2GQQA

Crystal structure of e. coli leucine-responsive regulatory protein (lrp)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
153
structure length
153
Chain Sequence
LDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFIQGYTALLNPHYLDASLLVFVEITLNRGAPDVFEQFNTAVQKLEEIQECHLVSGDFDYLLKTRVPDMSAYRKLLGETLLRLPGVNDTRTYVVMEEVKQSNRLVIKTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Escherichia coli Leucine-responsive Regulatory Protein Lrp Reveals a Novel Octameric Assembly.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Leucine-responsive regulatory protein
total genus 19
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gqqA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gqqA02
4U0VA 3SZTA 1OYYA 2EV6A 4YFNF 1SD6A 5ILSA 5DDGA 2EV0A 2QWWA 1I1GA 2A07F 1QGPA 2ELHA 2NAZA 4M74A 2P6SA 3LAPA 2UXNA 3R60A 4P55A 5H6RA 1YIOA 3BJOA 1KGSA 1FOKA 1UCRA 1E2XA 2IW5A 1ON1A 2ISZA 3HIFA 1XB4A 1J0RA 2EFPA 1SFUA 2H09A 3ECHA 1ZGJA 3QAHA 2D2WA 2M45A 2ISYA 2WC2A 4EJUA 4L9NA 3GFMA 4EJTA 2J5PA 2JSXA 1MJ9A 2PMHA 1G3YA 3WTZA 4AVPA 1A04A 3KCCA 3HTUA 3BROA 4LB5A 4ZYEA 1W5SA 2OQGA 3L2CA 1QNTA 4WXCA 4EQQA 2P7VB 4UV8A 2AXLA 4UXNA 2W57A 2MLGA 3OOPA 4Y17A 2RC4A 1MZBA 3REOA 5LGNA 4M9ZA 5D4SA 2DO7A 4B8XA 3FMSA 1YTYA 1HKTA 3NRVA 3ZPLA 1XSXA 4AIKA 3T0YA 3QP5A 2HYGD 3WGHA 3T1BA 2A6EF 3QU3A 4P9UA 2XAGA 4NQWA 1U5TA 3R0JA 3P9CA 1F5TA 2HR3A 2DU9A 3R61A 3ZMUA 2FXAA 1XGNA 3LWFA 4OOIA 3MAJA 1OYIA 4M9XA 3ZN1A 3F8NA 2XVCA 3IC7A 2E1AA 2HTJA 4LLGF 4G8XA 2D45A 1FX7A 5JFRA 1EH8A 1AWCA 1QZZA 1OPCA 3ZMVA 3WTUC 2FOKA 4EV0A 2HFHA 3WE3A 1J75A 2FE3A 1P4AA 1GXQA 3JTGA 1IXSB 2CVIA 3TKYA 4I0BA 4G6DA 2XAFA 1XN7A 3I54A 4EM2A 1W4MA 4IXAA 4ZH4F 5FGMA 3RDIA 3F3XA 3KE2A 1LEBA 1R23A 1ZRDA 2A61A 4KICA 1PP8F 1S6LA 1XMKA 2PFBA 4L0ZB 1XGOA 4L9VA 2XKOA 4CDGA 1LQ1A 2DJWA 4YFXF 5LEKA 3KFWX 2QUFA 1QQIA 2RV8A 2ADUA 2O0YA 2D1HA 4BHPA 4IHTA 5L3FA 5DUKA 3FM5A 4Y13A 3M8FA 2V1UA 2DI3A 2FBKA 5DV5A 2IPQX 2DPDA 2NNNA 2LDUA 5CLSA 2IT0A 1D5VA 3NQOA 4Y15A 4G7HF 2W84A 5H20A 1WKMA 1JE8A 4HLYA 2LNBA 