2GQQA

Crystal structure of e. coli leucine-responsive regulatory protein (lrp)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
153
structure length
153
Chain Sequence
b'LDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFIQGYTALLNPHYLDASLLVFVEITLNRGAPDVFEQFNTAVQKLEEIQECHLVSGDFDYLLKTRVPDMSAYRKLLGETLLRLPGVNDTRTYVVMEEVKQSNRLVIKTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leucine-responsive regulatory protein
publication title Structure of the Escherichia coli Leucine-responsive Regulatory Protein Lrp Reveals a Novel Octameric Assembly.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 19
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gqqA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gqqA02
3WTXC 1XDUA 3P9IA 2RV8A 3GFIA 1W4MA 1FC3A 1U8RA 1CGPA 2XROA 3LAPA 4Q5SF 2Z99A 5BS6A 1T2KA 4LJZF 5FGMA 2Z3YA 2HOEA 3GVAA 2MH2A 3COAC 3M8FA 1FYKA 3QU3A 2Q2EA 5H20A 3WGIA 2PMUA 2B0LA 1BC7C 2IT0A 3TO7A 5JR3A 3JSOA 1IN4A 3NQOA 1G6NA 4BAYA 1FBSA 2QQBA 2FXAA 5D5VB 3Q5FA 4KT5C 4A0XA 2ZBCA 2KJBA 2HKXA 3V7RA 4N9HA 2VE9A 3F8NA 3ULQB 1WSUA 1ULYA 4O5VA 3L7WA 5CVIA 3CUOA 2ELHA 2KRFA 5AONA 4RB0A 1WI9A 2FMLA 2L4AA 3QAHA 3DQVC 4ZYEA 3KP4A 4Q47A 1G4DA 1ZLJA 3V8JA 1BN5A 3ZMUA 1SFEA 1KQ0A 1ZHFA 5ICFA 3GF2A 3KZYA 2A69F 4JBAA 4UXNA 3RPQA 2MD5A 2YX7A 4ON0A 4YIFA 3E97A 3M1EA 3KE2A 2RDPA 4L9VA 2PG4A 2A6EF 5A2QK 1H0MA 4L0ZB 2VOPA 5E8GA 1SFUA 2DO7A 1W7PB 1JGSA 2XAGA 2HTSA 4EGYA 4EQQA 4EGZA 5LGNA 3J80K 2MH9A 2IVMA 2CQKA 4YG2F 5DUKA 5E1ZB 4P9UA 1TTYA 2EK5A 2UXNA 3L2CA 2HFHA 1I1GA 3FMSA 2DAOA 2TDXA 2DJWA 1XMAA 1QBJA 4ESBA 5LEKA 1K78B 3DPTA 2NAZA 4ETSA 3HTSB 4CYDA 2JZYA 3WU1B 4BYYA 3FHZA 3E3VA 3PQJA 4UVBA 1Z05A 2ZBKA 2ZMEA 1Z91A 1I27A 4EVIA 1EV7A 4G9YA 2DK8A 3K1MA 4A5NA 4IRIA 2DPDA 1FSEA 2GA2A 1O7LA 4ZZDA 5DUIA 2BBYA 4O6JA 1RUNA 3V4GA 4OMYA 1R22A 4GXOA 5D8KB 5CVVA 1B6AA 2E7XA 1OYWA 3DXJF 2XAFA 3T1BA 4UV8A 1F4KA 1G3SA 2ZO4A 4LLLA 3KETA 5ILUA 2DPUA 3ZN0A 2PJPA 1Q1HA 4B8XA 2GXBA 3T8RA 1XSDA 3S2WA 2NNYA 1BIBA 1WRJA 2QQ9A 3ZPLA 4Y17A 1T39A 3IWZA 4RAYA 4LLNA 3H3UA 3H3ZA 1YYVA 5ICEA 2E1AA 4IRHA 1UFMA 3LSTA 4U7BA 4M74A 4S05A 3JSPA 3HIFA 4RGXA 2EFQA 3EETA 2V1DA 1ZYRF 3ZQ7A 2OD5A 3TOAA 2J5PA 3LA3A 2V79A 2M45A 3ROUA 2ZMEB 5F1RA 1DDNA 5L3FA 2BYVE 2DW4A 4HDVA 2Z4PA 1IXCA 3FXUA 3TO6A 1FOKA 1OYYA 1J5YA 1ZGAA 2X0LA 5L3DA 2KIFA 2K4JA 1IF1A 1K6OA 1BBYA 2L3DA 2DI3A 3J81K 3BWGA 3MCZA 1XSVA 5E20A 4KMUX 2FQ3A 2F2EA 2HYFA 1Z1DA 1YS6A 2PQ8A 5ICCA 5HS8A 1KYWA 3IRRA 1L3LA 2HEOA 1S7AA 3IC7A 1B9MA 1SMYF 2FF4A 5DYMA 4IF4A 4OIQF 1U5TA 5DCMA 5D8LB 2DTRA 1FX7A 5K1YA 2EV0A 4R8HA 1HW5A 5IT9K 1UHMA 4KDPA 2LSOA 3U9GA 3MZYA 1FT9A 4GGGA 1AOYA 1R36A 1FWZA 5BMZA 4WK8F 3WTVC 2ISYA 4BH9A 3KFWX 2O6GE 1WQ2A 1IW7F 2O03A 1XGNA 4XSXF 4HDUA 4P9FA 4MTEA 1TW3A 4OIOF 4KYWA 2ZXJA 4F7ZA 3IKVA 4OMZA 2G9WA 4RGUA 4OIRF 3F21A 4BHCA 1YFHA 2VBYA 5ED4A 1MGTA 3K9TA 4WWCA 3ML6A 2GIVA 4EM1A 1E2XA 3GFJA 2F5FA 1D3YA 1BOAA 4BHPA 4OU0A 1RZ4A 2Z33A 1O3RA 3WE3A 4ZYHA 2OZUA 3DEUA 3FM5A 1BIAA 3R61A 1IN5A 2HQRA 1RI7A 1P4WA 4QWQA 2VXZA 4UNOA 2F5CA 1I6XA 2NS0A 2Z5UA 4D0PA 3DF8A 1R1UA 3QP6A 4KN7X 1IN6A 4KFCA 2IA1A 3L09A 1HSJA 5LHHA 1H9TA 2CFXA 5LHGA 2M8EA 1DUXC 4IHSA 4A0ZA 2QWWA 3M7GA 2CSOA 2DLLA 3O3KA 2PFBA 2XHKA 2ETHA 2HYGD 3KEOA 2GZWA 2VC1A 2JPBA 1QNTA 3WTUC 4ZYGA 4IXAA 3U1DA 5HDGA 1LB2A 3WGHA 1P2FA 3WG9A 3GYHX 1TQPA 4EJTA 2R7DA 1OPCA 1FNNA 2ADUA 1LDDA 4P96A 1U78A 1XGSA 4S04A 1O57A 4PGHA 1FLIA 2A6HF 2JPCA 2P6SA 3KCCA 5HLGA 2XRNA 2DQRA 2W24A 2JT1A 5E1WA 1E17A 4JK1X 4YFXF 2EFWA 3BY6A 4NB5A 5HOOA 2PLYA 4LFUA 3RYRA 3C1DA 2O0YA 5DDGA 2VC0A 4M9SA 3F8MA 1R1TA 2EFOA 4KIGA 4RB1A 1HQCA 4XRFA 1U6GA 2F5EA 2L02A 4LB5A 5K5RA 4ZH4F 1FPQA 1U3EM 2MLGA 1F9NA 3GLXA 5D6FA 4XLNF 4LK1F 4M6XA 3GEZA 3KP5A 4OIPF 4I02A 4I09A 4GYGA 2NRAC 2E1NA 4I2OA 1KU3A 4KIBA 4EJUA 1OKRA 5HVQC 3C3WA 4CZZA 1W7PA 2HDCA 2QUFA 4N0BA 3I59B 1MZBA 4HYEA 3CO6C 2C6YA 5FLXZ 3EYYA 3T5XA 3RYPA 4A6EA 3WTYC 1FP2A 1Y0UA 5CYVA 3F6OA 1JE8A 3W6JB 3DKWA 4CGZA 3VB2A 3C7JA 4HW0A 2MLKA 3HSEA 2FBKA 1K78A 3WE2A 3R60A 3N97A 1BI3A 4LD5A 1BI0A 5FO5A 5A2QZ 1TLHB 4ESJA 2M1BA 3GZ6A 1SAXA 1YIOA 5JHUA 1J7KA 2R7FA 2WWYA 4L9TA 1S29A 1QZZA 4L5IA 5HS9A 1YW7A 5LRRA 2E1CA 4HX4A 1NHAA 4EM2A 1Z9CA 1O3SA 1XD7A 1B9NA 2YX4A 3V7SA 3CDHA 2EB7A 2GA1A 4Q48A 3I0TA 4M73A 3RIRA 2EV5A 4A5MA 1LEBA 5JI6A 2YU3A 4WXHA 4RB3C 4KUMA 3O2PE 3KP2A 2ZKZA 3IHUA 1OYIA 4HV6A 1IXRC 3HRSA 3V8LA 4HQEA 5HS7A 4OOIA 3JAMK 2OZ6A 2O3FA 3P9KA 2Y75A 1WKMA 3E5XA 2HZTA 2ZJ2A 4Q4ZF 2Y48A 3HRMA 3I64A 2G7UA 3R0JA 3P9CA 1ONVA 1ZG3A 2OU2A 3HHGA 4UHTA 2W25A 2CGPA 3E5QA 1IAWA 1ZGJA 2VBXA 3CUQC 4FX4A 3V8KA 2XAQA 1LDJA 1IN8A 1IUYA 3T0YA 1LJ9A 4HV5A 3BPVA 2PI0A 3OOPA 5ERIA 4KNYA 3GXOA 1D5VA 5FFZA 1FP1D 2XUBA 2PMHA 3T8TA 4IVNA 3PQKA 3LQQA 1F5TA 1XCVA 4EM0B 3HHHA 2KKOA 3CLOA 3HSFA 3D0SA 1CF7B 3K0LA 2ZFWA 2ESNA 3LQRA 5LBQA 5DD4A 2IP2A 3LA2A 3MWMA 5DV5A 4M6YA 1LVAA 3OV8A 2LKPA 4NQWA 1JXSA 3GFLA 2FE3A 3E6MA 1GXPA 2YPRA 4M72A 5FB2A 4EJWA 5F64A 1JHFA 5E18F 1C0WA 2HTJA 1WWXA 2FNPA 1LEAA 3REOA 3QPHA 3J81Z 2PN6A 2OBPA 2W85A 1YG2A 5LLQA 2RN7A 2EV6A 3TOBA 2PBIA 1W7PD 