2GQQA

Crystal structure of e. coli leucine-responsive regulatory protein (lrp)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
153
structure length
153
Chain Sequence
LDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFIQGYTALLNPHYLDASLLVFVEITLNRGAPDVFEQFNTAVQKLEEIQECHLVSGDFDYLLKTRVPDMSAYRKLLGETLLRLPGVNDTRTYVVMEEVKQSNRLVIKTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Escherichia coli Leucine-responsive Regulatory Protein Lrp Reveals a Novel Octameric Assembly.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Leucine-responsive regulatory protein
total genus 19
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gqqA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gqqA02
1WWXA 5HLHA 2OBPA 1ULYA 3E6CC 3JAMK 4I0AA 1GHCA 2XAHA 1CGPA 5DCMB 1SD4A 1UHWA 1W7PA 1KQ0A 5FLXK 2A6HF 2PQ8A 1O7LA 2JTVA 3WGGA 4L9JA 4GYIA 1ON2A 4KA4A 4U0YA 3QAHA 2EFOA 2Y48A 4ENKA 1MD0A 3HSEA 3SZTA 5E8GA 2FBHA 3PQJA 2OAZA 3MEXA 1FC3A 3F8FA 4EGZA 4A5NA 1FZPB 4NQWA 1UCRA 5H20A 2DQLA 4KUMA 3L00A 1TW2A 1YLFA 3J81Z 1V3FA 2L02A 2OQGA 3OV8A 5JHUA 2XKOA 2VBZA 1R22A 3VOEA 3WE2A 3H92A 4DQ2A 2V79A 3L2CA 5J8FA 5DCMA 3E5QA 1F4KA 3R60A 3EYYA 1ZRCA 2FBKA 3IKVA 4K2EA 1VTNC 1R36A 3F6VA 2R7DA 4P9FA 4UVBA 1H9GA 2P8TA 2OD5A 2BV6A 1XSXA 5HDNA 3ZMDA 3BP8A 3Q9VA 4R1HA 2KIUA 2HKOA 1S3JA 2X4HA 4P55A 4E70A 2FE3A 3WG9A 3KP5A 4MTDA 4Y13A 2STTA 2W25A 5CVJA 4EV0A 3AAFA 3R6SA 4MGRA 2DK8A 2VOPA 2ESNA 4IRIA 3T8RA 3T8TA 3WTTC 3P9KA 2HR3A 2XAGA 4P96A 3F22A 5D8KB 4HF2A 3I59B 3IRQA 5LGNA 2A07F 2ZXJA 2DPDA 1KA8A 5HOOA 2G9WA 4RB3C 4LB6B 3F8CA 4AIJA 1H9TA 2M5WA 2PJPA 3GXOA 3RKYA 4OIPF 2JSCA 3DPLC 1RI7A 2JZYA 1J5YA 1FLIA 3KP4A 5JR3A 2RKHA 1E2XA 4BAYA 5ILSA 2XAJA 1FSHA 3N97A 3FM5A 3KFWX 2DW4A 1IN5A 2MH2A 1KYZA 4LLNA 1B9MA 4XLNF 1R00A 4RS8A 4UHTA 2ISYA 2L4MA 3F72A 1W4MA 4JBAA 3CJNA 1LQ1A 3JTGA 3F6OA 1YS7A 3GVAA 4BH9A 5DD4A 1U78A 1U5TC 1P4WA 3O6BB 4PCQA 3WTUC 3FXRA 5CLSA 2HS5A 4KIBA 4WWCA 2F2EA 2BYVE 3I64A 1W7PD 4MEYF 1TQPA 4G94A 4U0WA 3BOQA 3HTUA 5D4RA 4I0BA 4CXFA 4UV8A 3LWFA 4XRFA 4CDGA 3HOTA 2P4WA 3ROUA 1MZBA 5ILVA 1KQ9A 3FZVA 2DK5A 1ZG3A 5IT9Z 2A6EF 4XSXF 2W57A 3E5XA 1BI1A 5F1RA 2XIGA 2BBYA 1FYMA 4UXNA 4M9ZA 4Q5SF 4M71A 1LVAA 4HOBA 4IVNA 1MJ9A 4R79A 2ZMEB 3ZN1A 2V1XA 1O7FA 2J5OA 3BDDA 3FXUA 3K1MA 3RKXA 5A2QZ 2KIMA 4HX8A 3LQRA 4LK1F 3HRSA 4ON0A 4S05A 1STZA 3DPTA 3CUOA 4AWXB 2H6CA 4EJOA 1BJAA 4M72A 1A04A 2P5LC 2R3SA 2XROA 2CSOA 1BIBA 1J2XA 4I01A 3FMQA 3QOPA 2O61A 2KJBA 3I59A 2O6GE 1I1SA 5HS7A 1Z91A 1KU9A 4EVIA 3C18A 5HLGA 3U2RA 2V6CA 3B02A 2E1NA 2K4JA 2QYOA 3SXYA 3CUQB 1IN6A 1P92A 3WE3A 5LRRA 4U0VA 1D8KA 4HA8A 4AD9A 5FO5A 3RDIA 5DUKA 4OIOF 1P4XA 3H3ZA 4EJTA 2V9VA 1PUEE 1TQMA 2K86A 4IHTA 1KU2A 3F21A 5LGTA 4RB2C 4L0ZB 1EH8A 2MBFA 3EUHA 2A69F 2EFPA 4RAZA 1SMYF 2MA3A 1UB9A 1P2FA 3MZYA 4WF2A 5FD5A 2ZO4A 3K69A 1L3LA 4PGGA 2CYYA 1LEBA 3KETA 2JRTA 1HSJA 4KNYA 2PEXA 3W6KB 5BPDA 2IA0A 3KP7A 4O5VA 4G7HF 2DLLA 3I58A 5E20A 2QBYB 4GYGA 1QNTA 2OU2A 3CUQC 3SFZA 4Z2YA 1YO5C 1QPMA 3V7RA 1HW2A 2OZUA 2K4BA 2C6YA 1YW8A 4IPAA 3ZPLA 2L4AA 1ON1A 1U5TB 4OOIA 4KFCA 4HX7A 4G7ZF 2XAQA 1U6GA 3RPQA 2GZWA 4UVCA 1BC8C 2LNBA 3O2PE 3IWZA 1V4RA 2QZ8A 4ZZDA 2GQQA 3TDZC 2A61A 4IHSA 4M73A 5DYMA 5AONA 3BPXA 1I5ZA 4HDUA 3EDPA 5F6FA 5L3DA 3DV8A 2CWEA 4ASNA 2RV8A 2HQNA 3BWGA 5L3GA 4U7DA 1S7OA 1EH7A 2RNJA 1J7KA 4BXUA 4HLYA 1B59A 3M7GA 4G8XA 4U88A 3ZP5A 1P6RA 3R0JA 3RYPA 3E5UA 1YG2A 5HVQC 2DQRA 1QQIA 3QU3A 5E1XA 4MQVA 1HKQA 5K5RA 3HHGA 3ECOA 2QVOA 5E8IA 4I02A 1B9NA 1E17A 4LK0F 2TDXA 3KP6A 5LBQA 2DPUA 4XSZF 4MHGA 1ZLKA 3R0AA 4LD5A 1FOKA 1DPUA 2LKPA 4ENNA 1YTYA 3ABUA 2O0YA 1MJAA 1B6AA 1I1GA 3GFIA 2JPBA 2QWWA 2P6SA 4ZH4F 5ICEA 1I27A 4KMFA 4LMYA 3HRUA 4GCVA 1LEAA 2D1HA 3SZPA 1JHFA 1Z6RA 1DP7P 4M74A 4ENMA 4IF4A 4I09A 1FSEA 2IT0A 2KIFA 3HSFA 1IF1A 1YW9A 1XSVA 4IJAA 1NHAA 2QM3A 1TNTA 3RIRA 3HHHA 3TOAA 1IXCA 4HLXA 4NHJA 3ZMSA 3JAMZ 3WU0A 4GGGA 2AS5F 5E1ZB 2ACJA 2NRAC 2NS0A 4LG0A 2FNAA 2L54A 3BJAA 1U5TA 3G3ZA 4M6XA 5L3BA 1G3SA 2LDUA 3G73A 1FYKA 2OZ6A 1TQIA 1S29A 2O03A 4KIGA 3C7JA 1UFMA 3MZHA 4FT8A 2HYFA 1S6LA 2FU4A 1R58A 1O3TA 2QBYA 2FF4A 4L0YB 1FNNA 4A0ZA 1FY7A 1KQ8A 2XAFA 2M1BA 1GXQA 2HGCA 3ULQB 5DV5A 2NNNA 1WQ2A 5KK1A 3GEZA 3ECHA 4FX4A 4EJUA 1RIOH 1LDKB 2EFNA 5LHIA 2M87A 2QLZA 3K0LA 3VB2A 1G3YA 3KLNA 1SD5A 5D6EA 4ETSA 1I6XA 4Y15A 2ZCWA 3RKWA 4L9VA 1BI3A 4OIRF 2P7VB 3TOBA 4KYWA 3GX4X 5E1WA 3J80Z 1HQCA 3MFKA 4HW0A 2EV5A 1QZZA 5K1YA 2ZFWA 4ZZLA 1O3SA 2GWRA 2RGVA 1FP2A 1HSTA 1S8NA 4HDVA 3I71A 1J9IA 2X0LA 1FBQA 1TLHB 3TO7A 5LHHA 4OMYA 4OINF 5L3CA 1RZ4A 1J0RA 4F7ZA 1T0FA 4JQFA 2A3SA 3HYIA 1SFUA 5D5WB 4HV6A 5LEJA 2CVIA 2H09A 1ZARA 1KU3A 5TRDA 3HUGA 5AIPA 2Z3YA 3GZ6A 5D5UB 4BNCA 4B09A 4EM2A 2BEOA 5K5OA 4RAYA 3HOSA 1O3RA 5LRSA 3K9TA 3E97A 2VC1A 4G6DA 3BROA 1YW7A 5ERIA 2STWA 1CF7A 3GFJA 2IRFG 3DP7A 2YX4A 3QP6A 1T98A 2E1CA 1FT9A 1REPC 2E1AA 1HXDA 3GZ5A 3C1DA 1OYWA 1K79A 4RGSA 5LGUA 4HF1A 1D5VA 2Z5UA 1MJBA 3LA7A 4KICA 2MLKA 1T39A 1XMAA 4QWQA 2EV6A 3KEOA 2PG4A 2EJRA 4KMUX 3I53A 3CO6C 1FYLA 2HDCA 3L9FA 2CO5A 3WGHA 5FFZA 1HKSA 2K02A 3PFIA 1IUYA 2F5DA 1ZAOA 