2R3SA 5TJJA 2FBIA 2RDPA 3LQRA 5D8KB 4UNOA 5BQTA 3GUDA 1CF7B 3IRQA 4U7DA 4WWCA 5DEQA 4TV7A 4A0XA 4BXUA 1UB9A 4WCGA 1TNSA 1IAWA 4XLPF 4BQAA 2VOOA 1J2XA 3CO6C 4XLNF 1P4WA 3GVAA 3F8BA 3EUHA 3GFLA 5AIPA 3RPUA 4ZZDA 1LJ9A 3VFZA 1ZHFA 2L54A 3RYPA 4M73A 1HW2A 1K78A 2YSRA 1IRFA 3BOQA 1NHAA 2OQRA 3MCZA 2EV5A 3DXJF 2A3SA 3H3UA 4I0AA 4KIFA 3JSPA 2LKPA 3V7RA 1SFXA 3GZ5A 1L3LA 2VONA 4WK8F 4MNUA 5AIQA 3EYIA 4U88A 1O3RA 2PN6A 3DEUA 5FLXZ 4F7ZA 1CGPA 3F6VA 2F5EA 2DQLA 1J7KA 2MA3A 2NS0A 2Z3YA 2PG4A 4N0BA 2BEOA 3F21A 3WG9A 4ZZLA 2BBYA 4RAYA 1YFHA 5D4RA 2MLKA 1G3SA 2KIUA 2EJRA 5JR3A 1ULYA 2Z99A 4KIGA 3DP7A 1QZYA 1SAXA 4LG0B 2VC0A 1Z9CA 2FQ3A 5H6QA 3GF2A 3U1DA 2KIMA 4I02A 1EH7A 3E3VA 1TQIA 1XGSA 3KP2A 3SZPA 5CYVA 5LGUA 6PAXA 4D0PA 1R36A 1MJBA 3CJNA 2M8EA 2PQ8A 2K7LA 3ML6A 2IA0A 3RKXA 3GO5A 1OMIA 4PGGA 3JSOA 2YX7A 2ETHA 1TQMA 4M9SA 1BIBA 2CW0F 1FWZA 5D8LB 1XMAA 2QQAA 1DPRA 2Z5UA 3MZHA 1V3FA 1P6RA 1WI9A 3F8CA 4CICA 1ZYRF 1FC3A 3C18A 1YYVA 1S29A 3VB2A 3F8FA 3ZMSA 2V1DA 4UHTA 2YX4A 3HYIA 2WWYA 4MQVA 1OR7A 5E8IA 2FNAA 5D5VB 4RB2C 1XD7A 1EH6A 3T8RA 1FZPB 3ZMDA 3KEQA 4EJVA 3WU1B 2Q0OA 1XDSA 4OIPF 3WU0A 4KMUX 1P4XA 3MWMA 4CGZA 4AIHA 1USTA 4HF1A 1YS6A 2COMA 3WTSC 1SMTA 2GXGA 4KT5C 4BH9A 3G73A 4RGXA 4M6YA 1HW1A 2K4BA 3C1DA 3L7WA 5LLQA 3KETA 2CG4A 4A5MA 3R0AA 4IVNA 4LMYA 3K1NA 4ON0A 1BM9A 5FO5A 1IXCA 4KUMA 2F5CA 2XROA 3L9FA 3I59B 3HRTA 1H9TA 3RJPA 1XDUA 3FX3A 4I01A 4LLLA 1U3EM 5FFZA 4ESJA 2W25A 2C6YA 1DUXC 4A0ZA 3Q9SA 1KYWA 2IP2A 3OV8A 1I1SA 3KP4A 2EK5A 2VBZA 1KU9A 2M1BA 3MQ0A 4Q4ZF 3BY6A 1GXPA 2VBXA 1MJAA 4K2EA 3KLOA 4ENJA 1TNTA 1J9IA 5J6XA 1FBSA 1LDKB 2FBHA 3F22A 2ZNZA 3KLNA 2EWNA 1K7AA 2EFNA 5ILVA 4EM1A 2OZUA 2R7DA 2IVMA 3ABUA 3N97A 1W5TA 4ENKA 4L9TA 2XASA 1UFMA 2STWA 1ODDA 3BWGA 3TQNA 5LHIA 4GO1A 2JPBA 2G9WA 3ERED 1Z05A 1Z6RA 4MQ9F 5IT3A 4LGWA 4O5VA 3HRSA 4HX7A 1XSDA 5HLHA 4G6QA 1MKMA 3V8JA 2Q2EA 2P8TA 1BOAA 2NYXA 2PJPA 1YG2A 5BMZA 3E6BA 2P5KA 3N4MA 4IRIA 3ZMTA 4R79A 5EEGA 3FF5A 2ZO4A 3IRRA 3QPTA 4KYWA 3HOTA 3ULQB 5FFXA 1REPC 3E6DA 3TO7A 2M5WA 3IWZA 