3K69A 3GX4X 5AIPA 5CVUA 2K27A 1BC8C 3RKXA 1IRFA 3AAFA 1SD7A 3I54A 1V4RA 1S6LA 5AIQA 3TGNA 2H94A 3FXRA 2R3SA 2P4WA 1UB9A 3GWZA 2DU9A 3EQLF 4WXCA 3E6DA 5CVRA 3TDZC 1VTNC 1S8NA 4QLCU 5IT9Z 5IT3A 2YSRA 4MGRA 2VODA 5BPDA 1S7OA 1ZRFA 5LRSA 4Y15A 2P7VB 2FNAA 5E17F 1SFXA 4M9ZA 4A2UA 3BDDA 1TNSA 3NEUA 2DQLA 4WF2A 1KYZA 3TDUC 3FX3A 4NHJA 4G8XA 5HLIA 5CVJA 2XASA 3FF5A 2QQAA 4LMYA 1KGSA 3BJOA 4PCQA 3FMQA 1F1ZA 2Y0MA 4RGSA 4O3MA 2BV6A 3KP3A 3HYIA 6PAXA 1BM9A 2P7CB 3F72A 4G7HF 1PP8F 1UCRA 4P55A 2QBYA 1FY7A 1T98A 2QYOA 2RNJA 2ZNYA 1TQIA 4G94A 3ZMZA 4I7HA 5JFRA 2H09A 1B4AA 2JSCA 2DK5A 4FHTA 1J0RA 4R79A 2M87A 1DP7P 1R00A 2M30A 1FBQA 2D45A 5FD6A 1OR7A 4RGRA 3HOSA 3HUGA 2GWRA 2RGVA 2OAZA 4KN4X 1YTYA 4L18B 2PEXA 1ZH5A 4L0YB 2VT2A 2QVOA 1HSTA 2AS5F 1DPRA 1KU7A 1DPUA 5D5UB 2UXXA 2WTEA 1EH6A 2P5VA 2XVCA 3F6VA 3R0AA 2RKHA 3PFIA 2IW5A 3E6CC 1A04A 5L3BA 1UHWA 1T0FA 1P92A 2V1UA 5TRDA 3GZ5A 4U0YA 4HLYA 2LDUA 2W57A 2P8TA 3DFGA 4E70A 2QENA 4ZYDA 4FX0A 4YFKF 1HKQA 4RS8A 4A6DA 1QPMA 1Z7UA 3F22A 5F6FA 5HDNA 2FA5A 4MEXF 5E1XA 3JTHA 4IJAA 4PGGA 3DPLC 1SD5A 3QP5A 3HRUA 4YIIA 1ZG5A 2QBYB 3QOPA 3I59A 4HA8A 3RPUA 1TQMA 2G7HA 4MQVA 3I5UA 3MZHA 3HOTA 1RNLA 1USTA 2P5KA 4AVPA 5EEHA 1FSHA 5LGUA 1HKSA 4G6QA 3N4MA 2GQQA 1PP7U 1J59A 5LGTA 3VODA 1EH8A 1HW1A 3GW2A 4I0AA 4HAMA 3GUDA 5EEGA 2IRFG 5DEQA 2H27A 4BHBA 2K4BA 4EV0A 3QU6A 2P6TA 4U0VA 3ERED 3G73A 4RB2C 1BI1A 2FBHA 1ZRDA 1MJBA 3HTUA 4MQ9F 1P4XA 3J7AO 4KIFA 1X3UA 2F5DA 3L9FA 1XGMA 4U0WA 2EJRA 2ESHA 3MQ0A 2A07F 4AIHA 1U5TC 1YW8A 3K1NA 1R5GA 4HQMA 5JVTA 1ZARA 1PDNC 5TJJA 3L00A 4CXFA 3BROA 4ASNA 2MC3A 5DCFA 4LG0A 2EA2A 2H6BA 1D8KA 5LHIA 2M5WA 2V6CA 1IN7A 3P7NA 1XDSA 3HSRA 4L9JA 1LNWA 3R4KA 1YW9A 2QZ8A 2DBBA 5BOXA 3LWFA 4G7OF 5LEJA 3IRQA 1HW2A 3F8CA 4B09A 3E6BA 1R1VA 4DQ2A 3SHFA 4PDKA 1ZLKA 4GCVA 1XB4A 3ZMSA 5KK1A 5D4SA 1W5TA 4HF1A 3V7CA 2STWA 3LAJA 1J2XA 2JRTA 2GAUA 3I53A 3IWFA 3D5LA 1P4AA 1G3WA 2IA2A 1LQ1A 3K2ZA 4XLPF 1ZRCA 3O6BB 4L5JA 1L0OC 3J80Z 4OINF 3F3XA 1R7JA 3CTAA 3VFZA 1K7AA 2IPQX 1D8JA 3EDPA 2CWEA 3JAMZ 4UVCA 1I1SA 1XCBA 1O7FA 3CUQB 3WTWC 1TNTA 4GYIA 1MDMB 4HX7A 4YFNF 4L9NA 1YO5C 1CF7A 4LB6B 3BZ6A 3LFKA 2KIUA 2DFIA 3ISPA 2VE8A 1SMTA 2VOOA 2BE5F 5FLXK 3RDIA 3F8BA 3FM3A 4HOBA 4AWXB 5L3CA 1ON2A 3BOQA 4LG0B 1MKMA 4FT8A 5CJ9A 4I0BA 5H6QA 1MJ9A 4ZZLA 1ZG1A 2JSXA 1T6SA 2EFPA 3CO7C 1G3YA 5H6RA 2ZCWA 1XMKA 3LA7A 2NYXA 2CO5A 1HKTA 3CJNA 2HR3A 5J6XA 2FSWA 1T38A 1GXQA 1JHHA 2O8XA 4U7DA 3C18A 2CW0F 3WTZA 3ZP5A 3DV8A 1AWCA 5DD8A 3B02A 3BJ6A 4P5OA 3VEPA 2CVIA 1STZA 2EFNA 2K02A 2FRHA 4UV9A 3FZVA 4KA4A 3F23A 1FBUA 3JTGA 3KZZA 3VOEA 4UVAA 5D6EA 4XSZF 4MHGA 3SQNA 1FZPB 3ABUA 2OA4A 4AD9A 3Q9SA 2HQNA 2AXLA 1S3JA 2V9VA 2HKOA 1SD6A 4M71A 1QQIA 2HGCA 2BGCA 1ZN2A 2FOKA 3I58A 4LLGF 4G6DA 1IXSB 3RKYA 1KU2A 3ABTA 1KU9A 2VBZA 1KQ8A 1O3QA 5ILVA 3WU0A 4N9IA 1H9GA 5HDKA 3SXYA 2K7LA 4MTDA 2HS5A 5FFXA 5D4RA 3SFZA 4IHTA 3EUHA 1IRGA 2X4HA 2CG4A 2LNBA 1P6RA 2W84A 2VONA 2FU4A 1J75A 4CO8A 1K79A 2JTVA 2O61A 2COMA 2CYYA 2WC2A 3KP7A 2K86A 4LGWA 3WGGA 5L3EA 1MJAA 2ZNZA 1GVJA 1LDKB 2YR2A 2RC4A 2Q8KA 2LF8A 3ZMVA 3WTSC 4UUVA 1ZAOA 4ESFA 1U2WA 4AIJA 1PUEE 4EJOA 2XKOA 1IZ1A 4DNCA 4XBFA 3FMRA 1GHCA 2MA3A 3ZMTA 3DP7A 1MD0A 4ENKA 2QLZA 2VN2A 4ENMA 4Y13A 2VBWA 1REPC 2MBFA 2XV4S 4HF2A 3Q9VA 5BQTA 3I71A 1XSXA 3RJPA 2L54A 4HBLA 4BQAA 1QZYA 2RVCA 1BI2A 4JQFA 1V3FA 3RKWA 3KLOA 3H92A 4K2EA 3QPTA 5K5QA 2XKPA 4WXDA 3M8EA 1O3TA 3MFKA 5KVRA 1Z6TA 2OQRA 5ICGA 1G3TA 4MNUA 3GFMA 2BEOA 1HBXG 4IRGA 1BJAA 4HLXA 1W5SA 2XGXA 3F8FA 3SZTA 3M9AA 1KA8A 4HF0A 3ZMDA 3E5UA 1Z6RA 1EH7A 1ZREA 2XAJA 2A3SA 4A12A 3SZPA 2RQPA 1OMIA 2FBIA 3KLNA 2XAHA 1FYMA 3W6KB 4RAZA 1R58A 5HLHA 2IA0A 3GO5A 2XIGA 3IL2A 4KMFA 3FWEA 4M9XA 3MAJA 5BPIA 3U2RA 2E7WA 3QRFF 2IJLA 2EA4A 3HRTA 5L3GA 4R1HA 4WCGA 2STTA 2UWMA 1USSA 4Z2YA 2D2WA 3R6SA 2WV0A 3KEQA 2D1HA 4H0EA 4I01A 3NRVA 4CICA 5D5XB 4EJVA 2EWNA 3BPXA 1B59A 2VT3A 2KJCA 3WODF 2KIMA 4AIKA 4MEYF 4HZFA 1SD4A 5D5WB 1KQ9A 2A61A 5E8IA 2ACJA 3BJAA 2L4MA 1R5HA 1U5TB 3G3ZA 2D1VA 1B1BA 4IPAA 4EMSA 5DCMB 5FD5A 2FMYA 2J5OA 1YLFA 1ODDA 2Q0OA 4BNCA 3TKYA 1YS7A 4BXUA 3ELKA 4KICA 4TV7A 4G7ZF 1TBXA 3RTRA 1FYLA 5K5OA 4CDGA 2ISZA 2A68F 1XGOA 2H6CA 1QGPA 3JW4A 3B73A 2QM3A 2L01A 4A0YA 3ECHA 4I98B 5CLSA 2HWVA 2Z9OA 4WX9A 4ENNA 3TO9A 3WTTC 3RI4A 2V1XA 2NNNA 4ENJA 5J8FA 4CHUA 1ON1A 3ECOA 4HX8A 1HXDA 3BP8A 2LF7A 5J8CA 3TQNA 3CUQA 4GO1A 4LK0F 2UZKA 2FEZA 1RIOH 2A5YB 3MEXA 1MDMA 4PZJA 1YQAA 3IKTA 3EYIA 3K1PA 1I5ZA 2GXGA 1TW2A 1J9IA 3FXQA 1QO0D 3ZN1A 2DT5A 4U88A 2OQGA 1XN7A 3KP6A 2P5LC 3I4PA 1RUOA 1R23A 5ILSA
chains in the Genus database with same CATH superfamily