2COMA 1FBSA 4CICA 4FHTA 2VE8A 3BPVA 5JFRA 2MC3A 5JVTA 3HRMA 2VONA 4EM0B 4HZFA 2EV0A 2QENA 3LQQA 4PGHA 2KJCA 5DD8A 2FOKA 1WI9A 1G6NA 2Q0OA 4O6JA 2XUBA 1RNLA 3B73A 2R7FA 3FX3A 3TDUC 4XBFA 3OOPA 2Z9OA 2RDPA 1U3EM 2EB7A 3RJPA 4Q4ZF 1DDNA 5D5VB 1OR7A 4M9SA 4N0BA 3MCZA 2JSXA 1X3UA 1SFEA 1OPCA 1JHHA 2EWNA 3KZYA 1XGOA 4XLPF 4ZYHA 4NB5A 3TQNA 2F5FA 5CVVA 3WTXC 4R8HA 1KYWA 2M45A 3WTWC 5CVRA 2EK5A 3P7NA 1B4AA 3E6DA 3QPTA 3JW4A 1SMTA 2HFHA 2VODA 4UVAA 1MKMA 4A0XA 2Q8KA 2GA1A 3F8BA 3NQOA 1SAXA 1WKMA 5CVUA 2FNPA 2Z4PA 3F8MA 1USSA 1T2KA 2FA5A 1T38A 2W85A 1IN4A 2M8EA 5HS8A 1IAWA 1MGTA 3EQLF 2DU9A 3WU1B 3RI4A 2W84A 1IN8A 3WGIA 3ZMUA 2HWVA 2NYXA 4WK8F 4U7BA 5E18F 3ERED 2RQPA 5FB2A 3DQVC 4PZJA 1U8RA 1QBJA 4G9YA 2VOOA 1BN5A 4HX4A 1ODDA 4YFKF 5L3EA 1WSUA 3ZN0A 3U9GA 3VEPA 2F5EA 2FRHA 2HTJA 4IRGA 4YIIA 2YX7A 4BHBA 1OYYA 4H0EA 4LLLA 5H6RA 1B1BA 1XB4A 2ESHA 3BZ6A 1PP7U 4LGWA 4D0PA 2DJWA 3DFGA 2XKPA 2UWMA 3V7SA 5JI6A 2XRNA 1PDNC 5IT3A 4HV5A 1HW5A 3CUQA 2VXZA 2K27A 3QRFF 3REOA 3IKTA 1UHMA 2ISZA 4LFUA 3C3WA 5ICGA 3EYIA 4GXOA 1AOYA 1BI0A 4FX0A 2OA4A 1BI2A 1Z9CA 1W5TA 3M1EA 2FMLA 2MD5A 1ZGJA 4A0YA 1J75A 4ZYDA 2WWYA 1Y0UA 5J6XA 2O8XA 4BQAA 2V1DA 4OIQF 2P7CB 1L0OC 4EJVA 2PMHA 2XV4S 3FMRA 5HDGA 3TO9A 1AWCA 1XDUA 4BHCA 3P9IA 4IRHA 5K5QA 2ZKZA 3KP2A 2EA4A 1R5HA 4LLGF 2P5KA 1F5TA 5J8CA 4ESBA 1CF7B 4LB5A 4RGXA 3O3KA 1DUXC 1OYIA 3KEQA 4M9XA 3E6MA 4RB1A 4CHUA 2VBWA 1IRGA 4RB0A 3ISPA 2XVCA 1LDJA 3J81K 3HIFA 4CO8A 3QP5A 3T1BA 5CYVA 3W6JB 4KIFA 3I5UA 3FWEA 5HS9A 2GXGA 3FXQA 1XN7A 4N9IA 4YG2F 5AIQA 1LB2A 1H0MA 2HKXA 4M6YA 2GIVA 2CW0F 2XGXA 2A68F 2ZBKA 4P5OA 3ABTA 2O3FA 4UV9A 3R61A 1O57A 2CFXA 4I98B 2FBIA 3T0YA 1LDDA 1Z1DA 3WTZA 4EM1A 2ELHA 1K78B 1XD7A 2ZNYA 1RUNA 3LAJA 1D8JA 3GUDA 1OMIA 3WTSC 1TNSA 1ZN2A 3I0TA 4AIKA 4EMSA 3JTHA 3LA3A 2VC0A 1F1ZA 2HZTA 3F23A 5E17F 1XSDA 3WODF 3LAPA 2Y75A 1YIOA 2YU3A 3L7WA 4L9NA 4EQQA 2CGPA 2VE9A 1R1TA 2XHKA 2D2WA 3ML6A 3VODA 3J7AO 5BS6A 1YQAA 4ENJA 2FXAA 3ZMVA 1XGSA 2UXXA 2QQAA 1HW1A 2GXBA 4P9UA 1S7AA 3FMSA 5LEKA 5H6QA 4EJWA 4UUVA 4ESJA 3CO7C 3DF8A 2H6BA 5BMZA 2IA2A 2Z99A 3BJOA 4Q48A 1U2WA 2PBIA 1TBXA 1XGNA 2DFIA 1BIAA 1FBUA 1R5GA 5D8LB 3BY6A 2LF8A 1K78A 2ZBCA 5LLQA 3IHUA 1IN7A 1TTYA 4WCGA 3N4MA 1C0WA 3IL2A 4HQMA 5TJJA 1QZYA 3KLOA 2F5CA 2NNYA 2RVCA 3DEUA 1ONVA 2J5PA 2YR2A 1XMKA 1BOAA 3LA2A 4GO1A 3V8LA 3U1DA 1LNWA 4AVPA 3KCCA 1LJ9A 1ZRDA 2RC4A 1G3WA 3IRRA 1RUOA 1W5SA 4HAMA 3FM3A 3FHZA 1ZG1A 5HDKA 4KN4X 2YSRA 5ICCA 2KKOA 1Z6TA 1XGMA 5FD6A 2IA1A 5EEHA 2HEOA 5D6FA 5KVRA 2L01A 4CYDA 2YPRA 4S04A 5EEGA 3D5LA 3GF2A 4G6QA 3V8JA 1D3YA 3GWZA 1YFHA 3F8NA 6PAXA 1T6SA 2ZNZA 2ZJ2A 1P4AA 2P5VA 3MAJA 4A12A 4HF0A 2VT2A 5IT9K 5D4SA 1R1UA 1TW3A 4BYYA 1BC7C 1FWZA 2WV0A 1ZLJA 3KE2A 2PI0A 3DKWA 3K1NA 3NEUA 2IPQX 1WRJA 1MDMB 5CVIA 1JGSA 2NAZA 1K6OA 2AXLA 2PN6A 3JSPA 1QGPA 2K7LA 4Q47A 2CG4A 3K1PA 1IRFA 3GFLA 4CGZA 2EA2A 5DUIA 1DPRA 4RGRA 3Q5FA 1IZ1A 1ZREA 1W7PB 4WX9A 4A6EA 2GA2A 2LSOA 3RTRA 2MLGA 3WTVC 4ESFA 3SHFA 1SFXA 4LG0B 1IXSB 1XDSA 4O3MA 2QQBA 4KDPA 5CJ9A 1FP1D 2G7UA 3E6BA 2D1VA 3QPHA 4HYEA 5ED4A 3TKYA 3Q9SA 2H27A 2FQ3A 3P9CA 2L3DA 4I2OA 3SQNA 1GVJA 3K2ZA 5DCFA 3RPUA 4EGYA 1F9NA 4ZYEA 3COAC 4DNCA 1MDMA 2Y0MA 2HYGD 2Z33A 3R4KA 2HTSA 5DDGA 2G7HA 5FLXZ 1ZYRF 2P6TA 3ELKA 5ICFA 2B0LA 1SD6A 1IXRC 3M8FA 3H3UA 4L5JA 1PP8F 3FF5A 3MWMA 2JT1A 5FGMA 1JXSA 2RN7A 2HOEA 2VN2A 5HLIA 4A2UA 4LJZF 1O3QA 2ADUA 2WC2A 1Z05A 5FFXA 1Z7UA 3KZZA 1YS6A 4KN7X 2IW5A 2QQ9A 2BE5F 2ZMEA 3I54A 1SD7A 1XCVA 3NRVA 3V8KA 3KP3A 4MEXF 3ZQ7A 5F64A 5BQTA 3HSRA 2WTEA 3GO5A 1EV7A 4QLCU 1IW7F 2MH9A 2E7WA 2OQRA 1G3TA 1ZH5A 2FSWA 5DEQA 2JPCA 3GLXA 3S2WA 2UZKA 1BBYA 5L3FA 5D5XB 4L5IA 5BPIA 2FMYA 1FX7A 1J59A 4YFXF 2DBBA 1BM9A 2BGCA 2XASA 4L9TA 1ZG5A 1Q1HA 4L18B 3I4PA 4G7OF 2UXNA 2CQKA 3TGNA 3E3VA 3BJ6A 3V4GA 3GYHX 4MTEA 2PLYA 4MNUA 2DT5A 2FEZA 3HRTA 5LHGA 3D0SA 2IJLA 4HQEA 3LSTA 2HQRA 2VBXA 3TO6A 2ETHA 3T5XA 2Q2EA 3DXJF 3GW2A 3QU6A 1ZRFA 4B8XA 4A5MA 3CDHA 2M30A 4BHPA 2IP2A 2DI3A 3M8EA 1YYVA 4YFNF 1XCBA 4WXHA 2E7XA 5A2QK 2IVMA 1G4DA 2PFBA 1GXPA 1OKRA 3PQKA 3CLOA 4UNOA 4WXCA 3ZMTA 4CZZA 1R23A 2EFWA 4KT5C 2H94A 4N9HA 3L09A 4HBLA 4A6DA 4JK1X 4TV7A 3LFKA 1JE8A 4YIFA 3WTYC 3J80K 3JSOA 1ZHFA 1R1VA 3IC7A 2QUFA 2PMUA 4I7HA 2W24A 1KGSA 3MQ0A 1ZGAA 1HKTA 4OMZA 3HTSB 3V7CA 1QO0D 4IXAA 3CTAA 5BOXA 3M9AA 4WXDA 2A5YB 4Y17A 2DAOA 2LF7A 1EH6A 2GAUA 4PDKA 2V1UA 3VFZA 3RYRA 5ILUA 2KRFA 3GFMA 1R7JA 1FPQA 2D45A 4MQ9F 2EFQA 2VT3A 1K7AA 1USTA 3IWFA 3ZMZA 4ZYGA 4RGUA 4OU0A 3EETA 1HBXG 2DTRA 1KU7A 2DO7A 4AIHA 2VBYA 3F3XA
chains in the Genus database with same CATH superfamily