5HS8A 3TOAA 4Q48A 4ZYDA 1SMYF 2O61A 2GWRA 5BS6A 3W6JB 1IN7A 3PQJA 3KP6A 4G7OF 1IUYA 3ISPA 4HZFA 2RVCA 2ZBKA 1LVAA 4EVIA 1AOYA 4LK0F 1FPQA 4EJOA 1ON2A 1KU3A 5E1ZB 5LRSA 3I4PA 5K5OA 3IHUA 3CUOA 1D8KA 2ZBCA 3GEZA 5J8CA 2JSCA 3KZYA 1T2KA 5K5QA 5L3BA 5LGTA 1YW8A 3TDUC 1SD4A 2F5FA 1WSUA 3HRUA 1YW7A 3P9KA 3TO9A 3HHGA 5F1RA 3IKTA 5CVJA 4RS8A 1YW9A 2EFQA 3EDPA 5E18F 2B0LA 3GW2A 3I64A 3CUQC 5AONA 4NHJA 2M30A 1YQAA 3S2WA 4DQ2A 3M9AA 3O3KA 4N9IA 4P9FA 2UZKA 4ENMA 1PUEE 1BIAA 1BBYA 2QQ9A 3FXRA 3DF8A 2VODA 2XUBA 4EMSA 2H6CA 3TOBA 2XAHA 4XBFA 3BP8A 2OU2A 1JHHA 2EFWA 1KYZA 2WTEA 2VN2A 1B1BA 3SHFA 3V8LA 3J81Z 5E17F 2STTA 5ICEA 2FF4A 2QQBA 3TGNA 2OAZA 2Y75A 2F5DA 4EJWA 2PBIA 4OMZA 3J80Z 3MFKA 1RNLA 3SQNA 3FXUA 4MTEA 5BOXA 3CDHA 4L9JA 4BNCA 1O57A 3LFKA 1U5TC 5D5XB 2RN7A 1LNWA 3J81K 5DD8A 2M87A 3MZYA 4I98B 4A0YA 4G94A 2Z33A 1MDMA 3K1MA 1FSEA 4UVBA 1XGMA 2XAQA 2ESHA 5CVRA 1PDNC 1B59A 4FT8A 4BHBA 1YO5C 2IRFG 3D0SA 3GWZA 2E7WA 3E5UA 5HLIA 5L3DA 2RNJA 4N9HA 5D5WB 3F23A 3LA3A 1FBQA 1SFEA 2JTVA 3R6SA 2X0LA 3RTRA 5LBQA 2YU3A 5HDKA 3JAMZ 1IN4A 2P5VA 4EGYA 3LQQA 4YIFA 4HW0A 4KN4X 2E1NA 4NB5A 1TTYA 1Z6TA 2KRFA 1FP1D 1FYMA 1S8NA 4KDPA 1Y0UA 3BDDA 1BI1A 4MHGA 3FM3A 2CQKA 5F6FA 1U8RA 3W6KB 1ZRCA 3BJAA 3KP5A 3B73A 4OIOF 5L3EA 2XHKA 5E8GA 3V7SA 4R1HA 4GYGA 4RAZA 2QBYB 3CLOA 2EA4A 2DK8A 2VT2A 1WRJA 2QM3A 2YPRA 3AAFA 1G3WA 2DK5A 4MEYF 2H6BA 2O8XA 3PFIA 3E97A 5HS7A 2P5LC 4JBAA 5A2QZ 3WTXC 3QP6A 1IF1A 5HVQC 4OIQF 4P5OA 3KP3A 1T39A 2ZNYA 4AD9A 5HDNA 2LSOA 3HUGA 1J5YA 2DLLA 1L0OC 1CF7A 1I5ZA 1RIOH 1HXDA 4P96A 4KA4A 1R1UA 3DPLC 3K69A 2V79A 1ZG3A 4PDKA 2EA2A 1BC7C 1HKSA 2O03A 1ZARA 3GLXA 4XRFA 4DNCA 2L02A 1YS7A 3FZVA 1U2WA 1TW3A 4HF0A 5JVTA 2E1CA 1ZLJA 1P92A 1O7FA 3TDZC 2W85A 4U0YA 4PCQA 3GX4X 3K9TA 3KP7A 4LK1F 2KJCA 3C3WA 5CVIA 3J7AO 1G3TA 1K6OA 4O3MA 4A2UA 1TBXA 2GIVA 4H0EA 3E6CC 5FD6A 1E17A 3BPXA 1O7LA 3HOSA 4WXHA 4CXFA 5ICCA 1R5HA 2L01A 1HKQA 1S7AA 3DFGA 4FX0A 4CYDA 3DV8A 4WXDA 3LA7A 2K27A 1RI7A 2CWEA 2R7FA 5D6FA 1O3TA 1R7JA 1XCBA 2G7UA 4G7ZF 1F1ZA 2QBYA 2CFXA 4QLCU 