4TYBA 5DQHA 1AFJA 2Y0SA 1TK8A 4U95A 4FETA 1SJQA 3M8PA 4KV8B 4NXNF 4LSLB 3WU2C 1U8RA 4F04B 1KVIA 4OZ0A 1FESA 2KDZA 1JXEA 3A4CA 2R4FA 5FGMA 3G87A 1JWWA 1L3SA 4DCPB 1X9SA 2ZC2A 4ZVRB 3GVAA 1ETQA 2MH2A 5KG4A 3G71I 3IAS9 4C8MA 3QU3A 2Q2EA 4OI2A 2KLOA 3D5MA 4EGLA 1NK4A 2Z2ZA 1ZZFA 1RCXB 3CDBA 2YKNA 2JVHA 4DV3F 5J2MA 2RKIB 1NK9A 2FVCA 2B0LA 5DGBA 1CJVA 4Y65A 1BC7C 2IT0A 4K5RA 1OYDA 3KLVA 5JR3A 3CJ0A 2V6AA 1IKYB 1VC6A 1HPZA 3M2UA 3CMYA 2OPRA 1FBSA 2DR8A 2H54B 5LJ3Y 3Q5FA 3R9LA 2YNGB 4IQ4A 1WC1A 2B51A 4W98A 3ULQB 4BBYA 3UCUP 1T0FC 1HW8A 1WSUA 1ULYA 2G0EA 2H1KA 3CUOA 3HT0A 4TYAA 3MR3A 5AONA 2EILH 2ATCB 2MKKA 2L4AA 2DMQA 2L5QA 4J9SA 3R5DA 1I39A 1N48A 3DQVC 2Z1DA 2KJWA 3KP4A 3H25A 3V8JA 1SFEA 4PKDB 1KQ0A 1EA3A 1ZHFA 3DXBA 4LBIA 5ICFA 2Y2ZA 3K70C 4OMFG 3KZYA 2BW2A 1TQLA 2CPJA 3HSZA 4QCLA 1OMSA 2GA7A 3KE2A 1RTIB 3IA0A 3IBCB 2A6EF 5A76A 5A2QK 2VOPA 5E41A 5E8GA 1Q86T 1SFUA 1WKJA 4WJBA 3JTNA 4GC6A 3LGMA 2ZE2B 4ZPBA 3R7BB 2CQKA 1JLEB 4YG2F 1TTYA 2EXUA 1H6KX 3L2CA 3HD2A 5CYMA 3P5JA 2DAOA 2HVIA 2TDXA 4C8LA 1XMAA 4DR5F 1A6QA 1HNZF 3DPTA 1MLAA 4ETSA 4LF5J 4CYDA 4LF9F 1A0OB 1SFKA 4QIFA 1JJCB 4P2MA 4FPIA 1S5LC 4GRSA 3CC4I 1Z05A 4R8UA 1UEKA 4EVIA 2PMZN 3LMMA 1VQ8S 4XO0A 2LQ8A 4A5NA 4W92B 5LXRA 1FSEA 4LIWA 3RR7A 4PAAA 4O6JA 3V42A 4OMYA 2IYIA 2JRSA 4R25A 5D8KB 5CVVA 1FNMA 1QVGR 4DG1B 2BZ2A 1WC3A 4O3RA 2ZH5A 4KPCA 2E7XA 2IM2A 3LP1B 1C0TB 4C2MJ 3W5XA 2K1RB 3DXJF 2H51B 3MCSA 1K0VA 3QOEA 3OYJA 3T1BA 1D8ZA 3IS9A 4UV8A 1KOHA 5BYSA 1G3SA 3CCLI 3CC7I 4D5FA 3M8YA 2DPUA 3ZN0A 3ZTOA 1H8AC 4IQXA 1Q1HA 1OSCA 2L7MP 4O4GB 2GXBA 2X1FA 2BY2A 2JNJA 1MBKA 3KKFA 3T8RA 2LVSA 1LOUA 3DLKB 1WRJA 1T9YA 5DLGA 3CPWR 2H1LA 3IH3A 1T39A 4BC7A 1VQ4S 2WB1N 1YYVA 2LMDA 2E1AA 1UFMA 3LSMA 3LO3A 4S05A 1BMQB 1FVSA 2CV2A 2EFQA 5F8NA 2L9SA 3ILLA 2OPSA 1ZYRF 5A8WA 3CMES 2CADA 2HIYA 5HJXA 1OPZA 3KNGA 3LGNA 3BGLA 2N7YA 2DMPA 2VDIA 1OISA 2GVZA 3C16A 2DMUA 4PPZA 2O01C 3P6YC 2RNEA 2J8AA 1N5YB 3SQGB 4DV4J 1CPZA 4HNVA 4HDVA 2SXLA 3DYAA 1IXCA 3RBXA 3FXUA 1F36A 3TYTA 1PYOB 4YELA 4IX7A 1XC5A 4RAGA 1TELA 3AD7C 4QIEA 1N78A 3OTDA 3H5UA 1IF1A 2AGOA 1K6OA 2L3DA 2DI3A 2UXDJ 1SVLA 3AJ1A 1XSVA 2CS3A 5E20A 1X4PA 4WK3A 2KT3A 5E7OB 3HDSA 4P10A 2IIHA 2VA2A 1LNQA 2P2CB 2Y1LB 4LOCA 1UVJA 4RJVA 3H0DA 3CC2I 4OX6A 3V6DB 4JYKA 1ZAVA 2WAQD 3IRRA 5CZXA 1L3LA 3G6VA 2HEOA 3LAKA 3ASOH 2DGXA 1YITI 2NZCA 3EYZA 3OYDA 4PPDA 1VNDA 3OVBA 5K1YA 1PYVA 2FDNA 4R8HA 1HW5A 3SEQA 2JLFA 3HZEA 1FK9B 1UHMA 2FY8A 1ZELA 3QT7A 1ACMB 5IFMA 4DFPA 2UUAF 1R36A 3Q23A 2ZXHA 2R7TA 1LW0B 2ZD1B 2V9KA 2ISYA 4BH9A 1IBKF 3QAEA 3KFWX 4OJ3A 1T03A 4RKUC 2O6GE 2HYJA 5DG7A 1XNRF 2W2QP 1S6QB 2O03A 3R27A 4XMYA 4XSXF 1ETOA 4B3OA 1TW3A 1KOOA 1TZLA 4XKWA 4A93J 4L73A 4Z7YA 2BJ7A 5F8MA 3BR9A 3IKVA 1FVQA 4IRDA 2QTWA 2N4DA 3M30B 4OIRF 4P2SA 3PYFA 5BR8J 1YFHA 3DLAA 4QW9A 4M3DA 5ED4A 1MGTA 2AT1B 4NLVA 3KLEB 2GIVA 4M5GA 4EM1A 4G1IA 2D3ZA 2J7KA 4B9MA 2DNNA 3LL7A 1LWCA 1P1TA 2E5JA 1FTCA 1P27B 1JLCB 1O3RA 4X4PA 1JJ8C 4F02A 1T95A 1GXLA 4E8UA 1BIAA 3R61A 1IBMJ 1H74A 2X1GA 1I6XA 3EPZA 2C2KB 2R2RA 3PY8A 4ZMMA 2CQ7A 2Z5UA 2KXHA 3I32A 4XIUA 2E1MC 2GOXB 4XK8C 5DGAA 3HXLA 1FWPA 1R71A 4B3TJ 3CULA 1IUFA 3SSSA 2LP0A 5K8PA 3PX0A 5BNGA 1KC8T 1HSJA 1TUVA 2RAQA 2JUCA 4LJMA 4WFNQ 4LR9A 4N8OA 5K20B 4M3FA 4JI3J 3OFEA 2QWWA 1RC9A 3TEDA 1SH2A 4WCEQ 3X3UA 3ZTQA 5IT9U 5TGTA 3UI3A 4GDFA 2PFBA 2XHKA 1W1WE 2HYGD 3ISZA 3NS6A 4NXNJ 4BL0B 3FBEA 3EXYA 2O67A 4ID5A 5I4MA 4BY7J 4MFBA 1QNTA 4JI0J 4ZYGA 4IXAA 4HLBA 2KT5A 2QV6A 5K8OA 3QRRA 5M3MJ 1LB2A 1RHJB 3WGHA 2P0WA 3SIPB 1Y7PA 2JL9A 3GYHX 1TQPA 4EJTA 1FIPA 4Y7NJ 4DV2J 2AHQA 4PG6A 2B4OA 2DGWA 3SSQA 4X64J 2NOGA 5ETSA 3QNWB 3RRHA 1FLIA 3RBEA 3KCCA 1RT7B 3HFKA 5HLGA 2XRNA 2K3FA 2W24A 4JK1X 4YFXF 4RBTA 4J37A 3HJEA 3KLHB 3BY6A 2YPZA 4A8QA 2HS0A 4A3FJ 2V7FA 3RCOA 2XEXA 2VC0A 3ENVA 2KL8A 3HJFA 4M9SA 2GFFA 4CH0S 4OX9F 4ES1A 1VQYA 3N0VA 5IWAJ 4CCOA 4YOEA 1SVOA 5FJ4A 2F5EA 5K5RA 4ZH4F 2HWTA 2MLGA 4CYUB 3GLXA 4LK1F 4M6XA 3KP5A 1HBNA 2AJ1A 3HC7A 2I8EA 2B3TB 3FZBA 2I5JB 3F73A 5KFNA 3UVJA 2KHCA 3R3TA 2PJRB 5HMWA 3KLIB 3DLHA 3J81Y 3K4JA 1Q8IA 4CCNA 3OL3A 3MPDA 3I59B 1MZBA 2RDDA 3CO6C 1C0UA 3FHNA 3EYYA 3RYPA 2CW7A 4FE7A 5CA5A 4XRSA 2ZXWH 4ZDOA 3W6JB 4ZLPA 1SH0A 2ZBQA 3W61A 2KZZA 2NS7A 2AJFE 3I0SB 3PRVA 3VB2A 3PW5A 2IBOA 4O23A 2FBKA 2FHJA 4RL1A 5K7FA 2TCTA 9RUBA 1S6UA 2OUMA 3N97A 4LF2A 1S9FA 2QMXA 2DA3A 4AYBN 1D8YA 1TTHB 5KG5A 1CJKA 2V2ZA 2EZIA 4ESJA 2M1BA 2ASYA 4DEZA 1IKWA 3SCJE 4DUTA 3OSNA 3CEDA 4KC5A 4MTPA 2HRTA 5L1JA 1Y3KA 5JHUA 2EINH 2RIJA 5L1KA 3NGRA 4TKTA 1FWKA 4QWAA 1WG4A 3HOYJ 3KG4A 1WWHA 4BY1J 2E5IA 3UNGC 4UOGA 2E1CA 2QG9B 2LCWA 3R8YA 2YNHB 4EM2A 1SXLA 5HROB 3VR1A 4RU9A 1V3SA 2HG4A 2UV1A 1HA1A 2YX4A 3CDHA 2EB7A 5FDLB 1TV6A 1K1QA 4CCLA 2AYGA 4XKVA 1SB6A 4TVAB 2COLA 2GA1A 3I0TA 3RIRA 1FRIA 5J1RA 1FA0A 4MIAA 1UW4A 4RB3C 4KUMA 3JSMB 4G6TB 3O2PE 1XTAA 2DXEA 3G9CA 1JTYA 3S93A 2M3DA 3SXLA 4R5PA 3FMBA 2OZ6A 3VAJA 1B7YB 4M8LA 2Y75A 1R27B 2WW8A 3G2XA 1WKMA 2K3PA 2RU3A 4IOAF 4WE1A 1XNQJ 1OJ4A 3MAAA 4ZCLA 3L2RA 4ZJLA 4X1EA 4CI0B 3I64A 1B0VA 3CSKA 1EETA 2QLBB 1SANA 1SUQB 3M32B 4A48A 1JLBB 1R9TJ 4DQRA 3FSXA 2XQCA 4F7VA 3IGVA 2DNQA 3KJVA 1NH8A 4L75A 4HG2A 2DDBA 1LDJA 2ID6A 7FDRA 1IUYA 1LWEA 1JLGB 1R6VA 1KSPA 3M8QB 5ERIA 2DB1A 3GXOA 4K4XA 1SL0A 1ZM4A 2W8LA 2XUBA 4TLQA 2IJFA 3TJ9A 4ELTA 2J9EA 1F5TA 1M5HA 4JYAJ 2J0QD 2VJIA 4IR9A 2V5HG 2DHSA 4RW8A 3KK2B 1JKRC 4UQGA 2KKOA 3CLOA 1RT2A 1R8BA 5DD4A 4QR0A 3MWMA 4F4ZA 1PO6A 3MN2A 4M6YA 3CGIA 4CZCA 2VU5A 4NQWA 1UJ4A 1JXSA 4F55A 3NXZA 2ZFHA 1S6PA 2FE3A 1MMAA 2YPRA 4M72A 5FB2A 5F64A 3VSKA 2EPFA 1S48A 3AHPA 