3BM9 A;  4R1F A;  1YC1 A;  4HYP A;  2ZBK B;  3A0W A;  3Q5K A;  5FNC A;  4QPK A;  3T1K A;  3SL2 A;  3GIG B;  2YEG A;  1TC6 A;  4CWS A;  3R4N A;  4U7O A;  4O07 A;  1YC3 A;  3TZ2 A;  3LPS A;  2VW5 A;  4PRV A;  5C93 A;  1Y8O A;  2YGE A;  1GKX A;  5F3K A;  1Y4U A;  4FPP A;  2YE2 A;  2XDL A;  2YKJ A;  3Q5J A;  1UYF A;  4HY6 A;  3HHU A;  4V25 A;  1UY6 A;  4JAV A;  2WI4 A;  2YKC A;  3GIG A;  3K97 A;  1UYE A;  2XJX A;  4WUC A;  4WUD A;  2WI3 A;  2BU8 A;  4P7A A;  3Q5L A;  4JAS A;  4URO A;  4XCJ A;  4KSH A;  1U2O A;  2IOR A;  2IWU A;  4O04 A;  1I5D A;  3K60 A;  2E0A A;  1NHJ A;  3FV5 A;  5CTW A;  3B28 A;  4XE2 A;  2HCH A;  1NHI A;  1YT2 A;  4PRX A;  4U7N A;  1AM1 A;  4CWR A;  2XX4 A;  2IOQ A;  4CE2 A;  4L91 A;  2FXS A;  5M4P A;  3VHC A;  2CH4 A;  2GFD A;  4GT8 A;  4GEE A;  1TID A;  2BU2 A;  2HG1 A;  4L90 A;  2Q8I A;  1PVG A;  1BKN A;  1BYQ A;  1OSF A;  2YGF A;  4L8Z A;  4XC0 A;  2QG2 A;  3OWB A;  1Z5C A;  2BRE A;  5FNF A;  2UWD A;  2XDX A;  4XKO A;  5IDJ A;  2BRC A;  3B25 A;  5D6P A;  1UY8 A;  1TH8 A;  2QFO A;  2XD6 A;  1UYH A;  5CTU A;  2XDK A;  4HY1 A;  1THN A;  5CTX A;  1S16 A;  1UY9 A;  2WEP A;  1EA6 A;  2CG9 A;  3EKO A;  1Y8N A;  4ASF A;  4EGI A;  4LWF A;  3VAD A;  4XIR A;  2XK2 A;  4XDM A;  4XD8 A;  5M4N A;  3G75 A;  4GQT A;  3ZKB A;  5BOC A;  2BYI A;  3QTF A;  3A0Y A;  4HZ5 A;  4KQV A;  1TIL A;  2O1V A;  3CWV A;  4Q20 A;  1BGQ A;  2ZDY A;  5FND A;  3T0H A;  1I59 A;  1B3Q A;  2JJC A;  1YSZ A;  3CGZ A;  2YE6 A;  4B6C A;  4HZ0 A;  4W7T A;  2YE5 A;  2K5B A;  2PNR A;  3HZ1 A;  1B62 A;  4CWN A;  5D7R A;  1UYC A;  2XHR A;  2C2A A;  2QG0 A;  2XDS A;  4JQL A;  3HYY A;  2YE7 A;  4R3M A;  4XKK A;  1JM6 A;  3VHA A;  2XHX A;  2YEA A;  3NMQ A;  2QF6 A;  3B27 A;  2ZDX A;  4URM A;  5D7C A;  3ZXQ A;  1KIJ A;  2WI1 A;  3EHJ A;  3G7B A;  4KTN A;  4NH9 A;  2YE9 A;  4XIT A;  5D6Q A;  5D7D A;  1AMW A;  2WI6 A;  2JKI A;  1YES A;  1ZW9 A;  3GIF A;  3EKR A;  3HEK A;  4LWH A;  4MP2 A;  5L3J A;  4HXW A;  2XCM A;  1UYI A;  4YKT A;  3T0Z A;  1B63 A;  1UYM A;  3DGE A;  1YSR A;  4KSG A;  1UY7 A;  5CPH A;  4EGH A;  2YKE A;  4BIZ A;  3TZ0 A;  1R62 A;  2YEH A;  3OMU A;  1YS3 A;  4AWQ A;  4MBC