4ASNA 4RGSA 2QLZA 3CUQB 2Y48A 2V9VA 4CO8A 4S05A 4BAYA 4A6DA 1X3UA 1D8JA 2HYFA 1T0FA 5CJ9A 4HAMA 1LDDA 2JT1A 2IJLA 2H27A 4XSZF 2HKOA 4Z2YA 3U9GA 3HSEA 1U78A 4HX8A 1FT9A 5IT9K 2JPCA 3ABTA 2WV0A 1TW2A 3V4GA 2A69F 1R5GA 2EB7A 4RGRA 5J8FA 1B9MA 2BV6A 4IHSA 2Z4PA 1R58A 5CVUA 3LAJA 2A5YB 2L4MA 3DPTA 2HOEA 1G6NA 4AWXB 2ESNA 3HSRA 3ROUA 4HOBA 1ZH5A 3QU6A 1K78B 3I58A 5F64A 3IKVA 4RB1A 3F72A 4HYEA 3B02A 1O3SA 4HV5A 4I09A 3VOEA 1DPUA 3RI4A 2HQNA 2UXXA 4HQEA 4Q47A 1KU7A 1ZRFA 3VEPA 4UVAA 5JI6A 3T8TA 1UHMA 3RKWA 1KQ8A 3WE2A 2QVOA 1B9NA 3BJ6A 5DUIA 2L4AA 4CZZA 4I7HA 3I59A 2GQQA 5DCMA 1FYLA 3CTAA 1RUOA 2LF8A 2VE8A 3TO6A 2FRHA 5FB2A 2JRTA 3O6BB 1QPMA 3E5QA 3ZQ7A 3ECOA 4PZJA 5L3GA 4R8HA 2ZMEA 4FX4A 4HDUA 4KIBA 2DFIA 1RZ4A 3RIRA 1EV7A 2DAOA 2FMYA 2GA2A 3O2PE 2F2EA 3GFJA 4HF2A 1Z1DA 4RGUA 3RPQA 3E6MA 1D3YA 4HQMA 5ED4A 4ENNA 3GZ6A 4RB3C 4KNYA 4LFUA 1OKRA 3FWEA 4I2OA 2HKXA 3WGGA 1ZG1A 2UWMA 1B6AA 3M7GA 1QO0D 1S7OA 4GGGA 3K0LA 3MEXA 1LDJA 2LF7A 4PGHA 1DP7P 2Z9OA 2VC1A 2ZCWA 3RYRA 3GYHX 1H0MA 3JTHA 3IWFA 2NRAC 5DYMA 3F6OA 1FNNA 2VT3A 1QBJA 2P4WA 1SD7A 3KEOA 5E20A 5DCFA 3WGIA 3G3ZA 2XIGA 1T38A 2VOPA 2HZTA 2GAUA 4GXOA 4L5IA 1HBXG 2DQRA 1KQ0A 2HWVA 3FMRA 1O3QA 2KKOA 3LA2A 4GYIA 2HEOA 5E1XA 3E5XA 2K02A 5HS9A 3FMQA 2RGVA 1BI0A 1MD0A 3M1EA 4KFCA 4U0WA 3D5LA 4L5JA 4B09A 3EQLF 4LJZF 3RKYA 2ZKZA 3QRFF 2MBFA 3K2ZA 1Z7UA 3L00A 2PMUA 1USSA 3GXOA 5ICFA 1XCVA 1S3JA 2VXZA 3VODA 3KZZA 4G9YA 5KK1A 3ZMZA 4L18B 1ZN2A 2X4HA 4FHTA 5CVVA 5K5RA 2CO5A 4MEXF 2K4JA 2XAJA 4LB6B 4HA8A 4A5NA 1WWXA 3I5UA 2CSOA 1ZAOA 2MH9A 3H3ZA 2VBWA 4ZYGA 1TQPA 4UV9A 1BC8C 1ZGAA 2MD5A 4BYYA 2JZYA 4HLXA 5DCMB 5EEHA 3V7CA 2A68F 1ZG5A 2CGPA 1H9GA 1I27A 2P7CB 4YG2F 1BI2A 5FD5A 5TRDA 3BPVA 1V4RA 1B4AA 4OU0A 5IT9Z 2DT5A 3HSFA 3ELKA 3V8KA 2GA1A 1FY7A 3I0TA 3QOPA 2OBPA 4U7BA 1IN8A 4YIIA 1FBUA 2PLYA 1W7PB 1R1TA 2HGCA 2XV4S 1JGSA 5HDGA 4IRGA 2D1VA 1T98A 3CO7C 2DTRA 2ACJA 2QYOA 4OMYA 5ICGA 1OYWA 4LD5A 2QZ8A 4MGRA 2HTSA 5DD4A 1R22A 4WF2A 1FP2A 3WTTC 2ZXJA 5HOOA 1XSVA 2PI0A 4M71A 4LG0A 4A6EA 5E1WA 1J59A 