2ZKUA 3BPSP 1AFJA 2HVSA 4I56A 5C2CA 3GFHA 1V5VA 1S1VB 3N6MA 1FWKA 2XF6A 1XNRJ 3FEXB 5DCMB 2L2OA 1MROA 1ZM3A 1KQ0A 3Q2SC 5FLXK 2A05A 4EFAC 1B64A 4B9UA 1WEXA 4A3BJ 2JTVA 2R4FA 3WGGA 3GV8B 4I68A 2IVFB 4J91A 3AJDA 3PKYA 2AO9A 5I3QA 4KA4A 3QAHA 2Y48A 4LJMA 5HK4A 4ENKA 1M0SA 1UEUA 1T95A 4C8ZA 3GZ7A 1U8SA 1FC3A 3ZQIA 2Z2ZA 1MBEA 5IQQA 2JEFA 3BGFA 3F8FA 1FZPB 4B3AA 4O3NA 2ZDOA 5H20A 1TKXB 3PX6A 1HA8A 1WVRA 3UN2A 1HHQA 5HLFB 3V4MA 4KUMA 1TW2A 3CF5Q 3H0GJ 2L02A 3POTA 2X48A 1RTIA 3OV8A 2B4VA 2XQCA 3WE2A 3H8YA 4Y2MA 1S72S 2MPUA 2O7OA 1N88A 3QWLA 4CLPA 1IKYA 3E5QA 3D5RC 1T33A 1FEEA 2VL8A 2HQ3A 2DPIA 1ZRCA 2W2MP 1EARA 5J4VA 4K2EA 1VTNC 1S1VA 5CZXA 2AYGA 2IBDA 2R7DA 4P9FA 2OP5A 2HHWA 3CCRI 2H5JB 1ZTTA 4NZ6A 1RXOB 4C7QA 2XMAA 4B47A 3D0GE 3M9OB 2NOGA 2HKOA 3DBLB 4RR5A 2J9CA 4P9SA 5K7ZA 2E9ZA 4DCOB 3PX4A 1WF1A 3MAAB 3D54A 1HNZF 2CQCA 2VFTA 1LKZA 2J9DA 3LSJA 2STTA 1R31A 3C19A 3FMBA 3AAFA 1C0UB 3IXQA 3M3YJ 5K9FA 4DS5A 3HVAA 4MGRA 2VOPA 1N54B 2AW0A 1SEUA 4PXCA 2CZ9A 3WTTC 3G8SA 1T02A 3R1HA 2ZUGA 2HFNA 1HPZA 2XAGA 4UUXA 1D1BA 3BSOA 5D8KB 2KH9A 2F48A 5E2QA 5KFBA 4XDCA 3AB4B 4J5OA 4M63A 1JUPA 3OR1B 2DH8A 4N77A 5J2PA 2LYCA 1C1BA 3DHXA 2GFFA 1RYSA 4L6V3 2UXCF 3TYTA 3NGUA 2WRMA 1J5EF 3DU6A 2LXUA 2AX1A 4X64F 1SC4B 2G9WA 4RB3C 3LOUA 1N0UA 1W36C 2HS3A 3OYJA 4LB6B 5CA5A 1FDBA 1HBOB 1ZM4A 4JI8J 3CJ3A 2O9LA 2PJPA 1VBZA 3MCOA 1VQ8S 3NXZA 5JVGF 2AEJA 3KLEA 3HKZN 1J5YA 3KP4A 4Y2AA 5GTHC 5A8WA 3MWBA 1PYVA 2VJIA 1TU0B 3D3BJ 3Q8UA 4USMA 4WWSA 3FBBA 3V6DA 1X8DA 2ERRA 4K0KF 1VZ0A 1RWNB 2XO7A 5KFFA 3OVBA 4PZVA 2NR0A 1FXDA 2MJNA 4RLFA 3RQ4A 1RWVB 4DOZA 4RS8A 4UHTA 2WAFA 1MWYA 2QIFA 3CQZJ 4RNMA 3F72A 2MLXA 1YSJA 1W4MA 1WG4A 5GTIC 1RKWA 3F6OA 3GVAA 4WFNQ 4BH9A 2GO8A 4DI6A 3NMAA 1U5TC 3K59A 3SI8A 2BQUA 3KYDB 3WTUC 4WZQA 1HI0P 4ED8A 2X7IA 4XIUA 1GV5A 1YHQI 2QA4G 4BJ6C 1Q8IA 5GAHJ 1K1QA 4WWCA 2F2EA 1PILA 3KLHA 1NKCA 2BYVE 3I64A 4CTAA 2XGQA 4MEYF 4E7SA 2DYSH 2Y0SA 4DX6A 2HHUA 3BOQA 3HTUA 2VJJA 1B4SA 5J3LA 2CJBA 5A8RB 3ZXSA 5DJBA 1EKEA 2K9NA 1FMWA 4A8MP 4XOPA 3F0NA 1MZBA 2D3O1 1RCXB 1JNZB 2DK5A 2MZTA 4BQOA 2K2PA 4FYXB 4XSXF 3E5XA 2ROPA 2Y9YA 3PFEA 4C8OA 2F8HA 5HLTA 3GCWP 3W1YC 1FYMA 2W2NP 2DDBA 2ELJA 2B8QA 5CABA 5D3GB 1RADB 4OZ0A 3HGYA 3VGSA 5J2MB 1NEEA 1OS5A 3NS6A 2V1XA 2J5OA 3BDDA 3KG0A 3BZQA 3FXUA 3RKXA 3FRYA 2KIMA 3BTIA 4LK1F 4JI4J 2NS1B 2A6MA 2WSFC 3DPTA 4JB8B 4XN0A 2XB5A 3CUOA 1T08B 4DQPA 2B7EA 2B4UA 3A8JA 5KFDA 4ZVFA 2VKVA 1HLWA 1VIXA 4G12A 2R3SA 2XROA 2CSOA 3EPIA 5A76A 2SXLA 4MO7A 2QL7B 2RE1A 5IOLA 2ICWG 3EX7B 3PM1A 2CQGA 1PC5A 2XHWA 4FQGA 2FIUA 2XY6A 4P7VA 3OS2A 3FMWA 2LLZA 3TVKA 4A3LJ 2KT3A 1VQKS 1U1QA 2M9KA 5KFCA 1X5TA 2VIHA 3HT3A 4NC7A 3W7BA 2VI6A 5HLGA 4F4ZA 2WAQD 6FD1A 3B02A 5B0DA 3C66A 2K4JA 2MTLA 2B0GA 1JKHB 3I55S 5A8KB 2AYMA 2MC4A 4KT0C 1UWAA 2CJAA 2AJ2A 3MM7A 4URQU 4JX5A 4HL9A 3WE3A 2IVYA 1D8KA 4HA8A 4QPTA 4AD9A 2R2RA 5FO5A 3IRXA 4C3LA 1N56A 3V6HA 1YRTA 1KRPA 4ECXA 2CUEA 1UVIA 4CLSA 2AV5A 2QLJB 3LAKA 1BQNB 4KHMA 3HOVJ 4EJTA 3PYDA 1T0TV 5D0EA 2FQQB 5ETSA 2R92J 1DGRM 1IUJA 4K2XA 2KHDA 2RQKA 5G0RA 2I8EA 4IHTA 2YWGA 2PX9A 3IH3A 2DR9A 4CYUB 4RB2C 3PNVA 4L0ZB 4C8KA 1EH8A 1S0MA 1F2GA 2MJUA 4BQNA 2C1EB 2JA6J 3EUHA 2A69F 2EFPA 2BJ7A 1S76D 4RAZA 4RBOA 1UWBB 4YS2A 3OTEA 3GZNB 5F8HA 3V2UC 3K4BA 1AUSL 2LFVA 2ZB9A 1F5AA 2CADA 1F9EB 1ETKA 1IKVA 4PGGA 4CUGA 1RISA 4BJ5C 2B4PA 3MKLA 4DSLA 1UAAA 2OPQB 4I6WA 1J5OB 1HSJA 1YE9A 3UKGA 1FA0A 4HI2A 2HQGA 1QHGA 2ZD1B 3W6KB 1KD1T 3KP7A 4QPOA 1VQ4I 1PAUB 3SV3A 1G3OA 2RNEA 4XO0A 4O5VA 4G7HF 2W01A 2DLLA 1HWUA 4IHWA 1GNKA 1NSPA 2P9EA 4IDKA 3I58A 5E20A 2QBYB 4GYGA 4IKAA 3S2HJ 3SFZA 4Z2YA 2X1GA 4PXEA 3GILA 4LF6F 1S6PA 2C6YA 1YW8A 4WE1B 3AODA 3K5OA 3QQCD 1ON1A 2YH0A 3MECA 1U5TB 1WC1A 2QYCA 1WGXA 4TU8A 3KK1B 2CPYA 1HWIA 4Y3CA 3OYCA 2G0CA 3M1VB 3MEGB 1BC8C 3O2PE 2UUBF 3TRGA 3CJ5A 3RCOA 4KITB 1VQ5I 2QMXA 3BO2A 4E7IA 3GYNA 3PVXA 4CSWA 1XX5A 2ZSHB 3A02A 3LF0A 2BE2B 5IWAF 1S9EB 2DITA 4PWDA 2Q3PA 2WSEC 4XLFA 1HWLA 1MMGA 4M73A 1UFKA 1I5ZA 2F1FA 1WHUA 1DTTA 2AWZA 2QLFB 4ZK7M 3PV8A 2RV8A 1HNXF 3NGRA 1YJ9I 4FF3A 4BXUA 4NA3A 3N79A 4ZCKA 2QFJA 2FLNA 3RYPA 5DLGA 4NQWB 3QU3A 2G0IA 1SXLA 5KFJA 3K2YA 1VQ9S 1CQTA 4MQVA 2IS1A 1FWLA 5KFGA 4DJBA 1HKQA 3HHGA 5E3MA 1Y5NB 4RW9B 4I99C 4LBPA 1VOMA 4XSZF 3GONA 2CZ4A 4MHGA 5EYRA 4DL3A 1H74A 1NSKL 2GIZA 1BQMB 3H2VE 4PUSA 2A3JA 1OCRH 5HNFA 4ENNA 1LW0B 1I1GA 1CJTB 2E5LF 2KJWA 3C2PA 1P1TA 5D77A 4ZA1A 3P45B 1HDDC 2LVWA 2O5RA 5FKMA 3RBEA 3X1LB 4UZCA 4DGWB 2YNHA 1I27A 4KMFA 4LMYA 3MMAA 3OUYA 3HRUA 4GCVA 3EICA 3BEGB 1LEAA 1VR6A 2RMLA 2VKRA 2V9WA 2R8HA 4PJ0C 3ISZA 4Z37A 1DP7P 1R8BA 4WXWA 1XR5A 3S1NJ 2A18A 2W9CA 1N48A 3VAKA 1APLC 2KIFA 4DV7J 3QRPA 3HUGB 4YRVA 1XSVA 4ZVHA 4ECUA 4L73A 4XLAA 2B7CB 1ERDA 3LP1A 4PEOA 4PYAA 5ETQA 2KZZA 2XRLA 4CQ1A 4TY8A 4CLUA 5CCLA 3ZMSA 1DTQB 1JLFB 3C15A 4ZDNA 2J7KA 2L48A 1AHDP 3HZGA 2AHQA 2DA5A 3JXOA 4BGDA 2VKHA 5E1ZB 4XR6A 2ACJA 2XLJA 3LPEA 2L54A 1U5TA 1JJ4A 1X3WB 5L3BA 2ZH5A 1FFWB 2LDUA 1KOOA 3MPDA 4XN3A 5CYMB 3ZZ0A 3RB4A 2LEAA 4LITA 2O03A 2C3PA 4U6PA 3C7JA 1UFMA 2NS7A 1R58A 1O3TA 1RHUB 2OJ3A 2BYCA 3PO2J 4USHA 3W3CA 4FYVB 1UMQA 3NKYA 1R43A 3WG7H 5GPCA 3FBNB 1MBKA 1WSRA 4OZ2A 1NUEA 1CQNA 1FMVA 2XYPB 4BE1A 2DXFA 2VG6B 3WHCA 3D68A 5E5NA 1WORA 4CH0S 2NNNA 3AB2B 2VU5A 1C1BB 2ZHBA 3I0RB 4DFMA 5EDWA 4CLKA 4DBQA 2JZ5A 2AJFE 3ZQFA 1QUVA 2NUHA 1S99A 2KHCA 2M87A 2IGMA 2O8KA 3HC7A 4CLWA 3LOCA 3S01A 3ASNH 2Z57B 3OW2R 4X4RA 5A8RA 3K0LA 5EX3A 1OQ6A 3IGNA 4PXBA 5DM6Q 2UUAF 4F3QA 2DR6A 2ZCWA 2W82A 3JCUC 4ANDA 4ZIVA 3PW7A 3LO3A 2B5JA 2P7VB 1SV5B 3MTKA 2M0CA 3TOBA 3BR6A 2R5ZB 3UDCA 3GX4X 2EC2A 2BW2A 