1U6BA 4ZLLA 1YOVB 3OS0A 3HULA 4USTA 3KTQA 3SEOA 4ELUA 1CS4B 1LEAA 5SUHA 5EF6A 5DRKA 1RTZA 2J0WA 2R5ZB 4RUBA 1V5FA 4GC7A 1YG2A 2CW8A 2RN7A 4MFDA 5GP9A 1RT4A 2AIRB 4Q8FA 4XK4A 4HSRA 1F5CA 1W7PD 3K69A 3GX4X 4ZTJA 1PIEA 3HMJG 1KDNA 4BLGA 4XQFA 3LANA 1YLXA 3C66A 1BC8C 3RKXA 5C24A 2UUAJ 2NPFA 2GV1A 3HVWA 3VWSA 1S6LA 1NJYA 2WY7Q 2I38A 2Y30A 1GXTA 5CVRA 2DU9A 4MFEA 4WXCA 4Y3OA 3JYTB 2NSCA 4QLCU 1HQ2A 3PNYA 2ZJRF 5IT9Z 2HMIB 2MD0A 1C4CA 3C15A 2J0SD 1GT0C 2DPJA 4PQUA 5LD2C 5LRSA 2NXNB 3DI6A 2HWHA 4ZN3A 2MQNA 2MZ1A 1Q8BA 2BM0A 2HQCA 3QPIA 1K8AT 4A2UA 4B48A 2K40A 2GVDA 4I6AA 4AIDA 2OELA 2FTRA 4LMZA 5B5EC 4ECWA 4XLCA 2Z2SB 2AYMA 5CAAA 4NHJA 4G8XA 4QOTA 2DH7A 4BDPA 4FXWA 4N4NB 1M0SA 2VKEA 4JX6A 4V19J 3AAWB 1YIJI 3ZGKA 3E01B 2HNDA 4UUSB 1TP7A 1QHGA 3CF5Q 1U1RA 2QCOA 4K8RA 2JK3A 1VQKS 4GKKJ 2NZ4A 1DU0A 3BV8A 1N75A 2OV7A 1PGZA 2H5IB 5KAKA 1KHWA 4G7HF 1PP8F 1VQPS 1MMDA 3HXMA 2KYXA 1RWNB 5L1LA 2RILA 4NLXA 3OLAA 2ZNYA 4DQSA 1G4CA 2Q79A 2IPOB 4QWDA 5KG7A 4K4ZA 1FEXA 3PW4A 3H9GA 1WJCA 1CULA 2DK5A 2F5VA 2W9CA 5K5MA 4WIQA 4C98A 2M3AA 1GX5A 1FBQA 3FXJA 3OYAA 2NS1B 3VCDA 3NY0A 3JXOA 2LFBA 5FD6A 4BE0A 2RRNA 1D5YA 4Z6YA 3M6UA 3HZJA 3HOSA 3OLBA 4DHVA 3HUGA 1REVB 5DDQC 1XMQF 3CCQS 3DRRB 2VG5A 3TBIA 1IG7A 3JAMY 2VT2A 2QVOA 1TL1A 2HSEB 4CNYA 5KFTA 4LF8F 1RU2A 2W1OA 5T14A 1KFDA 3GLJA 2ZUGA 2Y1JA 1JJHA 4YY3J 4QR2A 2IW5A 1RWPB 4IG0B 4HYKA 3NAIA 2R7VA 1H38A 1NDKA 4RLFA 3V4MA 4Y0FA 2OPPA 1T0FA 4MLOA 4NZ0A 1P92A 1OWXA 1GV2A 1U25A 2V4RA 1GEHA 2D1CA 1VQMS 3VSLA 4HH0A 1F1BB 4OLOA 3TQEA 4E70A 1N32J 1YRUA 4HTJA 2RU9A 1HKQA 1WHUA 4U6PA 3S7RA 4YP3A 2P9GA 1Z7UA 3F22A 3J7AN 4L5EA 5E1XA 3JTHA 4IJAA 5G0RA 3VAFA 4LR7A 3ET6A 1IWAA 2VHGA 1ZG5A 2BX6A 4RW4B 2LXFA 3RPUA 1TQMA 2X6XA 4NLDA 2G7HA 3IP4B 2PEBA 3NAHA 1RNLA 3G6EI 1D3WA 2HFVA 4LRAA 2P5KA 2ZJPF 4AVPA 5EEHA 3LSRA 4N41A 3C6UB 3MCOA 5GAHU 4G6QA 3N4MA 2YWHA 3ELHA 2GQQA 3GR1A 1J59A 2QA1A 2N4CA 3VODA 4A3IJ 1SC6A 4HDGA 2R2TA 3ZO7A 3GW2A 2CUJA 4I0AA 3AL0B 1BC6A 4CYCB 3GUDA 5A0YB 4YDXA 1ULRA 2H27A 4BHBA 2HGLA 3W3SA 3DCAA 2FGOA 4EV0A 1XC9A 2CNNB 2MDAA 1Y0HA 1O5JA 4DV1J 4DV0F 1TKXA 4CT8A 3KX2A 5KG2A 7AT1B 1BI1A 1HC8A 5C42A 2FBHA 3ZTSA 1HQEA 4Y2MA 3DRPB 4AL5A 2D9OA 1MJBA 3BQ0A 2IS1A 4M3BA 4MQ9F 1P4XA 5JMNA 1MU2B 4ZVPB 4KQZA 4X62J 1D1AA 2H8RA 2ESHA 5F08A 2RSQA 1YW8A 4URGA 3RYLA 3L2UA 3DDIA 3K58A 4C4WA 1WDTA 2Q6CA 3N5BA 4M5DA 4CXFA 2MLYA 2YPYA 4M5HA 3T1HF 2CQ2A 1XIQA 3PSFA 5LHIA 2XYHB 4XORA 2M5WA 4C48A 3T1YF 3MMYB 2QSGX 3D68A 4D9JA 4M63A 5A8RA 3OXGA 4KGXB 1YW9A 1Q1KA 3BBBA 2DO4A 3TNVA 2A2DA 2BRKA 3H7HB 1ZLKA 2EPIA 3SZ2A 1Y4ZB 5KAFC 4FP9A 3OHAA 1W5TA 2MB0B 2V67A 5DQIA 3TW7A 3LAJA 3EUAA 2HDDA 4U96A 2F4FA 1ZAXA 4WP9A 4XDDA 1U2FA 3LF0A 1HBUB 3ZC4A 3D3BJ 1U0SA 2G4BA 3K2ZA 2XC9A 2K3IA 4QWCA 3O6BB 4QYZK 3O8HA 4LVNP 4JX4A 1RT3B 4DFJA 1NK8A 1BQNA 3TZWA 5KG0A 3F3XA 3BGUA 2KB2A 2YY3A 1FD8A 3FK7A 2CWEA 1MMSA 1FEHA 1CVJA 2R5YB 4NPOA 2HFSA 3A12A 3HHLC 1E0EA 3LSKA 3ZQGA 2Q6BA 4O44B 1YJVA 1O7FA 3OS1A 2KRBA 1TNTA 2FGCA 4DPWA 1TWCJ 1T02A 5KFCA 4L9NA 1V5EA 3BZ6A 2C3PA 3ISPA 3FCWA 4CO1A 2CWKA 4HR2A 2WAFA 4H4MA 5FLXK 5L3CA 1BGXT 4JI1J 1X4AA 3NGUA 4LG0B 5JUMA 4I6ZA 3LOCA 3QODA 4A8KA 5F8HA 4QIVA 2Y0BB 1BE4A 3LH2S 3M8PB 3H5YA 3GTKJ 1UVMA 5EX0A 1CJTA 2ZCWA 3CDUA 2VL1A 2UVUA 4HL9A 1XMKA 5IV3A 2N3OA 3CJNA 3IRXA 1FRHA 3HM5A 1QU3A 2FSWA 4BQQA 1GXQA 1JKOC 4QYRA 1DQ9A 3KJQB 1K4TA 3C18A 2OJED 3WTZA 1KHVA 2Q2EB 4UZBA 5DD8A 3B02A 2YKNB 5J2MB 3VAGA 3BJ6A 4P5OA 4DBRA 1CJVB 3MMBA 5FKMA 1HR0F 3HI9A 2AJ0A 2K02A 1KLMA 2FRHA 1R8HA 1WZ2A 4HSTA 1T8EA 3CC4S 3CDIA 5ETQA 2X6YA 1G59A 1HPZB 3FRYA 3M2UB 2OPRB 1UVLA 1Z7LA 4UVAA 5FKNA 3FDSA 4KE5A 2HHHF 2MSYA 2VKDA 2X9DA 5IS2A 5HL7Q 3DU6A 3GONA 2DNMA 4I99C 3ABUA 1QA6A 3J7Z5 2X1CA 4AD9A 5DM7Q 2HQNA 3EJMA 4ZDLA 2V9VA 3K5LA 4FF3A 5MAOA 2OSRA 2VPXB 1SL1A 1LXNA 1X4EA 2BGCA 5HN0A 1ZN2A 2OO4A 1N25A 5CHCB 2PFDA 2O3DA 4DUYJ 1MBFA 3S8SA 1KU2A 3ABTA 3DRYA 4ZVEA 3HVTB 2ALZA 3CCLS 2VBZA 3MR5A 3ABMH 4B3MJ 4OX7A 2KRCA 5ILVA 4N9IA 3SDGA 2C42A 3FFIA 3Q22A 4RLEA 1H9GA 1R4MB 5DO2A 2CQGA 5HDKA 4LITA 5LSLA 1S4EA 4K5SA 4AC0A 4N5SA 4IHTA 1IRGA 4NLRA 2LNBA 3GE9A 3GV5B 1RAAB 3ZXWA 3KOAA 2FZGB 1AYEA 3BSNA 4KRWA 2DA2A 5IYDJ 3Q2SC 1WF1A 2MG4A 2JJ4D 2QEXS 1TFWA 1ZR2A 1F60B 4F8RA 4EEFG 4X4UA 2C2RA 3D6FB 2C2ZB 3DWLE 1SIWB 4C30A 4MK7A 3M9NB 5THWA 4LGWA 2M0CA 4BXFA 4PJMA 1HL6A 4P7VA 4B02A 5CYMB 3DBRB 1MJAA 2WONA 2XYGB 3TJAA 1LDKB 1BQMA 4NEYA 2RC4A 1R89A 3LALA 2HWIA 4KSEB 4KGKA 1NDPA 4LRDA 5KFYA 2E9RX 4S0HB 2NUHA 3H0PA 2YKPA 1PUEE 4IHYA 4R0EA 1NK5A 3ZZPA 4ZHRA 4R8UB 1G1XA 5CQGA 4NLSA 1V5VA 3ZMTA 1R0AA 2BV3A 2ZB9A 3CD0A 3QIPB 4ENKA 1FEEA 2QLZA 4Z7CA 1REPC 1H2UX 2MBFA 1J2VA 5F9NA 3Q9VA 1ZR4A 2W82A 4MKAA 5HBMA 3MMCB 1YSJA 3Q8SB 4DUZF 4MAKA 1XSXA 2HQDA 2HBZB 1TL5A 2RVCA 3CC2S 4JQFA 5IOZA 1VQ7I 4LF8J 2RS8A 4DZJA 3RKWA 3KLOA 3CCUI 4K2EA 4L74A 3L7UA 5K5QA 4IFYA 4WXDA 2DEJA 5CQEA 3IS9B 1O3TA 1U09A 3MFKA 1EJ9A 2M8HA 1Z6TA 1MMNA 3X1LB 2AX0A 3OXLA 2R3VA 3PO5A 4D3GA 4A8WA 5GAGJ 4DN9A 2AP6A 4FQGA 4IRGA 2HVEA 2DXFA 3I87A 1BJAA 5IT4A 1W5SA 2XGXA 2Y9HA 1HWIA 3SZTA 2CJJA 4Y00A 3ZZYA 1T33A 3M9AA 3K59A 5HVHA 