4O6JA 2BYVE 1HW5A 4YFKF 4JK1X 2DW4A 1HQCA 3DQVC 4OINF 4AIJA 2HDCA 2GXBA 2J5OA 2NNYA 3Q9VA 3HRMA 4GCVA 1R1VA 1G4DA 3SFZA 4XSXF 3FHZA 1IW7F 2HQRA 1MDMB 4IJAA 3HTSB 2BE5F 2O6GE 3CUQA 1FSHA 3T5XA 2FEZA 3COAC 4ESBA 4ZYHA 1Z91A 2P6TA 5BPIA 3QPHA 3WTWC 3HHHA 3WTYC 4M6XA 1IZ1A 5ERIA 1BI3A 3I71A 1KA8A 4OIRF 4A12A 2FNPA 2FA5A 1PP7U 2KIFA 3P7NA 2ZFWA 2RQPA 3ZN0A 3Q5FA 5LEJA 3L09A 1I6XA 1LB2A 2OD5A 2XGXA 4KN7X 4EM0B 3PQKA 1IN6A 5FLXK 2FU4A 4JQFA 4EGZA 3ZP5A 1ONVA 2FSWA 3LSTA 2HS5A 2V6CA 4RB0A 3FXQA 3IL2A 1ZLKA 1BJAA 4ETSA 2BGCA 3P9IA 4KMFA 5HLGA 2G7HA 1MGTA 2DPUA 3I53A 5KVRA 3JAMK 5LHHA 5D6EA 2VE9A 1ZREA 2OZ6A 1SD5A 2IA1A 2E7XA 2O3FA 1IN5A 3BZ6A 2CYYA 1LEAA 4Q5SF 1IXRC 1RUNA 2MC3A 4S04A 2K86A 4HV6A 5A2QK 4IF4A 3GFIA 1HSTA 4HX4A 1WQ2A 4UUVA 1JHFA 4HBLA 1BN5A 2GZWA 4E70A 3WODF 5L3CA 2KJBA 3WTVC 2XRNA 3NEUA 3U2RA 3J80K 1Q1HA 1YLFA 4IPAA 1P2FA 1DDNA 2H94A 1C0WA 5BPDA 1KQ9A 2ZMEB 2L3DA 5LHGA 1VTNC 3EETA 4IRHA 1IRGA 1F9NA 5LRRA 2W24A 1U6GA 2AS5F 1HSJA 3R4KA 4UVCA 3EYYA 2Q8KA 1FLIA 2EFOA 3H92A 1U5TB 1F4KA 4ESFA 1KU2A 2PEXA 4HDVA 1STZA 4MTDA 2FMLA 2IA2A 3K1PA 1GHCA 2OA4A 1T6SA 3C7JA 4WX9A 4L0YB 5JHUA 2VBYA 2TDXA 2ZJ2A 4CHUA 2QENA 3F8MA 2A6HF 4QWQA 2V1XA 5ILUA 3SXYA 1UHWA 1FYKA 1TLHB 1JXSA 5K1YA 2XKPA 5D5UB 2YR2A 1W7PD 1R00A 3JW4A 1GVJA 1W7PA 1K79A 2MH2A 4M72A 4BHCA 2Y0MA 3M8EA 4LLNA 2RKHA 2DBBA 3DKWA
chains in the Genus database with same CATH superfamily
3UWTA 4QW8A 1F3FA 2YQ1A 1VFJA 3ILIA 5DDGA 5KFGA 4WXWA 2UXDF 1QGPA 1NSAA 1WELA 1NDPA 3WX4A 2P6SA 4JBCA 1FEXA 2IM3A 5HROA 3UD5A 2FLPA 2F5GA 1FTTA 3AT1B 2R8IA 2B5JA 4A8FA 3J7AY 4CM0A 3HIFA 2EFPA 2XWYA 5EG0A 2M45A 2OJ3A 3CDAA 4C30A 2AHOB 1REVA 3TW7A 2CPFA 3H4BA 4A4JA 5K8NA 5IPAA 4ECSA 3IAM2 2KRCA 2CPDA 2ZEJA 2CQNA 4I6AA 5CAAA 2BY0A 4AVPA 1A04A 2JFDA 5F08A 3BROA 1M1EB 1T9VA 1KVIA 1GUUA 3CCJI 1X0PA 3D0HE 3H2VE 4WXCA 1VJWA 4EQQA 4QWEA 1MH4A 1NJWA 2LMDA 2W57A 5ETSA 1JUPA 5AXKA 4LBIA 4KE5A 3RTVA 2NVXJ 4CCNA 3KNGA 1MZBA 3WDOA 2YNGA 5H9EJ 2POKA 1VBYA 1H38A 3FMSA 3LSGA 3SV4A 4K50A 4WYWA 3RBEA 1XSXA 3MM7A 3QP5A 