2N3LA 2I8DA 1TL8A 1EAYC 1S12A 2XMVA 2NREA 5KG6A 3EZOA 1AZSB 2Z56B 1S6QA 1BLUA 1U24A 2VB6A 1WC6A 2W1OA 1M1HA 3MMBB 3K5NA 1E6VB 1J9IA 4LR9A 4FTHA 2C2NA 2OHDA 3K0JA 4LIRA 5GAGJ 4X6AJ 4DR5F 2OI2A 1J0RA 1IBKF 1T0FA 2A3SA 5D5WB 3W9IA 4DX8H 2KVQE 3OR2A 2WAEA 1ZARA 3LUYA 2VIXA 1KN6A 2R7TA 5AIPA 2BJDA 2KZGA 1ITPA 3GZ6A 3EXCX 3MM6A 3KG1A 4QPXA 5LFAA 4BNCA 5H9FJ 4EM2A 2DNRA 4LSLA 1EB0A 5J2QB 4KH0B 5HN0A 3V81A 4X62J 3E97A 3D5SC 5KFSA 1XMQF 1YW7A 4DN9A 2E36A 2YNFA 2STWA 4P71A 4HEA9 3GFJA 3CF5F 2FZCB 4AUKA 2IRFG 3OSFA 4QWDA 3FK6A 3BGUA 1T98A 5ETMA 2BXYA 4K2JA 4HR2A 5FLMJ 4KV8A 2E1AA 3GZ5A 3C1DA 2V4QA 2K40A 1AROP 1K47A 2AGQA 2HFZA 2HS4A 5LGUA 2I5JB 2R5ZA 3GE9A 4Q45A 1V5FA 2MLKA 1RWMB 3TJ8A 5KT4A 4Q43A 5A0YA 3HT0A 3KEOA 3IM8A 4YHHF 5HJXA 1HKAA 3GR0A 4KMUX 3I53A 5CQGA 3HSZA 4V19X 1AKHB 3WGHA 4HPQA 2VDIA 3HHLC 3CCUI 4B3RF 4M5NA 3S7RA 1NDKA 1SIZA 4IFVB 2DHSA 4LIUA 2L7ZA 3DGPB 4J7CA 4DX7A 2ZVIA 2W00A 5MLCV 3AJ1A 1VI0A 4TY9A 4XPCA 5E79C 2QENA 3RW6A 1GT8A 5JMNA 1TELA 3KXDA 4CM2A 2XSJA 1P8GA 4HLBA 4V1Ak 4O6JA 2ZJPQ 4JYAJ 3B73A 4CTAB 3G71S 2CUFA 3QIDA 3D67A 2HDDA 5EWFA 3KWMA 1OCOH 1L5UA 3LSPA 3K70C 2H51B 2HBQB 3QODA 2EH3A 1JLGB 1JKPC 1U6BA 4Q4ZF 1DDNA 4G1QA 3WZ0A 4QWAA 4M9SA 5CPRB 3D28A 2JSXA 1R4MB 3IBCB 4QSHA 1FK9B 2IGNA 1NPRA 4OI4A 1SVLA 4NB5A 4PQUB 5CVVA 5I42A 2IM1A 3CCLI 3C3LA 3UDEA 3UI3A 4IR9A 2HNYB 3JRBA 2FHMA 4Y0FA 2VASA 3DOLA 5DS9A 2JL9A 2JJ7A 3JW4A 3UN3A 3BG7A 4I1TA 3CULA 2PFFB 1HDPA 2Q8KA 3NQOA 1SAXA 4MYTA 5D15A 2MFZA 1LXNA 2E2HJ 3KUEA 9RUBA 2FNPA 3KDNA 4KFBA 2FA5A 1T38A 2W85A 1IN4A 1WTBA 2ZH2A 2WAQA 2DU9A 6FDRA 4NYPA 3HULA 1JLAB 3RI4A 2MQ8A 1X4BA 4WBFA 3WGIA 2Q66A 2HWVA 3L2QA 2Z2MA 5F8IA 2RQPA 1WEZA 4PZJA 1IV8A 1U8RA 1B70B 4G9YA 2AEFA 1KLMA 2VOOA 4LBHA 3GTYX 1MMAA 1CC7A 2H1YA 2DB1A 2DGTA 2FD5A 2XULA 4DR1F 4J9NA 1KKHA 1HQUA 2EVZA 2M8GX 4O3QA 4IRGA 2L08A 4RO0A 1F43A 3EM1A 5DETA 4RW7B 1T9WA 2Z2SB 1PP7U 2HK2A 1PVEA 2V9KA 5L8RC 4P73A 1D0YA 4CCMA 3V7SA 2XRNA 3GIRA 1PDNC 5AE3A 5I3UA 4HV5A 3I0SA 1UAWA 3CUQA 3AG1H 2VPLA 2YWEA 1JX4A 4DZ6A 4RJVA 1PUFA 3CDAA 4C48A 2F6CA 2PA3A 2ISZA 3O8HA 1WTFA 2XYHB 2WCXA 1V9OA 1W0TA 5ICGA 1U0HA 1BI0A 5KFXA 2VFRA 3M8JA 2E34A 5ETKA 4USJC 3M1EA 1X2MA 2MD5A 3UN5A 4A0YA 1J75A 1EJ9A 1T3OA 2L9DA 4B3OA 1Y0UA 3K7RA 3VAIA 4YY3J 1JLAA 3U02A 2KYXA 3UCUP 2ECBA 1HQUB 2BZTA 2C2EA 4DR6J 1DFDA 2KL4A 4KKOA 3PCOB 3OLBA 2MXYA 1AWCA 1F9HA 3SDEA 3P9IA 3ABMH 3D7SB 3QJJA 4ETXA 3NRBA 1RBOB 1HA1A 1K6YA 3PFOA 1UG0A 2L7FP 5J8CA 2UUAJ 5B0AA 1CC8A 1B7YB 1CF7B 4M3GA 1A36A 3A3OB 3DEEA 2VPRA 4DL4A 1OSCA 1DUXC 4M9XA 1RRJA 2I0XA 3CCTA 1MBJA 5T41A 1Y3KA 4RAGA 3KHHA 4ECVA 4H4KC 2LKSA 3D6FB 2B4OA 3DTIA 1TL4A 3GTMJ 3H7HB 3M2RB 4B4CA 3R7BB 3ISPA 2XVCA 4AC0A 2CA9A 4CO8A 3HEFA 4GO5X 5CYVA 1LWEA 3B4DA 4UY8T 2FJ1A 5E3NA 5HS9A 2E5HA 2MKCA 2UU9J 1FEHA 3NGKA 1NB2A 2J0WA 5AIQA 1LB2A 4TYBA 3TARA 1HHTP 2GIVA 2JOQA 3ILOA 1T9TA 5L1LA 2A68F 2E35A 1YI2I 4P5OA 2CFOA 3THPA 3QYBA 1G8XA 2DK2A 5E3CA 3DN9A 3UD5A 3U27A 3T0YA 2MHEA 1LDDA 2ZOGA 2ROEA 2R8GA 3AD7C 2QA4S 2HGNA 2NXEA 2LXFA 3T6JA 2J8SA 3R2CJ 2D9PA 3CD0A 2K3FA 5EDNA 4RBTA 3CCUS 1RUNA 2DA7A 2OTLS 2DNYA 3T1HJ 3I6PA 2BJ1A 4EATA 1RAEB 1ZN2A 2PD1A 4KYZA 2ATLA 4DV5F 2HK3A 4AIKA 5IQ6A 1OR7C 2GOMA 1S1TA 1FJGJ 1T9YA 3M6WA 3ZTOA 3J81U 3EE3A 3F23A 2LY2A 3CJTA 1TKTA 3DHWC 3WIUA 4C2TA 1LPQA 2FUG9 1HW8A 1T3NA 3WODF 1H3DA 2E1MC 2DH7A 1A6LA 2YU3A 2CGPA 3BG3A 2MQOA 3J7AO 2D2WA 1OO0B 3QRQA 1Q7LB 4J9OA 2HBYB 2W2QP 2BJ8A 1RLDA 2HNDA 3FJ2A 2Z16A 5AXLA 3M05A 2FXAA 1NJXA 4NRTA 1NSAA 3HJEA 1UG2A 4P9UA 2A6TA 4TXSA 4YMEA 3VQTA 5HVHA 4LFCF 1R0AB 2LVSA 4NWBA 5H6QA 1UL3A 2HGLA 1GK8A 3CCMS 2H6BA 3H36A 4HRIA 3WIVA 3S3MA 4OMFG 5D8LB 3A3PB 2EC0A 4B3TJ 4CLFA 1RA6A 2MYFA 1JJ6C 1FKAF 3IHUA 4PFPA 1AT1B 1VQPI 2CRGA 2MSSA 3Q0UA 2FC9A 2HQFA 3N4MA 3V5RA 1YJWS 3UR0A 3L2UA 4C98A 4ZTFA 3CCSI 2YPYA 3MPVA 3RAXA 3J80U 2EFGA 3PIPF 3Q0AA 4B3TF 2FJWA 2F5CA 3DEUA 1ONVA 3JAMY 2UVUA 4A8YA 4C2MA 4KQZA 2YR2A 1U8BA 3V8LA 2YKNA 1XMXA 3KCCA 1ZR4A 1BWVA 2VJ4A 1FX2A 4ED2A 3F0CA 1G3WA 4GRIA 1OY8A 2DIUA 4NLRA 3B78A 3NNCA 4C30A 1CJVB 4CH7A 2V69A 4ID5B 1A0OB 2MZSA 1X0PA 4JI2F 4A3EJ 3D6TB 3FHZA 4DJAA 3GV7B 3EUHC 1SH2A 3QQAA 1WC0A 1XC9A 4U96A 4CZCA 2KKOA 1Z6TA 5FD6A 2VFVA 2EBGA 2M4KA 2JEJA 5KVRA 2QEXS 1BQMA 1FRJA 3K70D 4U7UK 3RAMA 5DS7A 3HVRA 2EWHA 4F3OA 3GF2A 2M2BA 4D3HA 4G6QA 3V8JA 3UQSA 4IZZA 5DGAA 2G0EA 4IQ4A 2QV6A 2Z2YB 2R2UA 1P4AA 2J6SA 4XKWA 3MUTP 2VT2A 1WI8A 4DV2F 1X0FA 5D4SA 3ET6B 4NLPA 2RB7A 3TOQA 1FIAA 2QL5B 3GCMA 1BC7C 2PI4A 3KE2A 1RTJA 3DRRB 1MROB 5K8PA 3DKWA 5F0WA 5KAFC 3NEUA 3SCJE 4ECZA 3DTKA 4M5JA 4F04B 5DG8A 3HG9A 5GAEU 2KISA 1S79A 4DV2J 4J00A 1K6OA 1VQLI 2AXLA 2RU9A 4A8XA 4ECSA 1CLFA 1IO2A 3V42A 3PL8A 2CS3A 4ER8A 1FDDA 4O44A 2JHEA 2PMZD 2IGOA 5I42B 4RGRA 3Q5FA 1ZREA 2AGOA 3OS1A 2HQCA 2JQ7A 3DM2A 4ESFA 4BS9A 3EWGA 3OHBA 2ZH1A 2G2YA 3NWSA 5J1EB 1XDSA 1CS4A 4O3MA 3QYFA 4KDPA 1FP1D 1GX6A 3E6BA 3AA8A 2V4JC 3S8SA 1GAOA 2JWNA 1REGX 1OYEA 2D1VA 3Q9SA 1BGXT 4PSXA 1OPZA 4J9QA 2I2YA 1RWKB 4PAAA 4TY8B 1ETYA 2CUJA 4J9RA 2G2ZA 3U1NA 3MR6A 3FCVA 4I2OA 3SQNA 1ACIA 4HT5A 1KP6A 1GVJA 3MAAA 3MMCA 