2PIIA 8ATCB 4N7TA 1Z6RA 2EKYA 2F4MB 5HLFB 2DFFA 1Q78A 3SZPA 1RDRA 4PXDA 3OL8A 4IH6A 1KLNA 3S6EA 4ZS6A 4LSNA 3TA2A 2YH0A 2JJ7A 1KQFB 1ZTTA 3DLGA 2DVIA 1R58A 5HLHA 1TKTA 4OLPA 3C2GA 2IA0A 3S17J 5A8WB 3J81j 5CD4H 2KRHA 1FTZA 3IL2A 1A7GE 2I6WA 3FWEA 4M9XA 3SDEB 3OL7A 4K2XA 2VZ9A 2UVWA 2GVZB 3C16B 3QRFF 2IBDA 4Y2AA 2FYXA 2VQHA 3QYYA 3DYAB 3HRTA 2STTA 1LFPA 2DTZA 1MMGA 3CCES 1P6TA 1RLCL 4PFOA 1BL0A 2UWMA 3NOGA 1WCMJ 4Z2YA 4ZTFA 2D2WA 1V55H 2X3GA 3R6SA 1JUMA 3KEQA 2D1HA 1V3ZA 4BBRJ 3AA9A 4I01A 4DV0J 5CH7B 3DMJA 4ANJA 3BPXA 1KONA 2AQFA 4F4XA 2VT3A 2HNYA 3PIPQ 2EVZA 4ZN1A 1S4FA 2JEFA 1B8IA 1LVKA 4ZDPA 4B47A 4TY8A 3G1OA 1U49A 1U1QA 1DLOA 4C3LA 1HBMA 2QSFA 3BJAA 1VDHA 1VI0A 4N4OB 1VQNI 2L4MA 5CZVA 4EMSA 4KGZB 1OQYA 3C3LA 3ILIA 4LSLA 2VD3A 2P9CA 3E8OA 1KBRA 2Q0OA 1YDLA 4CLZA 5AJ3J 4WZQA 1JKHA 2H5JB 2EZKA 2HHWA 3T1AA 3ELKA 4KICA 4TV7A 1TBXA 1X4DA 1T03B 1HNVA 3FQLA 1VLYA 1HNWF 1MWQA 1FOXA 1GT8A 1S1TB 1WG1A 5DTDA 1KP6A 2B0GA 5B0EA 3RB0A 2OKQA 3L7OA 3GJRB 4B3OB 4OI3A 3UCZP 4DL3A 4P71A 5D4LA 4AYBA 4ENNA 1XG1A 3WTTC 1D0XA 4CLUA 2V1XA 1UL3A 1FNXH 2CJKA 1N6QA 4Y52J 3Q3SA 2AX1A 5J8FA 4EZ9A 4V2FA 4HX8A 3BP8A 1O4XA 1LWCB 3G6XA 4GVLA 1DGRM 4U9RA 2BVMA 3DXSX 4WBFA 3MR2A 2A5YB 3MEXA 1MDMA 4CLPA 4PXBA 3UR3C 3TL4X 1F9EB 1TAUA 3HGYA 1TW2A 3VPRA 4WPAA 2LMIA 2C2OB 4L76A 2DT5A 3OY9A 3S2DJ 4EZ6A 3TMOA 2RHSB 2P5LC 3PUBA 3I4PA 3RKQA 4DX6A 5HJYA 2CPZA 5ILSA 3KDOA 4UUXA 1JMTA 3BQ1A 4AL7A 3GFIA 2ZH4A 3U02A 2UV8A 2F9JA 1FC3A 3BG7A 2JA2A 3CCSI 4USWA 1ZK8A 2XROA 4Y3CA 1T2KA 1YG0A 3GBGA 2BBEA 1VQ9S 2AJ4A 2HOEA 3J7YI 2MQOA 2VG6A 4DR4J 3TEGA 1DQUA 2L7ZA 1RP5A 5H20A 2N82B 1PJ5A 1OR7C 4ID5B 3WGIA 2PMUA 3VZHA 5D78A 1H2VZ 4MK9A 1S72S 4WYLA 1J5EJ 3U1NA 3OSPA 2NSBA 2I10A 5KOXA 1QSSA 3TUZC 2XGDA 4MKYA 2FXAA 3QSYB 2MXYA 4BACA 4KT5C 3ENWA 4A3BJ 3DGPA 2ZBCA 4CA0A 2DHAA 2HKXA 3BF4A 1RT5A 4DPXA 2XGQA 1IC8A 4KITB 3HHDA 4O5VA 4P75A 1X58A 3O3LA 2ELHA 5HQLA 4ZK7M 4D7NA 3OR2B 2FMLA 3BO3A 1S57A 2MJNA 2BVLA 2CJBA 3QAHA 1FE4A 4Q47A 3TVKA 4IYQA 2RQMA 1YJRA 3T19A 1F3VA 5E3QA 2PI4A 3GF2A 4KAIA 3JSRA 4O0NA 3OW2R 4JBAA 5L9XA 3RPQA 4CCJA 2KFNA 1WC5A 1HHQA 3NGDA 2XY5A 1MIJA 3UDLA 3NWRA 2Y0SN 1HDPA 3M1EA 4YN3B 1R5ID 2DDAA 4L9VA 1YJUA 1H0MA 1H2TZ 1HD0A 3UVJB 4PJLA 2J7WA 2VICA 3ZQFA 1JGSA 4OI6A 3VAIA 2PD1A 2HTSA 4A3EJ 4EQQA 5LGNA 2VKZG 2IVMA 4CO3A 3OUYB 4IRCA 2RQQA 1C0UB 2YQ1A 2ZZMA 3DOLA 2L48A 2FC8A 3SDBA 2HFHA 3FMSA 2HHPA 3LGHA 2BJ3A 2CPEA 2DJWA 3PDNA 4TY9A 5K7HA 3I0RA 2OHDA 5LEKA 1UFLA 4USHA 4U7UD 1MN9A 2KT2A 2F48A 5HVFA 5GAEI 2ZHAA 3TARA 2NAZA 2NQPA 4CUGA 1U9NA 2WZ1A 1N77A 1TR0A 4QQBA 4FYVB 3U1LA 3ZZOA 1UJ6A 3RB3A 4DZPA 3AQOA 4BYYA 5KFSA 4PG5A 1IKWB 3QGPA 2ZBKA 1S1VA 1BR2A 2V2KA 3OQ2A 3MR7A 3SQGA 2DK8A 3K1MA 2MKSA 2HVHA 4Q45A 4DMZA 1NPKA 5DUIA 1JLQA 3CDWA 1RUNA 1OQ3A 3V4GA 1O51A 3H5SA 1RWXB 1JJ2R 3WHCA 1R22A 3L2VA 1FKPA 3MAQA 2WVCA 4RO0A 3FCHA 3L95X 1TVRA 5FLXU 1ZPWX 4M3GA 1FDAA 4HI1A 5IC4B 2XAFA 3J7A1 1TV6B 2HEKA 2ZO4A 2CQCA 3KETA 3H9JA 9ANTA 3EMTA 2R8KA 5ILUA 2XMWA 3JSYA 3V6DA 4N76A 4J9LA 3CQZJ 4I6WA 1LW2A 4NXMF 3POTB 3TR5A 3LAMA 1EIYB 5IOLA 1X3WB 4CLKA 1QUVA 2M2BA 1IKXA 3NGSA 1WKLA 3NRBA 4R5PB 4Y17A 3PZPA 1RABB 4RAYA 1UKUA 3H3ZA 4RPFA 1L5UA 2GZOA 4U7BA 4M74A 2CUYA 1TT0A 3JSPA 5LT5A 3O8WA 2DY1A 3MAAB 3KJFB 3A8EA 4M5KA 2XGPA 3PR5B 2V1DA 3EGZA 2H5EA 2V79A 5EGOA 1MBEA 3BR1A 3ROUA 3NWGA 2OD4A 3ZR8X 2ME6A 3KJVB 1DDNA 3M30A 5L3FA 2Z56B 1IVZA 1NK2P 2DW4A 4C8OA 5E5NA 2HFNA 3CMEI 3TO6A 1T3NA 3K7RA 4RZRA 1LWEB 3LP0B 4LBPA 2X0LA 2PMZD 2KIFA 3S3OA 4PXCA 2P9EA 1JLCA 1D9AA 2D5VA 3J81K 3AXMA 4L3KA 3N4WA 3OYEA 4MYUA 5U47A 4JP0A 2R7OA 4KMUX 1FDNA 1RT2B 3ZFVA 5E0OA 2ROEA 2KVQE 3BG6A 4RW9A 1YS6A 4NQWB 4ANCA 4IHVA 1S6PB 4B08A 5LMNF 2XF5A 1KYWA 3RQIA 4NLWA 3IC7A 1B9MA 2FF4A 4RM3A 4IF4A 2O5DA 1T9WA 2BRLA 3FKIJ 4LR8A 2IS6A 1BWEA 2DTRA 1KTQA 2IMOA 1VZ0A 4X84A 3CJQA 4F2SA 3FISA 5AXKA 3CCYA 2QYGA 2LU1A 1Y1VJ 3VYTB 1FERA 4B3RJ 4LFCJ 1AW0A 3AB2B 1RT4B 3AG2H 1TKZA 3N6NA 5BMZA 2GO8A 1H73A 2CQ0A 4I0WA 1S59A 2DOAA 2C2EA 3LFUA 3OYNA 4IOCF 1HFEL 2V34A 2OLWA 2W2OP 2WB1D 2FJDB 1V54H 1UFKA 1IW7F 2QSWA 4HDUA 5C24B 5KT3A 3MEEA 1B72A 2HNZA 2EQRA 2VJVA 1OLTA 2KXFA 5ETVA 3V6JA 3RSNA 4KYWA 2ZXJA 5J1YA 4XTTA 2R9LA 4OMZA 3JSBA 1HNWJ 1RWWB 5DDRC 2VBYA 3MECB 1WFXA 3K9TA 3H5XA 1HQUA 3QYEA 2Q43A 3C15B 1E2XA 1IV6A 3GFJA 1NB2A 4DN0A 1KKHA 2PGCA 4F3MA 4PQUB 2VH7A 3QPLA 1RT7A 4HACB 5JLWA 2CPDA 5B1AH 1YX2A 2DYAA 3DEUA 3G1LA 2CH0A 3BGFA 4ZJOA 1IN5A 3FSYA 4QWQA 2DNKA 4IZZA 2APOA 2GVDB 3TVYA 1F2HA 4LF6F 1FFSB 1X2MA 2HGNA 2NS0A 3M6XA 4XPEA 4D0PA 3P45B 3DF8A 3KXDA 5F0WA 3THPA 2XAUA 2NVYJ 1FJGF 4KN7X 2CRGA 3GIMA 3UDEA 2GOMA 2IA1A 2DNGA 4LQ9A 5LHHA 1Q81T 4NC6A 4DYRA 4CYUA 1NKCA 3T9NA 2CFXA 5LHGA 4L3NA 5T7LB 3D4JA 3PFEA 5EDWA 4NUBA 2EC0A 3AFHA 3OYFA 4OZLA 3W65A 2BW7A 3KK1B 4JI2J 3M7GA 1GK8A 3ZOBA 2BE2A 2I5JA 3LOUA 2NR0A 3PJXA 3D6TB 2YUSA 2V63A 3NNCA 3KLIA 2ETHA 4UB8C 2F5GA 2EFVA 2GZWA 4M5IA 2OIHA 3PEJA 2FJWA 2LKSA 4MT1A 2F4VJ 4FASD 2JPBA 2F4IA 3NNAA 2OTJI 4YR0A 1CQTA 2HI3A 4LFBF 2FC9A 5HDGA 2FVSA 1CULB 4CCMA 5E3AA 1P2FA 4QPOA 2W9CB 4JOMA 4NBQA 2LBFA 3AG1H 2W9AA 1FNNA 4BU2A 