1HARA 5B09A 2FQ4A 4URGA 3T1BA 1OQ6A 1FJCA 2JVRA 3BDPA 5BJRA 3KLEB 4IG0B 1A31A 1NPKA 4RW9A 3QGGA 3QU3A 1YRNB 2EIMH 2O8KA 4NQWA 2M7BA 3R0JA 4B1RA 4ID5B 3P9CA 3TUZC 1F5TA 2XYGB 2HR3A 3Q0VA 4ZLNA 2RAQA 4AYBD 4P2FA 4OHXA 2QA2A 1OY9A 4JI1F 1EQ0A 4A3GJ 2P81A 1JJ4A 5F8MA 2LY2A 4I4BA 4CCKA 3IC7A 1OO0B 3PW5A 4AM3A 4AQYJ 5DTDA 2D45A 4PUOB 2BJDA 1X4AA 3AA8A 3VQTA 5L1IA 2RMLA 4LF4F 2GV1A 4UB8C 2WRMA 3M2VA 4CDIA 1MNEA 3QRPA 2KVIA 2HFHA 1U1RA 2R7SA 4Q2MA 3P49B 2ZDOA 4U67Q 5KOWA 3OUYB 1NK6A 1X58A 2P2CB 2FE3A 2BX6A 4C11B 4DR5F 3EPGA 4LRFA 1P4AA 4DBQA 2VD3A 3CJ8A 1UWBB 2G1HA 4LBHA 2CVIA 3VR1A 4I0BA 1HNZJ 2XAFA 4EM2A 4IXAA 1DTQB 3F3XA 2A61A 2B4PA 2EKYA 2ME0A 2ZE2A 1DTTA 1XMKA 4YB7A 1R0AB 3H9GA 1D1BA 2B56A 2PFBA 1NK8A 4CO4A 2UV8A 4QWBA 5LEKA 2PE8A 4C7QA 3L2RA 1HWUA 2WAQD 4RM3A 2HVIA 3M30A 2H3EB 2HIQA 1RWUA 5ETKA 4B02A 5DUKA 3EGNA 2H65B 3M8FA 2OEMA 2V1UA 2LQ8A 2DI3A 2J6UA 5DV5A 4RMNA 3GSDA 2GC8A 1DQAA 2ZH3A 3RBXA 1GLNA 4Y15A 4K4YA 2YNFA 2NXNA 3VAJA 5H20A 1Q4RA 1RHRB 1VGYA 1JE8A 1ETKA 3O1LA 3D0GE 1V5IB 2R3SA 2Y9ZA 2DNOA 4ZPVR 2GM4A 4RNOA 2Z30B 5TJJA 1XTZA 3V4IB 2FBIA 2OPTA 3LQRA 5D8KB 5EDNA 1X4GA 3H0DA 4IDKB 3GUDA 4WP8A 2KFDA 1WC3A 1ZPVA 2K1RA 2PEHA 4U7DA 4H4OB 5KFCA 5KFEA 4LIWA 4Y00A 3KWMA 5IWAJ 5F8LA 1B7YB 5E3NA 1Q8LA 4O3PA 1H2VZ 1GMVA 2UXCF 2VOOA 1ZOTA 2JA6J 1P4WA 1WDDA 3F8BA 3M07A 2OF7A 1ZHFA 3RYPA 2L54A 3VFZA 2LP4A 1C1CB 4WFZA 1U8WA 2M3DA 1KHWA 5LL6d 1Q81T 4WFXA 2MSYA 3BN7A 2YSRA 3I56S 5F04A 2ZVIA 1NHAA 3MCZA 3DLJA 1IDZA 4KIFA 4WYLA 2AHQA 3FKIJ 2LKPA 4IFVB 1VQKI 3SI8A 1W1WE 3OXFA 5HMXA 2FLLA 2VONA 5J4YA 3OSNA 2WBRA 2BXJA 3EYIA 3CXCR 4U88A 5F9NA 3DEUA 2Y8YA 3KYLA 4EO6A 5FLVA 1JXVA 2F5EA 1FERA 2HS3A 3GZNB 3SEOA 3EPIA 2ZZTA 3W8GA 4I2PB 2PG4A 2AX0A 5JLXA 4UT4A 2LBFB 2BEOA 2IGNA 2VJJA 3WG9A 3F21A 1VF9A 3S1MJ 1MBFA 4DQQA 3A8IA 1YRUA 2BBYA 2XTJP 1V5FA 1ETQA 5DLFA 2KPMA 1R6VA 3I6PA 2IA6A 4HH1A 5D4RA 3QNWB 4H54A 1TL8A 2EG1A 2CJJA 1RACB 3VVTA 1IKXB 3MM5B 1EETA 4KIGA 3GV5B 1WJ9A 1N25A 4GVBA 3Q0UA 5C25A 2L7MP 1SAXA 3FBEA 3VAGA 1TFYA 5ETNA 1X60A 5GPAA 