A;  3PEJ A;  4O05 A;  2YEI A;  4O0B A;  1Z59 A;  2XDU A;  3K99 A;  1UYK A;  1ZWH A;  2YI5 A;  3A0X A;  3EHF A;  3B26 A;  4EEH A;  2ESA A;  3INW A;  4HYM A;  4BQJ A;  2AKP A;  2FWY A;  5CF0 A;  3RLR A;  2XJJ A;  4PU9 A;  3R4P A;  1UYG A;  3WHA A;  2CGF A;  2BU6 A;  2YGA A;  4ZKI A;  2EXL A;  3OWD A;  2YE4 A;  1A4H A;  2H55 A;  4YKX A;  4AWP A;  4BXI A;  2FWZ A;  1ZXM A;  4ZVI A;  4LWI A;  4NH8 A;  4QPJ A;  1YET A;  1S14 A;  2HKJ A;  4EM7 A;  3GIE A;  5J71 A;  4CE3 A;  1AH6 A;  3INX A;  2YEE A;  3U2D A;  1TC0 A;  4R3A A;  2YEC A;  2XHT A;  4CWP A;  4GFN A;  4ASG A;  4EMV A;  3R4O A;  1Y8P A;  4X9L A;  2YI7 A;  1Z5B A;  3VHD A;  1KZN A;  4CWF A;  2YI6 A;  4FCP A;  2YEF A;  2WER A;  2YKB A;  5IN9 A;  2BU5 A;  4I5S A;  4U93 A;  3C0E A;  4DZY A;  1EI1 A;  3B24 A;  5FWK A;  3JZ3 A;  4K4O A;  3RLP A;  2BT0 A;  5M4M A;  3TZ5 A;  1L0O A;  3CRL A;  1TBW A;  3MNR P; 
#chains in the Genus database with same CATH topology
 2WI5 A;  2BZ5 A;  2O1U A;  4P8O A;  3QDD A;  4MPE A;  3R4M A;  2ZKJ A;  4YKU A;  1YT1 A;  3IED A;  4EFU A;  4HXZ A;  4BQG A;  2YEB A;  3RKZ A;  2YK9 A;  4LP0 A;  4LWG A;  4XIP A;  2WI7 A;  4URN A;  3H4L A;  4NH7 A;  1YER A;  5M4E A;  3U2K A;  1AJ6 A;  3D36 A;  3R92 A;  3T2S A;  4GGL A;  2YK2 A;  3TZ4 A;  4CWO A;  3PEH A;  2BYH A;  4XCL A;  2YJW A;  3D0B A;  4FCR A;  1MX0 A;  2XX2 A;  3O2F A;  4YKR A;  2XJG A;  4XIQ A;  4KP4 A;  5BOD A;  2WI2 A;  3TTZ A;  3WQ9 A;  2VCJ A;  3O6O A;  4FMT A;  2FYP A;  1I58 A;  3T10 A;  1NHH A;  4XTJ A;  2Q8H A;  2VCI A;  2XX5 A;  2IOP A;  2IWS A;  3O0I A;  2YJX A;  4XKA A;  2YE3 A;  1US7 A;  4GCZ A;  2YI0 A;  5IDM A;  2XAB A;  2YED A;  1Y4S A;  1I5A A;  3HZ5 A;  4BAE A;  3A0R A;  1ZXN A;  4MPN A;  2YEJ A;  3EHH A;  3HYZ A;  4WUB A;  4O09 A;  3U67 A;  2H8M A;  1U0Z A;  2Q8G A;  5M4K A;  2BSM A;  3LNU A;  3FT5 A;  3BMY A;  4LWE A;  3ZKD A;  4EGK A;  3EHG A;  1QYE A;  3ZM7 A;  3ZXO A;  4ASA A;  2YKI A;  1GKZ A;  1GJV A;  3CGY A;  4MPC A;  1IXM A;  4CWT A;  1YC4 A;  1Z5A A;  5J6A A;  3R91 A;  4L93 A;  4H85 A;  2GQP A;  1I5C A;  4ASB A;  3A0Z A;  3FT8 A;  4LPB A;  4MOT A;  4E02 A;  1H7U A;  3CYG A;  3G7E A;  2IWX A;  4H7Q A;  