2ADUA 3KG0A 2HHVA 4HEA9 2MHEA 3MKLA 4ILLA 3H59A 3H5RA 1UA0A 2Z8QA 2GJ2A 1IBLF 1O57A 4HH1A 3QJJA 3Q0VA 3IXQA 2QIFA 2XNQA 5E2QA 1G3OA 2LU2A 4NRTA 2VG5B 1KRPA 4ZVFA 4K4SA 3B6AA 2JT1A 5F0HA 1E17A 2PA8D 2WW4A 1N0UA 5HOOA 1FRMA 3KMSA 1SIZA 2QL7B 4DCJB 5D0RA 2O0YA 2ASDA 2MZJA 2IBKA 1W2IA 3UPFA 4S0MA 4HT7A 1AT1B 5DS7A 4BUPA 3GJTB 1N0VC 4F3OA 3QO9A 4DL4A 3CD6I 3BDPA 2FVRA 1MBJA 3I4NJ 2RHQB 2FZCB 3QBCA 1U6GA 5FJ8J 3GFYA 2M0MA 2IVFB 1F9NA 1GUUA 2MJUA 5DJBA 4OYMA 3GEZA 4OIPF 4IFVA 5DZ7A 2DODA 2EG2A 1QSYA 2NCKL 3GIIA 4BEHA 2MZQA 2HQIA 1Y3JA 3Q0AA 2NRAC 2E1NA 5G0RB 4DS5A 1OKRA 3ET6B 3H36A 3C3WA 4CZZA 4U8VA 2HDCA 2CXEA 4DPTA 3H2UB 3BQYA 1NAQA 2LLKA 3OTOF 3I9V9 2C6YA 5FLXZ 3T5XA 4BE2A 4A6EA 4RNMA 1FXRA 2JUGA 1FP2A 5CYVA 4NCGA 1CC8A 1JE8A 2IJRA 2E5LJ 1AHDP 2RDJA 3C7JA 2Z2LA 3FEXB 4HW0A 1Q7LB 3QFWA 3P8BB 1X4CA 3HSEA 3WIUA 3GMEA 3VGUA 5I42A 2C2DA 1K78A 3AOCA 4FYYB 3R60A 1JLBA 2UUBF 2AXTC 4OYXA 5KFUA 4U67Q 3A1YG 1SAXA 5IT9Y 3GSIA 1J7KA 3ZQCA 4OZ5A 3AH6A 3CB4A 3KYLA 1TKXB 3NCRA 1GMWD 4KIAA 1EKEA 5C42B 1YW7A 1LKXA 1HQEB 3FRZA 1VRQC 4E7SA 3MCMA 2CPHA 4KHPF 1RAHB 1EQMA 4KPYA 1Z9CA 4LBHA 3CJ8A 3FBBA 1XD7A 2AEFA 1KS2A 2DRBA 3D67A 2V8DA 3V7SA 1W36D 4ZC3A 3M2RA 4OYZA 4A3GJ 2IEKA 1IQTA 5GAGU 1R31A 3SSRA 1K44A 3VZIA 2CU7A 4M73A 1Z67A 4QIGA 4ENOA 1FJ7A 4M5DB 1LEBA 5D4OA 5JI6A 2YU3A 2WBRA 1WGXA 3ILOA 4DR7F 1D0EA 2X6WA 2ILZA 4WP8A 3KHHA 1O6XA 5A8RB 4TU9A 1VRUB 1IKVA 3MM5A 3Q0WA 3DBHB 3MCNA 2MZRA 2YKMB 2R5ZA 3JAMK 4A8OA 3P9KA 1QTMA 2RVJA 4FYWB 1JJ6C 2LREA 2XPWA 4IKFA 2OPQA 4Q4ZF 2Y48A 3HRMA 5HNFA 1O8BA 3GIRA 3R0JA 3MEKA 1FHTA 3GQCA 1IXKA 3EM1A 4AM3A 2RQ4A 2IGKA 1F3FA 2KTQA 4EK2A 1ZG3A 3HHGA 4UHTA 2W25A 2CGPA 3RRKA 4CDIA 3E5QA 3ZZRA 1TWHJ 1RWMB 2VBXA 4FX4A 5L46A 3PJWA 2XAQA 1BQNB 1K9MT 2QMWA 2EW9A 4AYBD 3O1LA 3FXOA 1X3ZB 4IRKA 3T0YA 6FDRA 1LJ9A 3AD8C 4HV5A 3G82A 3K5PA 1HYSB 2HMIA 3OR2C 2YU9J 3BM7A 1X31C 1YBTA 2PI0A 3DTIA 4NYZA 4KNYA 3CCRS 3WC2A 3E0JB 1PUFA 2NXNA 5AE1A 2M4GA 2WV1A 1IDYA 5ETPA 3LQQA 4BXXJ 2RB7A 1U8SA 4OZ1A 1DTQA 3A8IA 4YB5A 1S0VA 2DCEA 2OAUA 3LQRA 2IP2A 3DEWA 1B3TA 4KY3A 4OV6A 1EKRA 2H48B 4YS2A 1RU1A 3DBLB 3CCJS 3OV8A 4H4MB 1U7LA 2LKPA 4JOUA 4JI6F 1DJ0A 3PW0A 4ECTA 3FDYA 3PM9A 3KK3A 2H4WB 2KISA 1AA1B 1X1CA 4V19X 1I6HJ 5F8JA 1NTCA 4QPTA 1PJRA 1CJTB 5H9EJ 1C0WA 2JVOA 4QTRA 1ROFA 2UP1A 1WWXA 3RZOJ 2CMPA 1W26A 4URSA 2FNPA 3KHLA 3REOA 3QPHA 1QD1A 1YHQI 3IRXB 2PN6A 2F63A 2VJJA 1F9FA 3DGVA 3HT3A 2HAFA 2QL9B 4OJGA 3BR2A 3DHXA 4DSEA 4J5OA 4PQAA 4DSKA 1SKUB 5C5JA 4J9OA 3RG6A 1C1BB 1VQ5S 1P7JA 2J9DA 1OY8A 3GJQB 3IC1A 1Y5LB 1IRFA 1FO1A 1GTEA 3TA0A 1SD7A 3I54A 3MMBB 4UUWA 1D9FA 5AIQA 3A01A 1ZOTA 3TGNA 4G3IA 2H94A 3KUGA 3FXRA 1WF2A 4OYPA 3GWZA 3EQLF 1WPKA 3TDZC 2YTCA 3U1MA 1S9EA 2Q1LA 1VTNC 1S8NA 1YJNS 1I94J 1VFJA 2G9OA 2R2SA 2RH3A 4AQYJ 1REVA 4DR1F 5KHDA 2DISA 2YSRA 4MGRA 2VODA 1S7OA 2BY0A 1HW9A 3OYCA 2P7VB 1S1UB 3Q24A 1EZZB 1M1EB 3MKZA 4DR6J 1VQ7S 1OCPA 5IYCJ 3BDDA 1LEOA 3MR6A 5KCMA 3NEUA 4Y6IA 4WF2A 5HO4A 1KYZA 4URQU 2G0IA 1NHKL 5FD1A 4DR2J 5H9FJ 2LA4A 1WHVA 4G1PA 1KNZA 1SQGA 3H90A 1E6YA 1Z3XA 3PNTA 3FF5A 3QQAA 3IGNA 1NJXA 4LMYA 1ZZNA 3M9OB 1KGSA 2LQJA 2MKIA 3FFIB 2C3OA 3MUVP 3DRSA 1QSLA 5F0FA 3T5HA 4PCQA 1VQ6S 2HQ5A 4X66F 1G6BA 2R7ZJ 2BV6A 3HG9A 1N88A 3KP3A 2E1MB 2VQFJ 3HYIA 2GXAA 3IH2A 1GLNA 2M9HA 4P7TA 4DV6F 1BM9A 2KDOA 4BJ5C 2VJUA 2KFDA 4G1QB 2F8EX 2DTJA 3MDFA 2V8GA 5LFAA 1C4AA 1FY7A 3LPEA 4QWBA 3B78A 4KH0B 2KZMA 5F1JA 3K17A 2H09A 3A4TA 3N79A 1DBDA 4OHYA 3HHEA 2WONB 2GQCA 1D1CA 1VQPI 2I2YA 1J0RA 4F4WA 1BQMB 1D1UA 2ZHOA 1HHTP 2NXJA 3PFYA 1TL4A 1OR7A 1EP4A 3CJ4A 4ED5A 4CYCA 2UU9J 2OAZA 1YTYA 1VISA 1ZH5A 2B4UA 1HSTA 2OFHX 5J2PA 5SZTA 5D5UB 4UOCA 1EH6A 3M8JA 3N01A 2YWFA 2FY1A 5HBMB 3CDLA 5JLXA 3EVMA 1XMOF 4DV5J 2RKHA 4NDLA 1OJLA 5IPAA 4AD6A 1VC5A 2RS2A 3MTKA 3GTOJ 3D1NI 5TRDA 3HOXJ 4I1TA 3S8PA 1FRJA 1UWAA 2Q66A 5CYJA 1JQGA 4IFYB 2W57A 3RQ4A 3O2IA 3BTIA 1SH3A 2MPUA 3Q83A 1T9XA 1VQNS 1SBRA 3MI7X 2QENA 9ATCB 3KUEA 1YGYA 4ITSA 4ZYDA 4Y2IA 4TU8A 1GVDA 4RS8A 3C2HA 4I76A 4FNIA 2IA6A 2Z0GA 3PJ9A 2VFRA 4K2JA 4MEXF 6AT1B 1VQMI 1SD5A 2RE1A 2MFZA 3QP5A 1Y00A 4B3XA 2QBYB 4HA8A 2ZVIA 3W1YC 3MM7A 2DIVA 1I5OB 4MQVA 1RRJA 3MZHA 1HI8A 1Q5YA 4DR3F 2IY5B 4C8NA 1G2EA 4EWTA 4LSNB 4ZPTR 2XSJB 2EG1A 1T9VA 3K6GA 3DLGB 2E60A 5LGTA 2FIUA 4PEOA 1E6VB 4IG3A 1HW1A 3T3FA 1HBUA 5EEGA 3PKYA 1XBWA 3ABLH 2IAIA 4ZIWA 2X85A 4ILRA 4MYTA 4H4OB 3EGVA 3RBDA 2CNOB 3CO0P 2F1FA 1Z21A 3M07A 5B0AA 1RSCA 3DRXA 2XLJA 5DG9A 3HPGA 4NLQA 3JRDA 4EATA 1ZRDA 2OGUA 3CP2A 3HTUA 3GG1A 2MLXA 2ECBA 2AWZA 2W7OA 4USMA 3V4IA 2IGOA 2F5DA 1NM2A 4JI5F 3LP2B 2XZDB 3DMJB 5IP6A 4NX9A 3GWCA 1UWBA 2A07F 2WK4A 2E5GA 2M52A 1U5TC 1EQ0A 4PG8A 1R5GA 4HQMA 5JVTA 2HNYB 2V4QA 2LY2A 3CT9A 4IH5A 2DT7B 1X7VA 1ZARA 1PDNC 3R1LA 5J40A 1MMLA 2QKLB 4TY8B 5GMEA 3L00A 1Q4RA 2Z16A 1HHSA 1M5SA 1HBMB 3CCSS 5DCFA 4LG0A 3M3YJ 1N5QA 3OJUA 2EK6A 1B7FA 1IN7A 4I69A 2ZBIA 3WQPA 1LNWA 1K83J 2JHEA 3GCXP 3CJTA 3EGWB 2F8MA 2DBBA 5KG1A 1YJWS 1YJ9I 3QWUA 2GLOA 1OY9A 4B09A 2CNLB 3E6BA 1JKHB 3HFVA 3IM9A 4JI7F 2DGVA 2CUFA 3Q8VA 2XMUA 5KK1A 1HNVB 1X4GA 3IBWA 3V7CA 1WC4A 4WXOA 1FMWA 2JRTA 