2KIMA 2Y1LB 5GAHI 1WF2A 3E3VA 1TQIA 2VB6A 3LSKA 4ZN3A 3SZPA 1KKHA 4QTRA 2M8EA 4K4UA 1D1CA 3PTWA 2K7LA 1Q78A 2DHGA 5M5WJ 2IA0A 1RT6A 4XKWA 3VWSA 1HW9A 3DHWC 3GTPJ 1MSFC 5M5YJ 3BF4A 3AHPA 2QE5A 4PGGA 4F4XA 2ZXIA 4IHYA 3J7YI 4TQSA 4LMZA 2KH9A 2VL8A 1FNMA 3KNAA 2VFSA 4OYBA 1KR4A 3BR3A 1XMAA 2QQAA 5A8KB 1DPRA 4LREA 1V3FA 1K4SA 1WUUA 1W36C 1RT2A 1Q1KA 3F8FA 4Y52J 1TAQA 1DLOA 3HYIA 1S9GA 4MMOA 4MQVA 3V42A 5E8IA 5B0DA 3P4UB 3J81j 1OIAA 5D5VB 5DLGA 4RB2C 3QIDA 3TEGA 3L2VA 2B8PA 3T8RA 2CZVC 1RTJB 3KEQA 4EJVA 3WU1B 2Q0OA 2GAHC 1XDSA 2X51A 2QYGA 1N5QA 1J5EF 3NMAA 1DARA 1ROFA 4U7UK 2XULA 3NAHA 1RU2A 2A2CA 3MWMA 4XLCA 2QSHX 2DIUA 1NG6A 1REVB 4N8NA 4DJBA 1USTA 3TVKA 3GV8B 2XG8A 3WTSC 3GTKJ 1SMTA 2GXGA 3QYFA 2O66A 3OYHA 2AIRB 3PHEA 2CRGA 3PJRA 4M6YA 4F7VA 3BZKA 2K4BA 5EN1A 4YHHJ 2R5YA 4ES3A 1L3VA 3KZIC 4HEA9 4IDKA 1NKEA 4CH0S 2DRAA 2EW9A 4IVNA 3MEEB 4LMYA 2KMUA 2MKJA 4LRCA 3QT5A 1BM9A 3P96A 5FO5A 1IXCA 4KUMA 2IJRA 3DHXA 3HRTA 1WKKA 1XDUA 3E01B 2ZFUA 2AEFA 3FX3A 3R97A 1F5AA 1U3EM 2ZSHB 2BANB 3NGKA 2W25A 1W7WA 3PR5B 2YQ0A 3BLYA 2DD8S 3AXKA 2M0CA 3OV8A 3GTMJ 1SL1A 1I1SA 1CJKA 4LF2A 4OHYA 1D9DA 1X1BA 1DU6A 2M1BA 3MQ0A 2XZWA 2VBXA 3MD2A 1R49A 2R8GA 4UOHA 4R5PA 3OTDA 5J6XA 1FBSA 1LDKB 2ZNZA 1SJ1A 1HBMB 3DRXA 3W2WB 3PYFA 3H9QA 2F8HA 1B99A 1VLOA 1QVGR 4C3KA 2JVOA 4GO1A 3MXHP 4MQ9F 1EX8A 1R6YA 4MFBA 3ZGKA 2HBZB 1RXOB 4CA0A 2J9CA 1A7GE 2WB4A 3IAS2 4FZVA 3V8JA 2Q2EA 2P8TA 4Y4RA 3FBNB 1N34J 2VG6B 2J0QD 4O3QA 2PO4A 3E6BA 3M7VA 2P5KA 2KFZA 5GVQA 2VJUA 3N4MA 3WHIA 3W2VB 5EX0A 4RU2A 3W9IA 1WSVA 2ZWOA 2ZO4A 3IRRA 3WHBA 3ULQB 1JLBB 1FKOB 3MR2A 3AQOA 2UVWA 9ANTA 2B4VA 3PW4A 4EBDA 2VL1A 2M5WA 3IR6B 3UCGA 3BH6B 4Q48A 1SVLA 5HNFA 2FJAB 1ZK8A 4DLGA 4DJAA 3L2QA 5BS6A 2UXCJ 4YEAA 1IN7A 4PXBA 3PQJA 4G7OF 4GC7A 3ISPA 4M5HA 2ZH1A 2RVCA 2ZBKA 1AZSA 3JTOA 3K5PA 2VFUA 1LK5A 4PJLA 1LVAA 3BGOP 1AOYA 4LK0F 3FZBA 3NL0A 3TARA 1VK8A 3ZZ0A 2ZH7A 3KJFB 4KB7A 4X84A 1ZAWA 4IO1A 3QFHA 4EFAC 4DF8A 1RABB 3N01A 3GEZA 1U1NA 3ENWA 2K85A 1OJLA 4BCAA 2UUAJ 1VQOI 3G82A 1HNWJ 5C24B 2ZUAA 3NLCA 