4EGYA 1WG1A 4LF5F 4DNCA 3NARA 2QG9B 2MG4A 1HNIB 2HYGD 4IKFA 2W7AA 2IBKA 4EBCA 2F40A 4O44B 3HOXJ 1SH0A 2N82B 2HZCA 3PNTA 5ICFA 4J9SA 5LSLA 3JRDA 1CULA 2XPUA 3JB9k 1YOVB 1R6YA 1IXRC 2FZKB 4DU8A 2DGOA 3MEKA 2H54B 1N6QA 2HVZA 1JXSA 2DT6A 2RN7A 1BJZA 3DI6B 1JLCA 2PJRA 1YZ7A 3EGVA 1HWKA 2CG8A 4A2UA 1O3QA 4CIOA 2OTLI 4NYZA 5CYMA 1SC7A 2KQRA 3M4XA 1BQNA 1YS6A 4MH8A 1NDCA 3CTRA 2IW5A 1TWFJ 4BLGA 3LPYA 2DMQA 4JBCA 2ZMEA 1Y0HA 3SEOA 3I54A 1SD7A 1XCVA 2EINH 1IJWC 2JFDA 4DCPB 1J2VA 1FNMA 3QGPA 4M1KA 5BQTA 3HSRA 4IOCQ 1N52B 2HHSA 2RF2A 2XMWA 3GO5A 3HOYJ 1RQ0A 4QIWN 3H4DA 3BR2A 4QLCU 2NSCA 3FKJA 4GKKF 4MKBA 1IW7F 1KQSR 3GTOJ 1KQFB 4ETZA 1DLOA 4USVA 1G3TA 3W2AA 1N75A 3CWJA 3GLXA 3U7JA 3QPSA 4NI2A 2CWKA 2QLWA 4OI2A 4L5IA 2FMYA 1O8BA 5HROA 4YFXF 2DTZA 1NK4A 3ABKH 1Y8QB 1JXLA 2IBOA 4ZVOB 3H25A 2XASA 4L9TA 1WI6A 1VQNS 1Q1HA 1P9QC 4L18B 3M2RA 1NCLA 1J09A 3V4GA 1SFKA 4F8RA 3DBHB 1T9VA 3MTJA 2HS0A 3U1KA 4J9LA 4TLQA 3GR1A 2W4DA 3CD6I 1GX5A 1SJFA 3PEHA 1W2IA 3X3UA 3UVJA 4P72A 1N77A 2VBXA 1BHNA 2R4GA 3CESA 4QWBA 1Y56A 4C8MA 2ETHA 3IH4A 3GCXP 3ZQQA 1JLCB 2X85A 4B8XA 5KNLA 5E0OA 2O5DA 4X4TA 3A01A 2F8MA 4ELTA 3OL8A 2LYVA 4I2PB 3M8EA 1YYVA 1IM4A 4YFNF 2OPPB 3HOWJ 3MPYA 2ADCA 4DHVA 1VIOA 4IRCA 3I0RA 5IP6A 3DLLF 3FHNA 3PQKA 3TANA 2AQEA 5H9EJ 5EZHA 1S9HA 4Z7YA 3ZMTA 3B4MA 4UF4A 2NVYJ 2BY1A 4N9HA 1K4TA 4KJZA 4R8UB 1JJCB 3R7SB 3KLEB 2H9ZA 5I3PA 2OUGA 1GXLA 2XMUA 1HI8A 3OBIA 2OH2A 4RNOA 3ELHA 1R1VA 4JV5J 2KG1A 4OZNA 3WX8A 2L9NA 1KGSA 3MQ0A 4K4TA 2Q1ZB 3M8ZA 1ZGAA 1S6UA 1BR1A 3PIOQ 4JP0A 3HTSB 1XR6A 3H4BA 1SI9A 2EKYA 2WVCA 4CP5A 5F08A 5BOXA 2CQ0A 2XC7A 5TGTA 3DPUA 4F91B 1EH6A 2GAUA 1SVOA 2V1UA 4BHQA 3VFZA 3RYRA 2KRFA 2D1CA 2QJ3A 3OXFA 2V4JB 2HMIA 2BKPA 4FN5A 3QZ8A 4JI2J 5LSRA 4RWWA 2QCOA 4KPCA 3G1OA 4OU0A 5LXRA 4A8WA 3C6TB 2M4GA 4C11A 2X1FA 3Q22A 2VBYA 1F6TA 2HQDA 1N5SA 1EQMA 3DWLE 3PYEA 1ULYA 5JLXA 1U1RA 4ICLB 4LOCA 1GHCA 4GVLA 3MR3A 1CGPA 1IKYB 4LF7F 3OTOF 4O23A 1W7PA 5ETNA 2BA9A 2GVDA 4JI6F 5T7LB 4ZJZA 3PR5B 3SXLA 1K1SA 2CW8A 4GYIA 3HI9A 2BW3B 3HSEA 2PFDA 3GSDA 3OTOJ 2XGPA 4JV1A 3PQJA 4JI6J 5FLXY 1FESA 2LQBA 3MEXA 3BR5A 1JXVA 1ROFA 3EPGA 2XI3A 4NCAA 1ETQA 3MKYB 2XBPA 4U8YA 4NXMF 1S49A 1VK8A 4A3DJ 2DQLA 5M3FJ 1V3FA 2BQRA 2BXJA 1V3RA 2HG4A 2GGPB 3VOEA 1R6RA 1OCZH 3H92A 1IG7A 1M5PC 3H0DA 4AD6A 5K7FA 3F56A 1F4KA 3DLKB 1TAQA 4EO6A 2OIHA 3TWZA 1R36A 4WFAQ 1KTVA 2KRHA 3OXGA 5KFKA 1IWAA 2OC6A 1PUFB 1H9GA 2OD5A 2BV6A 3OYHA 1XSXA 4XK8C 3PW0A 3L1PA 3CSKA 2BE2A 3CJKB 4CO0A 4ECTA 3HKZA 1TP7A 2GS8A 4GC6A 4MFBA 4X4UA 1KR4A 2LBFB 4LBIA 2UXDF 1X4PA 3BREA 4B44A 5GVQA 3MM8A 2XMMA 3P96A 1RT7A 2LFBA 3CCQS 4MIWA 1SANA 2WVEA 3M8PB 4DFKA 1U1MA 2ASJA 4X65F 3KLGB 3DNCA 1B8IA 4AVZA 3G1MA 1FTZA 1Q5YA 3OYAA 2FOWA 2K85A 3J7A1 1N5YB 4EV0A 1JNRB 1NMEB 2HSEB 3R6SA 3RW7A 4OYZA 4IRIA 3TA1A 3T8RA 4V2GA 2HPIA 2BJEA 5J40A 1HNWJ 2HHHJ 1H88C 3KLFA 2HR3A 2MMYA 5SZTA 4XLEA 1N0VC 1S6QB 5A0YB 5EX0A 4P74A 3HXLA 1RAGB 3AHPA 4NLDA 4HF2A 5FKOA 5LGNA 2A07F 1G7CB 4XK4A 1N33F 4EZ6A 1T9XA 1PC4A 4DYCA 2HURA 4ZHRA 1RWOB 1VNDA 2G4BA 1KVIA 1KQKA 5HOOA 3TQ1A 3RTVA 1RAJA 2BQ3A 3AL0B 4Y28C 3TEHB 3BM7A 4AIJA 1NH3A 2B6AB 2M5WA 4RWXA 2ZH7A 4B02A 1PYOB 1RAFB 2HFSA 1T9UA 3DMJB 3DFEA 3RKYA 1FEXA 3FEZA 4QIWD 4XRSG 4DQQA 4A3GJ 4LSLB 4QW9A 2HOTA 1YLXA 1FLIA 2ZC4A 4M5KA 1FIPA 2BMBA 4ZLLA 1VRUB 5ILSA 3T1YF 1FSHA 3N97A 3RPUD 1DU6A 2DW4A 3I3LA 4PFOA 5LJ5Y 3HKZD 3WU2C 1IN5A 3MVPA 1GV2A 3K17A 4LLNA 4NXNF 2MZ1A 2DFFA 2HWIA 3FUYA 1VQPS 2ISYA 1DBDA 2WY7Q 2E5NA 4JBAA 1ZKGA 4RUBA 3HD2A 1MU2B 4WTOB 1YS7A 2E19A 2JWTA 3VZHA 2VQLA 3OMYA 2YKMA 1P4WA 4LF9F 4PCQA 4DR4F 1VMBA 3FXRA 2R2TA 3MURP 4F25A 1S48A 1RHMB 2CPDA 3VTIA 2Y30A 2CJ9A 2HMIB 3GJQB 2N4CA 2DA3A 4GRSA 3CEDA 1EX8A 1FXLA 4LF9J 3NAUA 3SCLE 4G94A 1FVQA 1GXUA 1S5LC 3AXKA 4BQQA 3NMRA 4DLGA 3ICLA 3MCNA 3Q8SB 1WJFA 3MR2A 1X4CA 1RT5B 5KT6A 4ZVTB 2DVIA 3HOTA 1BC6A 5JLWA 4RBVA 1TT0A 2PMWA 2RHSB 5ILVA 2R8KA 3KX2A 2YNHB 5B5EC 5IT9Z 3PKMA 4GMKA 2XS7A 4DPYA 1BI1A 3BTLA 5F1RA 4LFAJ 2XIGA 3UO0A 3K5MA 3VSKA 4NRUA 4UXNA 3M32B 1YGYA 1ZAWA 1F60B 1LVAA 4RDUA 2MY7A 1B72A 1URRA 4MKVA 2E1PA 3RBXA 1VBKA 5A2QZ 3K1MA 3HD1A 5KFYA 3LQRA 2V26A 3HRSA 4ON0A 3IM9A 4S05A 1STZA 4J9KA 2KMUA 5L1IA 3OJSA 2IIHA 2HBZB 2M9HA 3L3CA 1A04A 1QE1A 4NYOA 4K50A 2IGKA 3ZXWA 1YX2A 2WADA 2J0QD 3FMQA 3QOPA 1NO8A 2FDNA 5GAGU 3I0SB 1ZBTA 4RW8A 5CYQA 4RBUA 3KPHA 4L3NA 4BUPA 4JI7J 5HJYA 2C2ZB 3H5NA 4QCLA 4C0OC 5HS7A 1Z91A 4RPFA 1GVDA 1KU9A 3BH7B 2APOA 1HBMB 4AYBA 3C18A 2KT5A 4IG0A 4CRJA 3RAQA 1N34J 5HSPA 4JI7F 1SVMA 2GLOA 2V6CA 5RUBA 2WHOA 3LWMA 1DZ5A 5J1RA 1TT5B 3J7Z5 4CLYA 4NLVA 2LQ5A 2LQ9A 2KKHA 5BYQA 2XY5A 4LFBJ 2YWKA 4ELUA 3CT9A 2P8IA 1H2TZ 2ZWPA 2KB2A 4M8LA 2M8DB 1O51A 2LEPA 2V2QA 3RDIA 3A3NB 2VD3A 3VAGA 4OIOF 1P4XA 4R0EA 2V34A 4JX4A 1NG7A 3KJNB 4BWMA 2CQHA 3V6DB 2DGSA 4EBDA 2V8DA 1N36F 2NCKL 5EWEA 2LKZA 2EW9A 1QDUB 3RRKA 3LALA 1TK5A 3F21A 1WHYA 5KFRA 3Q23A 1Q4RA 1X60A 3I56S 1T7PA 2VPZB 2YNGB 1I6HJ 2MGQA 3TW7A 4KRWA 3CLQA 1SMYF 2MA3A 3HPGA 2IC3B 4CCLA 1UB9A 1RETA 2NOJB 1IRXA 4B48A 4WF2A 2N7YA 3KIOA 5FD5A 3A8IA 5E41A 2ZO4A 3KHRA 4OYPA 1L3UA 3MEEB 1S1WA 