4DU8A 3X2QH 4XLHA 1DHMA 3I53A 1P4AA 3HGGA 1F2GA 2KG1A 4I2PA 3W9HA 4W4MA 3ICLA 3KHRA 4L5JA 3TX0A 1ORKA 3PO2J 3A8KA 1RK8A 3CTAA 1YKWA 3BCBA 1K7AA 5KFDA 1D8JA 3LQVA 5L1IA 3CESA 3A0HC 4DLGA 1NO8A 2FQ4A 3PRDA 1N6QB 3TOQA 1N36F 1OCRH 1FMVA 4E7KA 2DGTA 3ETMA 1NSKL 1XN9A 1RWKB 1XCBA 1YQHA 4JV5F 4LFAF 1FFWB 2L3MA 4GYIA 3RAXA 2V50A 4E6KG 1MDMB 4HX7A 4YFNF 1CF7A 4PSWA 2X51A 2KIUA 2XO7A 2DFIA 2VE8A 1SMTA 2VOOA 4QJVA 4L72B 2AQ4A 2MQLA 3HVTA 2YBVA 3GTYX 1HWUA 1T8IA 1PCAA 1W0TA 4B9TA 3SZGA 3OFGA 1QAXA 4EBDA 3OXFA 2KKHA 3PUFA 1IM4A 4M95A 4FT8A 4I0BA 2DMNA 2H1YA 5H6QA 2RUGA 2M8DB 1MJ9A 5CD4A 4LF4J 1QAYA 2UUZA 1G3YA 4X4NA 1WVRA 4E7IA 3LA7A 2PFFB 2ZKTA 2HURA 4LF1A 4ATNA 1GDTA 3RB4A 4GVBA 2HBYB 2O8XA 4A47A 3OVAA 2BJ1A 2W01A 2VG6B 2WBMA 2CW0F 2HPMA 1AWCA 2XMTA 2C2MB 2BDPA 4C3KA 1RYRA 1R6YA 2CVIA 4ELVA 2CQNA 2GIZA 1T0TV 3D5SC 1OY6A 2EFNA 2HW3A 4PZVA 2BHZA 3EZUA 1NJWA 2EBEA 5KFFA 2RRAA 2A6MA 1AUDA 5GAHJ 3NCPA 4GO7X 2JA7J 3J7YU 1D1BA 4FVMA 2V9PA 3GYNA 4MHGA 3C46A 3DGPB 5EWGA 2NVTJ 4OZNA 1RT5B 2G2ZA 3Q9SA 3ZZUA 2AXLA 1S3JA 5KFMA 3U21A 3HM9A 2TRTA 2UZAA 1V3RA 2HAIA 2BYCA 1SD6A 2HHQA 4FE4A 3ERMA 4BJ6C 1Y11A 2YWWA 3QIPA 2Y3YA 2HGCA 4DR1J 2Q3PA 3GCWP 5GADI 3MMCA 1PKUA 2ZH6A 3HP6A 4CLSA 1AFIA 3TAMA 2FLLA 4WFYA 2HHXA 1YI2I 4ZCIA 2X7IA 1O3QA 4KJIA 4F3QA 3NEKA 2V6EA 4CLLA 1LV5A 4EI2A 2AQEA 5DS9A 2VPZB 1KZHA 2CJ9A 3SXYA 4DZDA 3BKUA 1I50J 2OP5A 4HHJA 3RUBL 4B3SF 4ZA1A 3EPGA 3FC9A 2F4OB 2YKAA 3S14J 5FKKA 2W84A 5GMKa 4QWEA 2VONA 3K5OA 3VGSA 2FU4A 1J75A 5JHFA 2CVEA 4FZVA 1TP4A 2F9DA 4X6AJ 2W9BB 2V9WA 1Y8QB 3Q8PB 5HLFA 2JTVA 4JI4F 3UQSA 2Z57B 4ICLB 3KP7A 2K86A 1T11A 2NXUA 3DOLB 5C2GA 3GFHA 2H65B 5DM7F 4DSLA 2QEXI 2ZNZA 4WFBQ 4KHMA 3I0RB 3U7JA 2V8HA 3ILJA 2HHTA 1NK6A 2VQEF 5ETRA 4UUTA 4II2A 4OYAA 3ZMVA 1RISA 1JLAA 4A46A 1ZAOA 1CQMA 1NRKA 1PYSB 3KPHA 5HLTA 1U2WA 4AIJA 4IHWA 3HO1A 3A2KA 2XSFA 3NCQA 2XKOA 5KFJA 3SDEA 2ERRA 1U2CA 1S1VB 2LXIA 2AYBA 4XDCA 1L3VA 3DP7A 4J19A 1RAIB 1LE8A 1N33F 3JRIA 4MKVA 2DFEA 3BGRB 3Q8QB 2XV4S 4ED0A 4CO2A 4DV7F 5BQTA 1S99A 1JLQB 2XF7A 5L38A 3D0HE 5GAEU 3CJ5A 2X6OA 2HIQA 3I71A 2DRAA 3RJPA 1FKPB 4BQAA 5KFLA 1QZYA 1MNDA 2JEJA 3LWMA 4OZ3A 1TVRB 2QC3A 1UP1A 2CWXA 4LIUA 1IM6A 1U47A 5D4PA 1WOOA 3QPTA 4USKA 4WTYA 4Q8EA 5LMUJ 3M8EA 2OPTA 5KVRA 1LKZA 5ICGA 4KHRA 5C25B 2CQPA 3PO4A 1XQIA 1LW2B 4HLXA 3F8FA 1F6TA 5HQ8A 4KGVB 4UY85 1X4HA 1YZ6A 3ZZZA 4OQJA 3DU5A 2XSDC 4ECYA 2XS7A 2LVWA 1IKXB 3BH7B 5LSOA 1IWGA 2XAJA 5DDPC 4N8NA 4C3HJ 2MY8A 2WSCC 3AG3H 4JUZA 3KLNA 5B0CA 2FJEB 2XAHA 2PDAA 3K57A 1PVEA 5ETMA 5KFHA 1NZ8A 2B6AA 5D15A 1S1TA 3GO5A 4LREA 5EGOB 3M2VA 2CA9A 1WSRA 1FTTA 3A03A 5BPIA 2ZJPQ 2V1NA 3P5BP 2XWYA 2IJLA 1GH8A 2EA4A 1BQXA 3D6HB 4HPQA 4R1HA 4F0HA 5JVGQ 3PYGA 4X65J 3AJ2A 1JNZB 1HBOB 5ETKA 3BYRA 1IR2A 3NRVA 1O0PA 4CICA 3CCEI 2JVGA 3IN5A 2VFSA 5D5XB 2EWNA 2OMOA 3W2VA 2J5AA 1U1MA 1SKSA 5GPAA 1NK3P 3WODF 4KISA 2MQ8A 4RW9B 5DDOC 4AIKA 3MD3A 4XRMA 4B17A 2R8IA 2E34A 1GMUA 4DL7A 2JRMA 4HZFA 2U2FA 3FBCA 2PE8A 2RRBA 4NASA 4XAKA 3G4SS 3OMYA 1R5HA 1B1BA 2LQ9A 2FMYA 1HLVA 1OS5A 2XCPA 4AFFA 1WH5A 4HNTA 3CJQB 1F43A 1RAGB 2J9DE 3QJLA 4PK4A 3D1HA 3RAMA 2DR5A 4BNCA 2B7BB 2DOEA 2KYZA 2OTJS 1YS7A 2KO1A 1JLFB 4FDFA 3AJDA 4BXUA 1TKZB 2CKWA 3K89A 2E44A 3ZCOA 3RTRA 1FYLA 4CDGA 3FUYA 1U1NA 1NSPA 1NEEA 3IM8A 1QGPA 5C44J 2LEAA 3JW4A 1RT6A 2XZWA 5EDNA 4NZ6A 3B73A 2QMUB 5KFXA 1VRTB 3NBPA 1UTAA 3MEEB 2L01A 1B72B 1IV8A 2HNZB 4ETZA 4BE1A 4I98B 5CLSA 1S1WA 1SC4B 2JEIA 1NKEA 2HWVA 4WX9A 2A6TA 4DV3J 1UW9A 4NE9C 1VQLI 3GYGA 2NNNA 1HQUB 2B4PA 4CCHA 4ENJA 3BQ2A 3W62A 4CHUA 1HF0A 2G1DA 1RR7A 4F36A 2OC6A 1RIOH 4BQNA 3CD6S 1UZHA 5KT2A 1YQAA 5F9LA 3OHBA 5CYQA 1M1KT 3K1PA 3JR9A 4NMXA 3OR2A 1X5OA 5C7PA 1J9IA 4PABA 4AE5A 5BJRA 3D28A 2XS5A 3HHLB 4JV1A 4XKCA 1FRKA 3R5AA 2ELJA 1VC0A 4U88A 2OQGA 3V81B 3KP6A 3OT9A 4ZDNA 2FJXA 3MWBA 2MY7A 3DLBA 4H4KC 4XNFA 1RKIA 1XDUA 3P9IA 2WSEC 2Y9YA 1RHUB 1ICEB 1WJEA 1SJRA 3BR6A 1CGPA 3LAPA 4Q5SF 2G2OA 1WF0A 3HCXA 4ECRA 4LJZF 2BE2B 2E19A 2XSJC 4JI8F 2FD2A 3PV8A 2DR7A 1VCTA 3COAC 1TMJA 3OUYA 4CLWA 4IDKA 3K4CA 3B54A 3LSHA 1E3OC 1VQ9I 3M8ZA 1KQSR 4LF7F 3R97A 2YWGA 1WNEA 1SVDA 2CPFA 1IN4A 3NQOA 1QE1A 2LBFB 3EZOA 4Q5VA 1G6NA 3I5BA 5F41A 2QQBA 3JB9k 1D0YA 5D5VB 3MM9A 3G8TA 1S72I 1W7WA 3HOVJ 4A0XA 5KT5A 4DR5J 3KLFB 2KJBA 3V7RA 2VE9A 1NH3A 1HNZJ 3F8NA 1NK0A 1VQSA 4LF9J 2D3O1 1SC7A 3OFFA 1MH3A 1RAEB 4ES2A 4PUOA 1FKOA 1FJLA 1WI9A 3J7ZT 3BREA 4DXLA 3HD1A 2V8PA 3MHYA 3QO9B 1G4DA 2WAQA 4WYWA 1S7EA 1ZLJA 3IAS2 2F3JA 1BN5A 3CJ3A 3FZ2A 4BWJA 4RA2A 1JJ4A 3NOCA 1SFOJ 5B0BA 3K7AJ 2UVVA 2MKJA 4P2FA 2XY7A 1Y1WJ 3JRHA 4UXNA 5F3TA 4I7FA 3UCGA 4IFVB 1D09B 4YQWA 4CLTA 4C0BA 2YX7A 2CDRB 2RDPA 4BEHB 2C22A 2PG4A 3SCKE 2XB5A 3JS9A 4L0ZB 5FKLA 2XM3A 3CCZA 3M1VB 4OAYA 3V2UC 2DO7A 1YRTA 3POTA 3EPIA 2XAGA 4F91B 3TZXA 4EGZA 1NSQA 3TP2A 4EEYA 1GV5A 1JIHA 1EHWA 1H98A 2LOOA 1N52B 2HDWA 4I4BA 4ZPVR 3K4NA 1S77D 3W63A 1NKBA 4NCGB 1N5TA 3QJPA 3D9BA 1W25A 2XB0X 2RQCA 5FLVA 4ECUA 1QBJA 5KT7A 5KAIC 3VAMA 2MGZB 1JUPA 5AXLA 1QRYA 2FUG2 5KG3A 3T9ZA 1OYEA 5I42B 1K78B 4JI4J 3ASNH 3W66A 3BTLA 1WJBA 3OIPA 3H8YA 4Q43A 4MIMA 4WKRA 