4EFT A;  4KFG A;  1ID0 A;  3TUH A;  3CRK A;  3A0T A;  1YT0 A;  4E01 A;  2VWC A;  2YE8 A;  3OPD A;  2BTZ A;  3RLQ A;  4YKZ A;  2Q8F A;  1QY8 A;  4E00 A;  1H7S A;  1AH8 A;  1QZR A;  4FCQ A;  4YKW A;  4I3H A;  2CCU A;  4DUH A;  4CE1 A;  1BXD A;  3OW6 A;  4AS9 A;  4YKY A;  4MP7 A;  2C1G A;  4V26 A;  3D2R A;  1UYD A;  3H80 A;  2O1W A;  5M4H A;  3K98 A;  5F5R A;  2BU7 A;  4BIU A;  4URL A;  4CWQ A;  2CCS A;  5CTY A;  3KE6 A;  4YKQ A;  3C11 A;  4AWO A;  2Q2E B;  2WEQ A;  1UYL A;  4B7P A;  1MU5 A;  4JAU A;  4L94 A;  5GGZ A;  2CCT A;  4MB9 A;  4H81 A;  4PL9 A;  1I5B A;  3BM9 A;  4R1F A;  1YC1 A;  4HYP A;  2ZBK B;  3A0W A;  3Q5K A;  5FNC A;  4QPK A;  3T1K A;  3SL2 A;  3GIG B;  2YEG A;  1TC6 A;  4CWS A;  3R4N A;  4U7O A;  4O07 A;  1YC3 A;  3TZ2 A;  3LPS A;  2VW5 A;  4PRV A;  5C93 A;  1Y8O A;  2YGE A;  1GKX A;  5F3K A;  1Y4U A;  4FPP A;  2YE2 A;  2XDL A;  2YKJ A;  3Q5J A;  1UYF A;  4HY6 A;  3HHU A;  4V25 A;  1UY6 A;  4JAV A;  2WI4 A;  2YKC A;  3GIG A;  3K97 A;  1UYE A;  2XJX A;  4WUC A;  4WUD A;  2WI3 A;  2BU8 A;  4P7A A;  3Q5L A;  4JAS A;  4URO A;  4XCJ A;  4KSH A;  1U2O A;  2IOR A;  2IWU A;  4O04 A;  3LMM A;  2C1I A;  1I5D A;  3K60 A;  2E0A A;  1NHJ A;  3FV5 A;  4E72 A;  5JEN A;  5CTW A;  3B28 A;  4XE2 A;  2HCH A;  1NHI A;  1YT2 A;  4PRX A;  4U7N A;  1AM1 A;  4CWR A;  2XX4 A;  2IOQ A;  4CE2 A;  4L91 A;  2FXS A;  5M4P A;  3VHC A;  2CH4 A;  2GFD A;  4GT8 A;  4GEE A;  1TID A;  2BU2 A;  2HG1 A;  4L90 A;  2Q8I A;  1PVG A;  1BKN A;  1BYQ A;  1OSF A;  2YGF A;  4L8Z A;  4XC0 A;  2HHI A;  2QG2 A;  3OWB A;  1Z5C A;  2BRE A;  5FNF A;  2UWD A;  2XDX A;  4XKO A;  5IDJ A;  2BRC A;  3B25 A;  5D6P A;  1UY8 A;  1TH8 A;  2QFO A;  2XD6 A;  1UYH A;  5CTU A;  2XDK A;  4HY1 A;  1THN A;  5CTX A;  1S16 A;  1UY9 A;  2WEP A;  1EA6 A;  2CG9 A;  3EKO A;  1Y8N A;  4ASF A;  4EGI A;  4LWF A;  3VAD A;  4XIR A;  2XK2 A;  4XDM A;  4XD8 A;  5M4N A;  3G75 A;  4GQT A;  3ZKB A;  5BOC A;  2BYI A;  3QTF A;  3A0Y A;  4HZ5 A;  4KQV A;  1TIL A;  2O1V A;  3CWV A;  4Q20 A;  1BGQ A;  2ZDY A;  5FND A;  3T0H A;  1I59 A;  1B3Q A;  2JJC A;  1YSZ A;  3S5T A;  3CGZ A;  2YE6 A;  4B6C A;  4HZ0 A;  4W7T A;  2YE5 A;  2K5B A;  