2LR8A 4LSZB 1I50J 1PCAA 2PEXA 2VJVA 5F0FA 2L7MP 2IA0A 2XSDC 2CU7A 1N5VA 2CQ1A 3NP5A 3EGWB 3R5AA 3UD3P 4ED7A 1FI4A 2RKIB 3MEDA 3DLBA 1RPWA 2Z58B 4IH5A 1YO5C 3RB6A 4JI1J 2AJ0A 1HW2A 4G1PA 4ZS6A 2ACMA 2K4BA 1N5YA 5U47A 1DJ0A 4IPAA 4KFCA 1S6PB 4HX7A 2VA3A 1EZZB 4Q7AA 3RPQA 2GZWA 2LDYA 4DR7F 4URSA 3DGVA 3PW5A 4V19J 3BR9A 3UNYA 4MT1A 5B1AH 4PJLA 1V4RA 3KYCB 2BHZA 2VQEF 2J5AA 4ZZDA 4IOAF 2JC1A 3K57A 1H38A 1YHQS 3TDZC 3MMAB 4IHSA 3K4KA 4TU7A 3LSRA 3K4NA 1UELB 5AONA 4DR2F 2AP6A 3W3SA 1WPKA 2HHQA 4HDUA 4LF8J 1SIWB 3EDPA 1FJ7A 4EI2A 3G6ES 2W9CB 2X3GA 2CWEA 3O6QA 3MN2A 3KLIB 1TP4A 4OHYA 3BWGA 1A31A 2F63A 2V2KA 3QSYB 4OWRB 2DHXA 4U7DA 3HSGA 1EH7A 2RNJA 3H42A 4X66F 4X4QA 1U1KA 1J7KA 2FVCA 2PDAA 4HLYA 2VG7A 4JOMA 5IV4A 1L3KA 4XONA 4G8XA 1ZPVA 2M2EA 3ZP5A 3MR5A 5HVQC 5E1XA 1S7HA 2I10A 5D8HB 5EJCA 4MFDA 3FXKA 5K5RA 3ECOA 3PRDA 2D41A 4I7FB 1IC8A 4Y2CA 1B9NA 3LP2B 1FJLA 4YEAA 1RT2B 4LK0F 3KP6A 2DPUA 5LBQA 3FZBA 1RTZA 1XQIA 3NY0A 2XY7A 1U25A 4PUOA 2ZOFA 4LD5A 4D5CA 3EDQB 1F2HA 2NXUA 5ETTA 4L72B 3VGUA 1DPUA 5KFOA 2XB2D 1VBYA 1YTYA 3BO4A 2W2PP 2NXCA 1BA5A 3GFIA 4C0BA 3HLUA 2CVEA 2NUUG 2ASLA 2QWWA 2YUSA 2RDJA 3CVKA 1Z0XA 3GSIA 2VG6A 4DV0J 4DR3F 3D0HE 3A4CA 1HW9A 5DQIA 4PPDA 3SZPA 1JHFA 4BEHB 1Z6RA 4BDZA 1DARA 4M74A 4ENMA 1MMDA 4IF4A 3RBZA 1FSEA 4NEZA 3HSFA 1IF1A 3CCJS 3B8HA 4IJAA 4DUZF 1TNTA 5CD4H 2DT7B 3HHHA 3TOAA 1HOMA 2MDAA 4BACA 4HT7A 2MKKA 1VS3A 1TZLA 2A5WA 5GADU 4U87A 1R9TJ 2MW8A 2MY8A 1C4AA 4OYMA 2NS0A 4LG0A 5HVFA 3BJAA 4HTIA 1FRKA 2KIQA 4ECWA 1SKSA 1F0XA 4X62F 2IM2A 1S9FA 1G3SA 3OL3A 1MMNA 3JR9A 3LGNA 3AOAA 1S77D 3IR5B 4ATNA 2IAIA 1S29A 4FT8A 1WC4A 1S6LA 2FU4A 2QBYA 2FF4A 4L0YB 4F52A 2NZCA 4PG5A 3BQ2A 1KQ8A 4L74A 3BBCA 3JYTA 2NYHA 1RAHB 2ZM6J 3CXCR 3JS9A 3HKWA 2HFUA 3NLCA 2XSFA 4OHWA 2IMOA 3F73A 2YKQA 4DV4J 4FX4A 2HGMA 4C97A 1LDKB 2EFNA 4FNHA 2ABYA 3OYLA 2QLZA 2JK3A 5A2QU 4MK9A 5L9XA 4D3GA 1FTRA 1QRYA 1AA1B 2CPJA 2HQIA 3DYAA 1BI3A 4UQGA 3KDOA 3W60A 3TZYA 3DDKA 2BACA 5IYCJ 4LF4J 5E1WA 3SYZA 2MD0A 1DQAA 5HMZA 3MFKA 2HYIB 1QLNA 2O3DA 4FBUA 4DWIA 2ZUAA 1VK3A 4DPOA 2EV5A 3S32A 4OYAA 2IHR1 1U6ZA 3H5SA 5K1YA 1ZA2B 2GWRA 4HH1A 2RGVA 1JK9B 1UMJA 1FP2A 4OZ1A 3H5YA 1Q78A 4P2XA 1HFEL 1VLYA 4TQRA 2KM8C 4HDVA 2DH9A 4WP9A 4F4YA 2F7VA 1IKWA 4CDIA 4A8KA 2X0LA 4IUFA 1TLHB 3TO7A 1QPIA 5E3OA 4DSKA 4OQJA 3HZJA 1VQ8I 1HBNB 4F7ZA 2ALYB 1RJJA 2EQRA 4NLUA 4IOAQ 2OKQA 1VDHA 2ZH4A 1CJUB 2UXDJ 2HBRB 2H09A 4JI5J 1KU3A 3M8SA 4MFEA 4ZLPA 3H2UB 3OR2B 1IBLJ 1JLBA 2Z3YA 4ZLNA 5D5UB 2IRXA 1URNA 3BGOP 4B09A 1NU4A 1VQYA 1M5KC 1Q81T 4RAYA 2GHVC 1O3RA 3J7YI 1R89A 5LRSA 1ZR2A 3N6NA 4H4OA 3NCPA 2VQFJ 3K9TA 4C4WA 2QLXA 2RQ4A 2VC1A 5HLFA 2M7AA 2LBFA 2AIRB 3W2VA 2NVXJ 3MZIA 1ZQ3P 1N4LA 2PA8D 2TCTA 3DP7A 4IG3A 2CKWA 2DCLA 3DLKA 3QP6A 3OQ2A 4NLWA 5F9LA 1HNWF 2DCUB 3ULHA 1FT9A 4M3DA 1REPC 4DL6A 2UXCJ 3K5PA 1D1CA 4L75A 2E60A 1XMQJ 2HW3A 3O5TB 4A3CJ 3MD1A 1U48A 3D2WA 2XZWA 3CB4A 1N33J 1XMAA 1C1CB 5IPAA 1R8PA 2H1LA 3MZ8A 2CPHA 4ZVQB 1GXTA 4TQSA 2DNZA 1X9WA 4KBIA 5FFZA 2K02A 2CQ4A 1KFDA 2JLGA 1IUYA 3MAHA 1IKXB 2NXJA 2YNIA 3SJMA 2AU0A 3BSCA 3MOZA 5IYDJ 1TFYA 3S3NA 3GIKA 2BW3A 4EYHB 5JUMA 2VE8A 4DSFA 1TVRA 2BANB 5CCMA 3T3FA 2V4RA 4Y34A 3SQGA 2D3ZA 1YIJS 2VONA 2JFKA 2EV0A 5ETLA 1RHRB 2Y8YA 5DD8A 4ED0A 5D4PA 5IFMA 3IV5A 3ZC4A 4Q5VA 4X4VA 1G6NA 3MKZA 1X19A 2GZOA 5H9FK 2KXFA 3PRBA 2R7FA 1EHWA 2RH3A 3OOPA 1KWMA 3FQKA 2VQEJ 4LRCA 2RDPA 2XNQA 4LFBF 4PK4A 3HHLD 3ITHB 4N0BA 3MCZA 3JRHA 1RHJB 2IY5B 1X3UA 2YH1A 4DXLA 3NNHA 1E0EA 1RYRA 2XWXA 3G86A 1GDTA 1JHHA 4RNHA 2F5GA 3KZYA 4ZYHA 1JLQB 4Q0BB 3TQNA 3CCYA 2F5FA 3M07A 2YNIB 3PNYA 2XSJC 1VQOS 3KHLA 3GBGA 3MXHP 4CYCB 1B4AA 1DQUA 1BW6A 3QPTA 2I9SA 2FLOA 3HDSA 4UVAA 2GBYA 4A0XA 2LY1A 1Q0NA 2LA4A 3F8BA 3NBPB 1RAIB 3NG8A 5CVUA 2DNPA 2Z4PA 2DMNA 1ITYA 4RZRA 1U9NA 2M8EA 5HS8A 1D3WA 1IAWA 1S4EA 4TLRA 4F50A 3EQLF 1LW0A 3L9ZA 4KFBB 5KG0A 3LSKA 4C3HJ 5KFWA 4F93B 1HMVB 2W84A 3BSNA 3A01B 5K8OA 2LEBA 3UVJB 4U7BA 3EXYA 4UUWA 1U4BA 4E2FB 4ZCMA 3SDGA 5FB2A 3LAMA 2CQPA 3PHTA 4I6YA 4M95A 2CH0A 1BN5A 3J7ZI 3H5RA 2XMTA 2R8JA 5B3SH 1RABB 5C24B 4F2RA 1V55H 4KE5A 2ZE2B 4DIQA 3L2RA 4HSRA 4RNFA 4FVCA 3KUGA 1WSUA 2RUSA 4G1IA 3U9GA 5DO2A 5K5MA 4LSNB 2FRHA 3W64A 5EG0A 2HOAA 3G8QA 4YIIA 2YX7A 4O3PA 5C2GA 3GWCA 2CMPA 2D3UA 4LLLA 1UETA 4WPAA 5FKLA 1QD1A 1B1BA 3SQOP 4DUZJ 2B9XA 4IO9Q 2COLA 3S16J 1M5VC 2R9LA 1XC5A 3B54A 4LGWA 4D0PA 4OV6A 1M90T 3E7LA 4YQWA 3MOJB 1D0XA 4F4XA 4LF7J 4URGA 4YDDB 2W9BB 4I6AA 2LQ8A 2XPWA 2K27A 3QRFF 2H5EA 3QFWA 3IKTA 1UHMA 4A3MJ 4FE4A 1U2CA 3SSRA 3OYMA 4N8NA 3AAWB 4YB7A 4PUOB 1ACMB 1FJGF 3IS9B 4PWWA 1WJBA 1MMSA 1N25A 3OV7A 2OA4A 1KOHA 1BI2A 1W5TA 2GGPA 5KFTA 3R6GB 1YRNA 2WWYA 3J80Y 3TI0A 2EBEA 3G1LA 4PR6A 4LSNA 4C9YA 2P7CB 1JI8A 1L0OC 1ETXA 2PMHA 3TO9A 3IRWP 4QWCA 4MKYA 2BVLA 5KFHA 2FGOA 4B3OB 4ZDOA 4QR0A 5HODA 4IRHA 5K5QA 4MAKA 4LFCJ 2ZKZA 2DY9A 5J2NB 1I94F 1NK0A 1N32J 3FISA 2GVDB 2EA4A 3K89A 4LLGF 2P5KA 1ZZFA 1F5TA 1UP1A 2DNMA 4RGXA 1HNIA 3KZIC 3EDRB 1FNOA 3LFUA 1S0NA 4CHUA 1FXRA 3BZKA 4RB0A 2ZH3A 2IMWP 2OPRA 1MNEA 3GQCA 3GPAA 3M32A 4DV7F 1FK9A 4V19K 3ETOA 3BH6B 2X6WA 3E01B 1TWGJ 1WKKA 1QY7A 4KIFA 2E9RX 1X1BA 2X51A 3G4SS 2HXIA 1XN7A 4N9IA 1H0MA 2HKXA 1MSFC 1YRUA 2XGXA 2ZBKA 4OYWA 3DM2B 2O3FA 2YKMB 4UV9A 2VUMJ 2Q6CA 1PAEX 2GHPA 4ECQA 1X1PA 3C2GA 5DQHA 4MJKA 2CFXA 4NOHA 1RACB 4OJHA 4ZP8A 4ZVEA 3K10A 2KN4A 4O4RA 4QR2A 2V7FA 4F4WA 3WTZA 4K4XA 1E6YA 2DHHA 4OI1A 2ZNYA 1GTEA 4ZP9A 2K7JA 1W26A 3GUDA 3BO3A 1ZYQA 1IRZA 1OMIA 4DMZA 3WTSC 4PPZA 2XSJB 1TNSA 4EMSA 3RR7A 3JTHA 1EETA 2ZE2A 4IX7A 2DRAA 2DHGA 4F0MA 1TL7A 1F1ZA 3W8GA 5SUHA 1F5CA 3I9V2 1XSDA 2Y75A 4X2BA 1YIOA 4L9NA 4DR2J 3BF4A 1R1TA 5KFQA 5AJ3F 3ML6A 4QYRA 1O5JA 2JH3A 1O6XA 2Y9ZA 1YZ6A 4IRDA 1EF4A 3MGJA 4KAIA 2QRRA 4FYYB 2K9LA 4AUXA 3ZMVA 5KT3A 4D1QA 3U21A 2PEBA 2ZXIA 5IP9J 4J9PA 1S7AA 1NZ8A 2DRBA 4EJWA 4OHVA 4UUVA 5JJBA 1QSSA 4RUCA 4ESJA 5BMZA 2AD9A 2Z99A 4C3MA 1U2WA 2XF5A 1SJRA 2OAUA 2PBIA 7FDRA 5IOYA 4JV2A 1WJCA 3WHBA 3IS9A 5L38A 2LF8A 1FE0A 1U1OA 3MMYB 1K78A 1WJ9A 2ZBCA 1K4SA 2F65A 2O01C 5DDOC 2CV1A 3DOMA 3EGZA 5EGOB 2AX0A 1D0ZA 4N5SA 4DF8A 2JRSA 4HQMA 3L95X 1MSWD 4K4WA 2A6OA 1ZOTA 2DA6A 5TJJA 3L7PA 1QZYA 3KLOA 1TK8A 2NNYA 3KLIA 5D0HA 1LV5A 9ANTA 2L9SA 2JUGA 3TA2A 1FTTA 1RESA 1X9SA 2FY1A 1XMKA 4HACA 3LA2A 3BV8A 2V1NA 3M8QB 2NSBA 2OF7A 1NH8A 4P2MA 3EVOA 1TUWA 5GMEA 1ZRDA 1JUMA 3IRRA 3KKFA 5FDLB 4WFZA 1VYAA 1RUOA 3ZQLA 1DLOB 3T9ZA 4UZBA 4I76A 4HAMA 4BKXA 4LIWA 3GTPJ 1AZSA 1FRMA 1E6VA 5HDKA 3HFKA 4KN4X 2HPUA 1S1UB 5ICCA 2V2VA 1XGMA 3BLYA 1D1AA 2W7PA 5EEHA 3EUKL 4E7KA 4KHPJ 3MPWA 3DDNA 2KRCA 1ZAVA 3TUJC 2YPRA 4NLTA 4S04A 3DOMB 3CD5A 3JAMU 4PG7A 5EEGA 5D4LA 2KHMA 2VG5A 4U67Q 4NUBA 2E5JA 1H8AC 4HSTA 2W9AA 4CLTA 3THTA 2GXAA 3A4TA 2ZNZA 1MG7A 4HF0A 5IT9K 2DEIA 3V4IB 1L3SA 2X1DA 3L7UA 2YNFB 1WHVA 3QAUA 4BYYA 5HMXA 3T1YJ 2XB0X 2M0GB 3QATA 3K1NA 1RWXB 1X2NA 3EYZA 3MMCB 1EETB 3KMSA 1RBLA 3ZQGA 3MD3A 1H2UX 4LRFA 3CCES 4KISA 2YKOA 1DTTB 4ED6A 1QUPA 2MABA 4HNVA 3R5GA 1I39A 4CO2A 3I82A 4QIFA 4J9MA 3N05A 2DOFA 3JSPA 2CG4A 1IXKA 1TL3A 1U2FA 3EVMA 4AU7A 1IRFA 4QPQA 1WH7A 1RE1B 3CP2A 4CGZA 5T7LA 1DPRA 3HJFA 2NVQJ 1OFCX 3CCQI 3QT5A 4QW8A 1MU2A 4ZP6A 2Q6BA 3BR8A 2NLWA 1X9MA 2MLGA 1PJ7A 3WTVC 4WE1A 2DFEA 1HYSB 2PMZN 1B7FA 1IXSB 3ZQHA 2QN6B 4ALZA 4F67A 1HPZB 3DXBA 2AEMA 1K61A 2QSHX 2DPJA 4DV3F 1UW4A 4BEHA 5IYBJ 3QPHA 2V8PA 1RWPB 4XPEA 2K7KA 2H27A 1WWHA 4WIQA 4S0MA 1Z4UA 3P9CA 2L3DA 8AT1B 3AG2H 3VF0B 3A03A 3K2ZA 5DCFA 1TL5A 3CJQA 5IXUA 3RPUA 3MEEA 4ZYEA 2DNOA 2VKEA 3CE8A 5DGBA 3CD7A 2QF7A 1MDMA 2KRBA 2YQ1A 2Y0MA 1VHIA 5B7WA 2R5YB 5KT2A 3IO1A 5DDGA 3OTBA 2O66A 2G7HA 5FLXZ 2K3IA 1TMMA 1TWCJ 1SC6A 3HCXA 2JDJA 4O0NA 2ZHOA 3ELKA 1SD6A 3P49B 2BVMA 2EPFA 2IS4A 4ZCLA 1ETOA 3C16A 1NKEA 2XLKA 3M8FA 1WG5A 2MLYA 5ETPA 2XMKA 2BEFA 2EPIA 1RHQB 4LG3A 4LJZF 2ADUA 2YX1A 4TKTA 3NNAA 2VG5B 1VQ6S 2WC2A 3HDDA 5FFXA 3D5MA 3D3CJ 2CW7A 3RJMB 5DZ6A 1MBGA 2QC3A 1QM9A 2BXZA 1X4FA 3T1AA 3KOAA 2XCPA 3K4MA 1UA0A 1KHVA 4ID5A 4AXIA 2X1BA 4IL6C 4MEXF 2NYIA 2O67A 4Z7CA 1NK6A 3KK2B 2C3UA 4QU7A 3ZOBA 1YBAA 4C0HA 3M8RA 3KJVB 1E3PA 2E7WA 1ZH5A 5ITHA 2FSWA 1LOUA 2JPCA 3SFGA 3S2WA 2UZKA 3PW2A 4PRFA 3ABLH 2M4MA 4RMNA 2LC2A 4BL0B 4ES1A 1QJHA 5BPIA 1RT5A 4BCAA 4OI3A 3M8PA 1FX7A 4ZJQA 4L76A 3JSMB 4W92B 5KT5A 3MM8B 5B0CA 1WJEA 5BYSA 1ZS6A 1RT1B 1WOSA 3FSXA 1ORKA 1DGWY 1OSDA 3I4PA 3TGNA 3D4JA 3R5DA 4F0KA 2FGCA 1E3OC 4ED1A 2GAGC 2XF7A 2PLYA 2OPSB 3M1CA 4NI2B 2DT5A 1F5BA 2VXDA 2E2JJ 2F4FA 2IJLA 1RT2A 1MW7A 5FKNA 5C42B 2CJKA 2UXBF 1MMLA 4Q44A 3U1LA 1ZRFA 3Q8QB 3QU6A 1K83J 1WZ2A 3FRZA 3M2VB 3LW5C 4NLGA 2VFSA 2W4PA 3CDHA 3CDWA 5I4MA 2G2OA 4BHPA 1IR2A 2PJRB 3DC2A 2DI3A 4PG6A 3T9NA 2NXNB 1RBAA 3PJXA 5CHCB 3O8GA 2BRLA 2MB0B 1FOXA 2PFBA 4YP3A 1QSLA 1OKRA 3G9CA 2QQ8A 4DZJA 3AH6A 4M3BA 3BGRB 2DNQA 4YDXA 2EILH 2PSZA 4GKJF 3DLEB 3GIMA 2H94A 4BC7A 2MGZB 3PZPA 2AYBA 5FKKA 4KJIA 3H90A 4TV7A 1JLQA 4Q0BA 4YIFA 3HM5A 3WTYC 3JSOA 2QUFA 1FX4A 2M3DA 4I7HA 5FLXU 2QSFA 4NNJA 1HKTA 3CO9A 4DZPA 1YDLA 2HIYA 4DUTA 1TL7B 2LP0A 4BXXJ 3IWLA 2M5YA 4IXAA 1PYTA 3L4BC 5B08A 3GFYA 4Y17A 2DAOA 1SBRA 4NDLA 2LF7A 4XMYA 4X65J 4B9TA 3C2BA 4IO9F 2QT7A 3VR1A 3P8BB 2BKNA 4YB5A 4FDFA 3GFMA 1FPQA 3HHDA 4MQ9F 2PO4A 4ZMMA 1K7AA 4OZLA 4KT6A 4OYIA 4YR2A 3ZMZA 2JX2A 1SVDA 2VPYB 1RWWB 4XORA 4A3IJ 4RGUA 2AT1B 4I0WA 1L3TA 2DTRA 2DO7A 1TVRB 3ZTQA 3CNQP 4DG1A 1WWXA 3E6CC 2OFGX 2KG0A 4I0AA 2XAHA 2HVRA 3KMQA 1SD4A 4XRSA 3ZQCA 3EVWA 3UFCX 3OUYB 2A6HF 2DXEA 2R2SA 1O7LA 2ATCB 1I51B 3I56I 2LKXA 1C0TB 4USWA 3TVZA 2B56A 4U0YA 2DCEA 2JA7J 2PC6A 2EFOA 1MD0A 4DR6F 3PJWA 3SZTA 2JA5J 1A7GE 2X1AA 5IY5H 2MQNA 2FBHA 5A2QY 1S9GA 2L41A 4JI8F 1FFGB 3TVYA 2X6XA 2R42A 2VPXB 4A5NA 4EUVA 4NQWA 2L3MA 2VJ5A 1CSJA 4AIDA 4F92B 3E0JB 4KKOB 4KSEB 5E33A 1U0SA 1I94J 5K14A 1YLFA 3J81Z 3G82A 5M5XJ 1NPKA 2VBZA 2NVUB 3S1QJ 5AT1B 3M9MB 3QGIA 4HH0A 3RYLA 2V79A 3UR3C 3VVUA 5J8FA 1X1DA 3GFXA 3DRPB 1C0UA 1S57A 3I9ZA 4ECRA 2KM8B 1KQGB 5D3GA 1YX3A 4UVBA 4EGLA 2U2FA 1WH5A 3ZMDA 1KLNA 3BJYA 3BP8A 5KFMA 1MN7A 5C7PA 2KIUA 4WFYA 3KJFB 1S3JA 3OSNA 2X4HA 2CJQA 4P55A 3CIZA 3B6CA 2ZVSA 3WG9A 3KP5A 1T11A 1EKRA 3QNWB 5THWA 4Y13A 2EI5A 3JSBA 3O3LA 3GMEA 1PKUA 4QZVB 5KFLA 2V67A 2W25A 5CVJA 4DR7J 5HBMB 2OD6A 3GTGJ 3RSNA 1Y7PA 2DK8A 2VA2A 3TEGA 