1MN7A 2O8KA 3QRPA 3K8WA 3S32A 4XLAA 1MSEC 1S0OA 2ZH2A 1DTTB 1WH7A 3VQSA 5BYQA 3E3VA 3PQJA 4UVBA 2W7NA 2VQEJ 2BE9B 4OV1A 1Z91A 1I27A 3I31A 3DOKA 1NBEB 3B8HA 2VQCA 2FOWA 4IRIA 2DPDA 2GA2A 1O7LA 3LP0A 1MSWD 5M2PA 2BBYA 2GJIA 3H42A 3WX8A 3AA8A 4BWMA 2BE7D 4GXOA 1K6YA 3D1QA 2L0KA 3W60A 2L41A 2K9NA 1WI6A 1XEZA 2ZHBA 1TUGB 1BUXA 1KVKA 3MURP 4BQOA 2DYSH 3O6QA 1EKSA 1OYWA 4DV7J 3CTRA 3ENAA 1SKRA 3M2RB 3MTJA 1F4KA 4J9KA 3VF0B 4BCAA 2R92J 1G2HA 1PC5A 1VHFA 3QSIA 2DHXA 1Q5VA 1VBXA 5CXTA 2PJPA 4B8XA 1YHQS 4CTAA 5A2QU 5D3GB 1RKTA 4CRJA 1TWAJ 1V6HA 2Y0SD 4WFZA 3FGVA 1XSDA 3K2YA 5K14A 2LY9A 2HZCA 4RW6B 1TFYA 2HLUA 3W8PA 2GM4A 3GTMJ 1IKVB 2JLGA 1BIBA 3MM5B 4O0IA 3M4OJ 4J01A 3BN7A 4LF5F 4C3MA 4JV2A 3IWZA 3DM2B 4PYDA 4FF1A 4IRHA 2HRYA 3LSTA 1ETVA 4M5LA 3PO3J 3MZ8A 3HJVA 5HSPA 2GNKA 4DYQA 4Z2XA 3GILA 1IRXA 2OPQB 1ZQ3P 2IAJB 3ZQ7A 3JRBA 3IG1A 3HOWJ 3TOAA 1FD2A 4LT6A 2R7QA 2LEBA 2EI5A 1IBKJ 4N47A 2ZMEB 3PJRA 5F1RA 1T05A 4DZ6A 3JTOA 3OYHA 1XNRJ 3MECA 2NXCA 4FNHA 2Z4PA 3QMQA 4K4TA 3G82B 4KH1B 2OSQA 3DDNA 3CLQA 2C28A 1J5YA 4HNUA 2DITA 5L3DA 1FDDA 2MZSA 1ZM9A 1U48A 4HACA 5E79C 5J47A 4OFZA 3G8SA 2K4JA 4XONA 1PUFB 1P9YA 1N54B 3FBNB 3CIZA 4HI2A 1BBYA 3TEHB 2E5ZA 1VI7A 2IS2A 3BWGA 2M7AA 3MCZA 4P52A 1DTQB 2QSHX 2OFGX 3VALA 1WJ5A 5ICCA 3MPVA 1AU7A 2DJIA 5HS8A 1HNXF 3BKFA 3KK3B 3KIOA 1SMYF 4OYOA 5HK4A 5DYMA 3TWZA 1U5TA 1HA8A 1Y10A 1PG5B 3BBFA 5D8LB 5T7LA 2AJQA 2ZM6F 2KZVA 4IEJA 1UA1A 3UN2A 3KK1A 5IT9K 2F7VA 2LSOA 3U9GA 1LWFA 3MZYA 1FT9A 3P4UB 4ZVOB 1K47A 1FWZA 4IO9F 3H40A 1KQGB 2ZBPA 4WWSA 4YRVA 4WK8F 2C3MA 3WTVC 4KTQA 5EN1A 1FTRA 3R2DJ 2GMJA 4DQPA 4RM2A 1U1KA 5FROA 2DT6A 3BR5A 1TL8A 1JX4A 1HDDC 2L9NA 3A01B 4OIOF 3KG1A 2QKMB 3BSOA 1YRNA 2Y8WA 5E3PA 2G9WA 4RGUA 4PYAA 3EE3A 4BHCA 2DNPA 4B43A 3N5FA 3QT6A 1S9EB 1AZSA 4QYZJ 4XRSG 3J80Y 2KHDA 1BOAA 4ECXA 4OU0A 2FZKB 1RZ4A 3WE3A 1RADB 3FM5A 1M5PC 4K0KF 4DIQA 1X19A 1RI7A 1SJ1A 2VXZA 3EDRB 4WK1A 2F5CA 3BG5A 1U8WA 4KT0C 4V2GA 1NMEB 3Q8YA 1RYSA 2GGPA 3QGIA 2QGFB 1JT0A 1X0PA 1YWXA 2XGEA 1E6YB 2YVSA 1IN6A 4KFCA 2C3UA 4U7CA 1E3PA 2K9MA 2V2QA 3DRSB 3W8GA 5IQQA 5C3EJ 1H9TA 4EU0A 3W9JA 4OX9J 3DLEA 1D0ZA 1AKHB 3BSCA 4A0ZA 2ZOGA 3R5BA 4ZVTB 4TQRA 5F04A 2HPIA 3UWTA 5K8NA 3O3KA 4CLFA 2YS9A 2FB0A 3KEOA 4IO1A 2UXCF 4UF4A 2HPUA 3BGOP 2HXIA 2VC1A 3HPHA 3LW5C 5BR8F 3WTUC 4TLRA 3TZYA 3QT8A 4QU6A 1HI0P 3U1DA 3ZQQA 4JI8J 2Z30B 3PCOB 2KP6A 3T5JA 2ZH7A 1S97A 4Q44A 2R7DA 1LDDA 1U78A 2KN4A 2AEJA 1EP4B 5K7ZA 3CJ2A 2NPIA 1IBMF 1J27A 1XTZA 4ECZA 2JPCA 5JVHQ 3MAHA 3DC2A 4CP5A 2P6SA 2BOLA 2ZXIA 2R7UA 5D4NA 3GP9A 1HLWA 3R5GA 2HOSA 3TRGA 5J2PB 3SI8A 4E98A 5H1SV 2JVRA 3BR3A 2V4JC 4B1RA 2LP4A 4B3TF 4NB5A 1HARA 2PLYA 2DIUA 4LFUA 2XY6A 3RYRA 3C1DA 2EC2A 2YNFA 5D0GA 2C3YA 1POGA 3F8MA 1RETA 3DLJA 1R1TA 2EFOA 3JRAA 4RB1A 2ZSHB 2WADA 3SQOP 2BW3A 5EG0A 1JUSA 3Q0UA 1FPQA 1U3EM 4OZ2A 2PMWA 2ZZTA 4XLNF 3C14A 3UKGA 2CPYA 4I02A 2LK2A 2D9PA 2WHOA 1XR5A 4GYGA 2JA6J 2WB4A 4BC9A 1YJ9S 4J9VA 5ITHA 2DFHA 4JI0F 2CG8A 4I2OA 4KIBA 4EJUA 5HVQC 4A8MP 1RXOB 1FKAF 1W7PA 2QUFA 4WTOB 2V69A 4HHUA 4JBCA 1VRUA 5J4YA 1SV5A 4OX8A 4QPQA 4DV2F 3D6MB 3MM7B 2R8GA 3WTYC 3OL9A 1Y0UA 3FEYB 2G13A 2YKMA 4C9YA 2ZITA 3TZZA 4X64F 3DKWA 2IJNA 4YB1P 1APSA 4CQ1A 1YZ7A 1N5VA 2MLKA 5J1UA 4PXEA 3WE2A 3EWGA 1LUJB 1ZYQA 4IG3B 2CNKB 3THTA 1BI3A 4LD5A 4E7JA 2MQQA 3L3CA 3MD1A 2M70A 5A2QZ 3E3XA 1N34F 1NK7A 4JB8B 1YIOA 3P3DA 2R7FA 1OCOH 4YR2A 3OYBA 4O3SA 1A31A 3I6PA 1HWLA 2BOPA 5IWAF 1HYSA 3IR7B 3N6MA 3GB0A 4P1WA 1WJAA 3K8VA 2GIFA 2FUG9 3H3VK 2BJDA 5KG6A 3US5A 5ETOA 1NHAA 5M2RA 3V4IB 1OIAA 2DMTA 1YE9A 3OSGA 3S3MA 2J76E 1IQZA 3BZKA 4W97A 2MEWA 2MGQA 1B9NA 1UWBB 2LRDA 1K0TA 3QATA 3I5AA 4WF9Q 2ZOFA 1ETYA 4DJBA 2IXSA 3TW6A 2W2NP 4HKQA 3VYSB 2EV5A 4A5MA 3NGKA 4J9UE 3DTKA 4B9NA 2YKOA 5F0UA 1RA6A 2ZC4A 4KR0B 4D1QA 4X4TA 3UDVA 2A5WA 3IHUA 3OR1C 3MKYB 3HRSA 1G7CB 2VKHA 3CJTB 4NLUA 4K7QA 3CJSA 1V5IB 1NU4A 5B08A 3V8LA 3CWJA 3OD2A 2B5JB 5D0EA 1BY9A 4MIBA 1IR0A 2O3FA 5HAOA 2LDYA 4ANEA 2IVYA 1OCZH 2HK3A 3E5XA 2HZTA 3QZ8A 2OCEA 2OTLS 2UUCF 2GS8A 3S1QJ 4J9RA 1NB7A 1VQOS 4DYCA 4QBUA 1C1BA 2G7UA 3T6JA 1HWJA 4Q0BA 4DJAA 4QIWN 3D2WA 2HFOA 3OIQA 3P9CA 1ONVA 5HODA 1WOSA 1TKDA 1P1LA 1S49A 4I2PB 2QA4S 1ZGJA 3CUQC 3FJ2A 1WC0A 1IN8A 4A8SA 1ETKA 2QFIA 1G8XA 1A5JA 2U1AA 1Y5IB 3OOPA 4OZJA 3R7SB 3CD5A 4CLYA 1FJEB 1QVUA 3OYLA 1QPIA 3FSIA 5FFZA 2FVQA 1FP1D 1T7PA 5B0DA 1S1UA 2PEHA 2GAGC 1XCVA 3BO4A 3HHHA 2L9RA 1VBKA 1YI2S 1Q82T 4ZVSB 4TQSA 3D0SA 1CF7B 1IUJA 3CCRI 4UTGA 4DF8A 2ZFWA 3LA2A 1EX8A 5DV5A 1LVAA 2BXYA 4JV0A 2GO9A 1K61A 4E2FB 2DA5A 3QGGA 2DGUA 1UMQA 3GFLA 3E6MA 1GXPA 1FDBA 4PRFA 3IO1A 2XDVA 1QAIA 4EJWA 4F50A 3PIOQ 1JHFA 4ZVGA 2BJ9A 2BQ3A 3A3NB 3CCJI 2W1BA 1MWZA 3RU0A 1MNEA 4MJKA 3SV4A 3UR0A 1XNQF 3GYXB 4KGMA 2HTJA 1HNXJ 1ZETA 1YK9A 1LXJA 5KFWA 2HVDA 3TI0A 5LLQA 3HHNB 2EV6A 4G1QA 4GVBB 1ZAWA 1FRXA 2PBIA 3FKBA 4L6V3 2GHPA 3OIOA 3S1MJ 4C2MA 4RX6A 2ZM6J 1A6LA 4F93B 2XC7A 4EBEA 2K27A 1UPMB 4Y2KA 4X4RA 3ENQA 3AAFA 3RGIA 2X3DA 2KG0A 3KLGA 4Y34A 2B56A 1SC3B 1IN0A 2BXZA 4J7CA 3ETOA 2R3SA 2Y1RI 1VQ5I 3OYGA 3E6DA 1YJTA 2VV5A 2FHJD 4JYAF 4Y33A 4IOCQ 4MIWA 2DD8S