2PNR A;  3HZ1 A;  1B62 A;  4CWN A;  5D7R A;  1UYC A;  2XHR A;  2C2A A;  2QG0 A;  2XDS A;  4JQL A;  3HYY A;  2YE7 A;  4R3M A;  4XKK A;  1F51 A;  1JM6 A;  3VHA A;  2XHX A;  2YEA A;  3NMQ A;  2QF6 A;  3B27 A;  2ZDX A;  4URM A;  5D7C A;  3ZXQ A;  1KIJ A;  2WI1 A;  3EHJ A;  2FTK A;  3G7B A;  4KTN A;  2YE9 A;  4NH9 A;  4XIT A;  5D6Q A;  5D7D A;  1AMW A;  2WI6 A;  2JKI A;  1YES A;  1ZW9 A;  3GIF A;  3EKR A;  3HEK A;  4LWH A;  4MP2 A;  5L3J A;  4HXW A;  2XCM A;  1UYI A;  4YKT A;  3T0Z A;  1B63 A;  1UYM A;  3DGE A;  1YSR A;  4KSG A;  1UY7 A;  5CPH A;  4EGH A;  2YKE A;  4BIZ A;  3TZ0 A;  1R62 A;  2YEH A;  3OMU A;  1YS3 A;  4AWQ A;  4MBC A;  3PEJ A;  4O05 A;  2YEI A;  4O0B A;  1Z59 A;  2XDU A;  3K99 A;  1UYK A;  1ZWH A;  2YI5 A;  3A0X A;  3EHF A;  3B26 A;  4EEH A;  2ESA A;  3INW A;  4HYM A;  4BQJ A;  2AKP A;  2FWY A;  5CF0 A;  3RLR A;  2XJJ A;  4PU9 A;  3R4P A;  1UYG A;  3WHA A;  2CGF A;  2BU6 A;  2YGA A;  4ZKI A;  2EXL A;  3OWD A;  2YE4 A;  1A4H A;  2H55 A;  4YKX A;  4AWP A;  4BXI A;  2FWZ A;  1ZXM A;  4ZVI A;  4LWI A;  4NH8 A;  4QPJ A;  1YET A;  1S14 A;  2HKJ A;  4EM7 A;  3GIE A;  5J71 A;  4CE3 A;  1AH6 A;  3INX A;  2YEE A;  3U2D A;  1TC0 A;  4R3A A;  2YEC A;  2XHT A;  4CWP A;  4GFN A;  4ASG A;  4EMV A;  3R4O A;  1Y8P A;  4X9L A;  2YI7 A;  1Z5B A;  3VHD A;  1KZN A;  4CWF A;  2YI6 A;  4FCP A;  2YEF A;  2WER A;  2YKB A;  5IN9 A;  2BU5 A;  4I5S A;  4U93 A;  3C0E A;  4DZY A;  1EI1 A;  3B24 A;  5FWK A;  3JZ3 A;  4K4O A;  3RLP A;  2BT0 A;  5M4M A;  3TZ5 A;  1L0O A;  3CRL A;  1TBW A;  3MNR P; 
#chains in the Genus database with same CATH homology
 2WI5 A;  2BZ5 A;  2O1U A;  4P8O A;  3QDD A;  4MPE A;  3R4M A;  2ZKJ A;  4YKU A;  1YT1 A;  3IED A;  4EFU A;  4HXZ A;  4BQG A;  2YEB A;  3RKZ A;  2YK9 A;  4LP0 A;  4LWG A;  4XIP A;  2WI7 A;  4URN A;  3H4L A;  4NH7 A;  1YER A;  5M4E A;  3U2K A;  1AJ6 A;  3D36 A;  3R92 A;  3T2S A;  4GGL A;  2YK2 A;  3TZ4 A;  4CWO A;  3PEH A;  2BYH A;  4XCL A;  2YJW A;  3D0B A;  4FCR A;  1MX0 A;  2XX2 A;  3O2F A;  4YKR A;  2XJG A;  4XIQ A;  4KP4 A;  5BOD A;  2WI2 A;  3TTZ A;  3WQ9 A;  2VCJ A;  3O6O A;  4FMT A;  2FYP A;  1I58 A;  3T10 A;  1NHH A;  4XTJ A;  2Q8H A;  2VCI A;  2XX5 A;  2IOP A;  2IWS A;  3O0I A;  2YJX A;  4XKA A;  2YE3 A;  1US7 A;  4GCZ A;  2YI0 A;  5IDM A;  2XAB A;  2YED A;  1Y4S A;  1I5A A;  3HZ5 A;  4BAE A;  3A0R A;  1ZXN A;  4MPN A;  2YEJ A;  3EHH A;  3HYZ A;  4WUB A;  4O09 A;  3U67 A;  2H8M A;  1U0Z A;  2Q8G A;  5M4K A;  2BSM A;  3LNU A;  3FT5 A;  3BMY A;  4LWE A;  3ZKD A;  4EGK A;  3EHG A;  1QYE A;  3ZM7 A;  3ZXO A;  4ASA A;  2YKI A;  1GKZ A;  1GJV A;  3CGY A;  4MPC A;  4CWT A;  1YC4 A;  1Z5A A;  5J6A A;  3R91 A;  4L93 A;  4H85 A;  2GQP A;  1I5C A;  4ASB A;  3A0Z A;  3FT8 A;  4LPB A;  4MOT A;  4E02 A;  1H7U A;  3G7E A;  2IWX A;  4H7Q A;  4EFT A;  4KFG A;  1ID0 A;  3TUH A;  3CRK A;  3A0T A;  1YT0 A;  4E01 A;  2VWC A;  2YE8 A;  3OPD A;  2BTZ A;  3RLQ A;  4YKZ A;  2Q8F A;  1QY8 A;  4E00 A;  1H7S A;  1AH8 A;  1QZR A;  4FCQ A;  4YKW A;  4I3H A;  2CCU A;  4DUH A;  4CE1 A;  1BXD A;  3OW6 A;  4AS9 A;  4YKY A;  4MP7 A;  4V26 A;  3D2R A;  1UYD A;  3H80 A;  2O1W A;  5M4H A;  3K98 A;  5F5R A;  2BU7 A;  4BIU A;  4URL A;  4CWQ A;  2CCS A;  5CTY A;  3KE6 A;  4YKQ A;  3C11 A;  4AWO A;  2Q2E B;  2WEQ A;  1UYL A;  4B7P A;  1MU5 A;  4JAU A;  4L94 A;  5GGZ A;  2CCT A;  4MB9 A;  4H81 A;  4PL9 A;  1I5B A;  3BM9 A;  4R1F A;  1YC1 A;  4HYP A;  2ZBK B;  3A0W A;  3Q5K A;  5FNC A;  4QPK A;  3T1K A;  3SL2 A;  3GIG B;  2YEG A;  1TC6 A;  4CWS A;  3R4N A;  4U7O A;  4O07 A;  1YC3 A;  3TZ2 A;  3LPS A;  2VW5 A;  4PRV A;  5C93 A;  1Y8O A;  2YGE A;  1GKX A;  5F3K A;  1Y4U A;  4FPP A;  2YE2 A;  2XDL A;  2YKJ A;  3Q5J A;  1UYF A;  4HY6 A;  3HHU A;  4V25 A;  1UY6 A;  4JAV A;  2WI4 A;  2YKC A;  3GIG A;  3K97 A;  1UYE A;  2XJX A;  4WUC A;  4WUD A;  2WI3 A;  2BU8 A;  4P7A A;  3Q5L A;  4JAS A;  4URO A;  4XCJ A;  4KSH A;  1U2O A;  2IOR A;  2IWU A;  4O04 A;  1I5D A;  3K60 A;  2E0A A;  1NHJ A;  3FV5 A;  5CTW A;  3B28 A;  4XE2 A;  2HCH A;  1NHI A;  1YT2 A;  4PRX A;  4U7N A;  1AM1 A;  4CWR A;  2XX4 A;  2IOQ A;  4CE2 A;  4L91 A;  2FXS A;  5M4P A;  3VHC A;  2CH4 A;  2GFD A;  4GT8 A;  4GEE A;  1TID A;  2BU2 A;  2HG1 A;  4L90 A;  2Q8I A;  1PVG A;  1BKN A;  1BYQ A;  1OSF A;  2YGF A;  4L8Z A;  4XC0 A;  2QG2 A;  3OWB A;  1Z5C A;  2BRE A;  