4WTYA 4IG0B 2J0XA 2E5ZA 4BE2A 3SSSA 3HOZJ 2Y9HA 1UJ8A 3T8TA 2CNNB 3P9KA 2DYRH 5FJ4A 3ENQA 2C22A 5E3QA 2EIJH 1LWCA 5D6GA 1Z67A 1W7WA 3KJQB 3LA0A 3I59B 4PJNA 3TQEA 4ILMA 4O3RA 3AJ2A 3IRQA 1SJ4P 3Q83A 1OLTA 3Q8RB 3OVAA 2JEIA 2KRRA 2A1BA 1Q95G 4CNZA 2ZXJA 3SBMA 2DPDA 3I4HX 1KA8A 3F8CA 1R4NB 2VLAA 2DOAA 3SSQA 2JSPA 3GXOA 2JSCA 3DPLC 5GAEJ 1RI7A 2JZYA 1V6HA 1F36A 4A8OA 3C46A 2VICA 1X4EA 4E98A 1X1AA 1E2XA 2WV1A 5HVGA 1SKRA 5CZVA 2QEXI 3FM5A 4BC9A 1YX5A 4Y33A 1LKXA 4XLNF 1AA7A 1R00A 3LNQA 5HATA 3JQKA 2EEYA 2Z0GA 3QYYA 3HSDA 5ETRA 3CJNA 1LQ1A 3DOKA 3BBFA 2ZBPA 2AYEA 3C14B 4Y4RA 2J7WA 3IR6B 3O6BB 2WVDA 1X4DA 1RB0A 2OMLA 2HS5A 4KIBA 1SKWA 1RA7A 2NQPA 1SUQB 4WK3A 4HHJA 2L0KA 4W97A 3S8PA 2RVJA 1T05B 2RQMA 5EHHA 1NG6A 1UZCA 3SMZA 4I0BA 3FNNA 2OV7A 1DRZA 4CXFA 2CXEA 2DR5A 3AT1B 3LWFA 4CDGA 3GTLJ 4NC8A 5IOZA 2QLBB 3FZVA 2YWHA 1X58A 4RW8B 3ILIA 4RM2A 5C25A 1YVFA 4WXOA 1YBUA 2BBYA 4UUTA 3N5FA 3T41A 3HHNB 4ZVGA 2OTJS 2HQ5A 4M9ZA 4M71A 1IN0A 1GEHA 3AG3H 4EK2A 5D4OA 3VAMA 3PJRA 4HOBA 1B3TA 3W8PA 1MJ9A 2VG7B 4R79A 4ZJLA 2HNZB 3I32A 2Q2EB 1BW5A 3HPOA 2GJIA 5DZ7A 3HFVA 1HQEA 4ED5A 5E7OB 1ZTWA 3R5BA 4K4UA 3ADAC 1YITS 3N4WA 2K9QA 4AWXB 2H6CA 5BNGA 2V5HG 5C42A 1BJAA 4BS2A 2OPSA 3MR7A 2CPIA 1BIBA 1HL6A 1I3AA 4I01A 1JJ2R 2P9GA 2KJBA 3BQZA 3PJ9A 2FC8A 4OX7A 1NJWA 2X1CA 3I59A 1WJAA 4RL1A 1VGYA 3PX0A 1HLVA 3GTQJ 3P4UB 2O6GE 1I1SA 2V2ZA 2WVFA 1TV6B 3CJ4A 3ZO7A 4B3RJ 2ELKA 1H2VZ 2L9VA 1VJQA 4OJ3A 2EIMH 1VQMS 4B9VA 1WHWA 5LL6d 3U2RA 1D9AA 4MLOA 3AFGA 3UWTA 2XGDA 4QOTA 3U1MA 3SXYA 1EKSA 1Q86T 1GFWB 1H73A 3ENVA 3MHYA 4N47A 2QSFX 5LRRA 2FVSA 3D66A 5KG4A 2X6YA 1IBLF 5DUKA 4M5LA 4D7MA 2FVRA 1XBWA 2Y69H 3H3ZA 3W2WA 2OPQA 3V6KA 4JI0F 3D1HA 2A2CA 1QHHD 1TQMA 3IWNC 1P1LA 1A35A 3OIQA 2CNLB 2OD4A 3BKFA 1B72B 2I1RA 4QQBA 5MAOA 4FETA 3CC4I 1KU2A 2B9YA 5LGTA 4MIBA 4IQJA 2XAUA 3HF5A 3ZNUA 2ZHAA 3S14J 3HHLA 1PSDA 4OAZA 1P2FA 1Z21A 3MZYA 2FJAB 1KHWA 1UEVA 3K69A 1L3LA 4ZHRB 5AE2A 1LEBA 2F4IA 2YU9J 1FRHA 2JRTA 2YTCA 1RP5A 2UUCJ 1X4AA 3UE2A 2HZVA 5BPDA 1LFUP 5HO4A 1U0JA 4D5FA 2E5GA 3SIPB 4NC6A 1X3ZB 1XTZA 2OU2A 3CUQC 1YIJI 3P5TL 1FOWA 1ELOA 3AQPA 3DLGB 5LOQA 1BWEA 3V7RA 1IR0A 1OJ4A 1YJNI 5HBMA 3OJUA 4PABA 2CZVC 3ZPLA 4WU3A 1W1WE 4OOIA 2HNHA 1RGVA 4KO0A 4G7ZF 2DN0A 3JREA 3E3XA 4N8OA 1LWFA 2F9DA 1U6GA 1ICEB 5F27A 4UVCA 3IWXA 1FJEB 3HJVA 2DR8A 1Z2LA 1ZM9A 5HQ8A 4HNUA 1JLGA 4FKXA 2KP6A 2QZ8A 1RDRA 2GQQA 2LG4A 1F3VA 4OLOA 3R6LB 2AXTC 1JJ8C 4HDHA 3ETMA 1QSYA 4XAKA 5E3PA 3H1CA 3CJ8A 1Y6IA 3BKTA 1JTXA 5F6FA 2J8AA 5L3DA 2E44A 4H4KA 1QE1B 3HB9A 4ASNA 1LWEB 1EA3A 5ETOA 3BG9A 2LECA 3G87A 5L3GA 3BKUA 4YEJA 2WOMA 2HQAA 4OJ1A 3KK2A 3H9JA 5GP9A 2BOLA 4WF9Q 1R0AA 3VYRB 3M7GA 4PG8A 4PJMA 5T14A 5EZGA 2LOOA 1WFXA 2GIQA 3E5UA 3V4IA 3GV5B 1QQIA 1WSVA 4UQTA 2B8PA 1ZTRA 2ZJQQ 3LMMA 1RT4B 4IG3B 4FVMA 3CF2A 4GDFA 4K5RA 2QVOA 4Z6YA 4GC7A 4YY3F 3TUPA 2HVQA 3RQIA 1Z2ZA 4BU2A 3ET6A 1UCNA 3OSGA 1X7VA 2KL8A 1PJ6A 1D8ZA 1ZLKA 1WF0A 5KFPA 1SFOJ 4NE9C 4CWBA 4G65A 3KK3B 1BXNA 1WOPA 4MKAA 5G4DA 3RRHA 2DJNA 3ABUA 3KLVA 2O0YA 4XL9A 1B0TA 5KFIA 1MJAA 1XERA 2JPBA 3Q24A 4ZJOA 4S0HB 4PJJA 2BW7A 4F4AA 1TFWA 4HKQA 2P6SA 4ZH4F 2RU3A 2BZ2A 4AT1B 1HNZJ 3CDIA 1XEZA 3S1TA 2HRUA 1WJ5A 4FBTA 2QKMB 2D1HA 2PT0A 1H7XA 3MPUB 2J6TA 1QAIA 1VC5A 5KG3A 3UDLA 1YI2S 3CCRS 1QZEA 3BN7A 5M5YJ 3QO9B 1V5IB 1BD6A 1R71A 2IT0A 3UD4P 1D1UA 1YW9A 3GLJA 3Q89A 2UVRA 3FEYB 1KBRA 3RIRA 1YJRA 3MM6B 1HD1A 1IXCA 2XMJA 4XLCA 4HLXA 4DUYJ 3DTEA 2C28A 5KG7A 4U9RA 4ZKAA 5EGOA 4DS4A 3FXOA 3JAMZ 3KHGA 1REVB 4GGGA 2AS5F 4NL5A 3OYGA 4U95A 1UVKA 2NRAC 4UW2A 2KPMA 3N28A 4A93J 3QPIA 4WKYA 3G3ZA 3MEGA 5C4XJ 3OT9A 5BJRA 4KB7A 3ENWA 1RT3A 3DYAB 4K59A 2W8LA 3G73A 3H5UA 1T03A 2VHGA 2KO1A 2OZ6A 2D5VA 3TZWA 3R5JB 4KIGA 2EZKA 5CAAA 4HYKA 4USTA 3HL2A 1RTHB 4I69A 5KFUA 3T1HF 5CD4A 2E9TA 1FNNA 2PE8A 4B9MA 1TWAJ 1N5QA 2KVIA 2XAFA 2E1MB 5KAIC 2ZJQF 2IM0A 4DV5J 2R7OA 4RW6A 4OX6A 1PGZA 1D9DA 2HGCA 3M30A 1XR7A 3ULQB 1QVFR 2Z30B 3Q0WA 3OYEA 4GFBA 4B3XA 1U49A 3SDEB 4DPUA 3CC2I 1RIOH 3JYTB 2BBEA 5A8WB 3N0VA 5J1YA 3M2UA 1AKHA 2NZ4A 4IQXA 4FPRA 2KTQA 1AYEA 1G3YA 1YRNB 2OCCH 3TJAA 4ETSA 1I6XA 4LRBA 2LDIA 4G6TB 3UCZP 3W9HA 2CDQA 4W1UA 4MMOA 4KC5A 4OIRF 1SUQA 2GAHC 2K1RA 5F3ZA 3J80Z 3S1RJ 2GO9A 4Q2MA 4FYWB 2QE5A 4HVZA 2X3DA 2E5LJ 1G59A 1A6IA 3ZTSA 5M2UA 4HW0A 3VV2B 4X4SA 2EZIA 2C3MA 4DR4J 2DNLA 5AXKA 2F9JA 4DX5A 4ZZLA 1YJTA 1LWXA 1UPMB 1O3SA 4ZPVR 3ZFVA 1SC1B 2FJXA 3BR0A 2N8GA 2FHJA 1RT7B 2ZBQA 2DGUA 1KNZA 2HLTA 3I71A 1PJ5A 2Y3YA 2L5QA 3KLGA 4AFFA 1WKJA 2G0JA 2YQ0A 4JQFA 4XLHA 2ZOMA 3HYIA 1SFUA 1R3NA 4UY85 4HV6A 5LEJA 4HNTA 4O4GB 3LP1B 3MM7B 5F0CA 1R8AA 3I9V9 1NK5A 3TNVA 4UOHA 1A6QA 3HUGA 5HROB 4X0GA 3CMES 2L9RA 4X4NA 1FO1A 3QO9A 4NLYA 2L7KA 1LNQA 1RC9A 2ZSIB 1WEYA 2BEOA 2G9OA 5K5OA 5B0EA 3HOSA 4RU9A 1CG2A 2GHWA 3O44A 4DPTA 4G6DA 3KYLA 3EZ5A 3DDIA 1YJNS 8RUCA 1FWPA 3IR7B 4MK7A 4BBRJ 3IG1A 2K8GA 2YX4A 2E1CA 2ME0A 2M52A 2FJDB 3TA0A 3HZEA 3R9LA 1SPBP 1K79A 2QO3A 1GLNA 2B9EA 6AT1B 2XHCA 2Y31A 2GIFA 3I31A 2C3YA 2B43A 1SL0A 5DDQC 2E66A 4TNOA 3ZZYA 4KICA 2DRDA 2XO6A 3R1LA 1I6JA 4QWQA 4ZN1A 3JRFA 4B3MJ 2EV6A 4XKCA 2PG4A