5FNF A;  2UWD A;  2XDX A;  4XKO A;  5IDJ A;  2BRC A;  3B25 A;  5D6P A;  1UY8 A;  1TH8 A;  2QFO A;  2XD6 A;  1UYH A;  5CTU A;  2XDK A;  4HY1 A;  1THN A;  5CTX A;  1S16 A;  1UY9 A;  2WEP A;  1EA6 A;  2CG9 A;  3EKO A;  1Y8N A;  4ASF A;  4EGI A;  4LWF A;  3VAD A;  4XIR A;  2XK2 A;  4XDM A;  4XD8 A;  5M4N A;  3G75 A;  4GQT A;  3ZKB A;  5BOC A;  2BYI A;  3QTF A;  3A0Y A;  4HZ5 A;  4KQV A;  1TIL A;  2O1V A;  3CWV A;  4Q20 A;  1BGQ A;  2ZDY A;  5FND A;  3T0H A;  1I59 A;  1B3Q A;  2JJC A;  1YSZ A;  3CGZ A;  2YE6 A;  4B6C A;  4HZ0 A;  4W7T A;  2YE5 A;  2K5B A;  2PNR A;  3HZ1 A;  1B62 A;  4CWN A;  5D7R A;  1UYC A;  2XHR A;  2C2A A;  2QG0 A;  2XDS A;  4JQL A;  3HYY A;  2YE7 A;  4R3M A;  4XKK A;  1JM6 A;  3VHA A;  2XHX A;  2YEA A;  3NMQ A;  2QF6 A;  3B27 A;  2ZDX A;  4URM A;  5D7C A;  3ZXQ A;  1KIJ A;  2WI1 A;  3EHJ A;  3G7B A;  4KTN A;  4NH9 A;  2YE9 A;  4XIT A;  5D6Q A;  5D7D A;  1AMW A;  2WI6 A;  2JKI A;  1YES A;  1ZW9 A;  3GIF A;  3EKR A;  3HEK A;  4LWH A;  4MP2 A;  5L3J A;  4HXW A;  2XCM A;  1UYI A;  4YKT A;  3T0Z A;  1B63 A;  1UYM A;  3DGE A;  1YSR A;  4KSG A;  1UY7 A;  5CPH A;  4EGH A;  2YKE A;  4BIZ A;  3TZ0 A;  1R62 A;  2YEH A;  3OMU A;  1YS3 A;  4AWQ A;  4MBC A;  3PEJ A;  4O05 A;  2YEI A;  4O0B A;  1Z59 A;  2XDU A;  3K99 A;  1UYK A;  1ZWH A;  2YI5 A;  3A0X A;  3EHF A;  3B26 A;  4EEH A;  2ESA A;  3INW A;  4HYM A;  4BQJ A;  2AKP A;  2FWY A;  5CF0 A;  3RLR A;  2XJJ A;  4PU9 A;  3R4P A;  1UYG A;  3WHA A;  2CGF A;  2BU6 A;  2YGA A;  4ZKI A;  2EXL A;  3OWD A;  2YE4 A;  1A4H A;  2H55 A;  4YKX A;  4AWP A;  4BXI A;  2FWZ A;  1ZXM A;  4ZVI A;  4LWI A;  4NH8 A;  4QPJ A;  1YET A;  1S14 A;  2HKJ A;  4EM7 A;  3GIE A;  5J71 A;  4CE3 A;  1AH6 A;  3INX A;  2YEE A;  3U2D A;  1TC0 A;  4R3A A;  2YEC A;  2XHT A;  4CWP A;  4GFN A;  4ASG A;  4EMV A;  3R4O A;  1Y8P A;  4X9L A;  2YI7 A;  1Z5B A;  3VHD A;  1KZN A;  4CWF A;  2YI6 A;  4FCP A;  2YEF A;  2WER A;  2YKB A;  5IN9 A;  2BU5 A;  4I5S A;  4U93 A;  3C0E A;  4DZY A;  1EI1 A;  3B24 A;  5FWK A;  3JZ3 A;  4K4O A;  3RLP A;  2BT0 A;  5M4M A;  3TZ5 A;  1L0O A;  3CRL A;  1TBW A;  3MNR P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...