3RZDJ 5LJ3Y 2YS9A 3A03A 1T02A 5GAGI 3CF5Q 2V4JC 3OR1A 3G8SA 5HQMA 1WI6A 2IBOA 1WSUA 1RAGB 1ZAXA 3S7RA 5J2QA 2KXHA 2IGOA 3S15J 4NRUA 1RCXB 2ZZMA 4EEFG 2QRRA 4PWDA 1D9FA 1SBRA 4ZTFA 2DGOA 5L38A 4JI6J 1HNIB 3IO1A 3MPDA 2KM8B 2B0LA 2BE9B 3TW6A 3O8GA 4NHJA 4OJGA 3SDBA 1NSPA 2M30A 3A13A 1YQAA 5E79C 1JI8A 1Z2ZA 5ETPA 1ENHA 4M5LA 1QD1A 1HOMA 2Z2LA 2QL5B 4L72B 3DNCA 3CJRB 2XMVA 4II3A 1LWXA 3FXRA 2QQ9A 4FE7A 2XUBA 1A6LA 4IHXA 2J5AA 3HBLA 3CJ5A 3GG0A 1B0VA 2H48B 1NTCA 5FLXY 2CQ7A 3BEGB 2WTEA 3UI3A 1SCJB 3J81Z 4OYAA 2HPUA 2NPFA 4DR6F 2CQGA 3EUKL 3LPEA 1HDPA 2FF4A 2IGMA 3KKFA 3TGNA 3S2HJ 2Y75A 5A0YA 4EJWA 4M5MA 3PX6A 3J80Z 1X4CA 3SQNA 2E35A 1BR1A 2HBQB 1UZHA 1RA6A 3TEDA 2BM0A 1HHTP 4AXJA 4NZ7A 2XB0X 1NHUA 1IR1A 1U5TC 4N56A 1Y5NB 2MQPA 3KXDA 1RZMA 2AJ1A 3HHLD 1T05B 3LGNA 2RN7A 4HRIA 4DG1A 4XLFA 3MTKA 3ERMA 1C0TA 1SFKA 2IAIA 1Q16B 4G94A 2Z33A 4NC6A 3GR1A 2XMUA 4F4WA 2AQFA 1LWEB 1ULRA 4IOCQ 3ISNC 2ZOMA 3PRDA 4MYUA 5SUHA 2E29A 5KFRA 2CKWA 1C0UA 1YO5C 3MPWA 3D0SA 3GWZA 4IHVA 3E5UA 4NXNF 2JTVA 3OD2A 2X0LA 4QIWD 2Q6BA 2YU3A 3CW2C 4F04B 2QV6A 1ZPWX 4JV5J 1IN4A 2J7KA 2P5VA 2CDQA 4WCEQ 2R7UA 4RBVA 3DM2A 5KFTA 3HJVA 1WJCA 1G59A 5AXMA 2L9DA 2K3IA 2KRFA 5KFYA 2COBA 3AKZA 1WHVA 5D78A 1Q8IA 4KDPA 2HG4A 3L95X 2BVLA 4GDFA 3H40A 1BI1A 3V6DB 3PFYA 2GX8A 3OBIA 5BNGA 1QY7A 2K2PA 3EM1A 1J5OB 1HNZF 2CQKA 8ATCB 5TGTA 3R7SB 3GYNA 1ZRCA 3GZ7A 2RF2A 3B73A 3KP5A 4F92B 2CQIA 2KG1A 5AXNA 2M7AA 3GCXP 4BU2A 3QT8A 1C0TB 3OL6A 1TK0A 2FJXA 2NXUA 2BW3B 4DYRA 4BLGA 3VAIA 4X66J 3H4DA 4RAZA 4LF6J 2CUYA 3CLOA 3SDEB 2R2RA 4TKTA 2ZFHA 1WRJA 4ECVA 1YRNA 1HWJA 1T03A 2Y9HA 4NZ6A 1T9TA 2YPRA 3US5A 3MMBA 4LITA 3ZC4A 3IAM9 1G3WA 2H6BA 3E97A 3HK2A 5HS7A 2P5LC 5J2NB 4F4YA 3T1HJ 1N0VC 1T94A 3QP6A 2JVGA 1BE4A 4OIQF 2KT3A 2A3JA 5KTQA 2G13A 1EAYC 2B9WA 3Q8QB 4IUFA 2KZGA 4V1Ak 1SV5A 2FY8A 2DLLA 1L0OC 4MJKA 4C8OA 3Q83A 1HXDA 3TI0A 5DM7F 1CQMA 2HK2A 3MECB 5KFIA 5FKMA 3I96A 2Q1ZB 1U0SA 5D6GA 4IFYB 4I68A 3DTKA 3CIMA 2O03A 4XRFA 2L02A 1YS7A 3FZVA 1I6HJ 1GXLA 3MPVA 1GX5A 3M32A 2W48A 1Z4UA 3OYGA 4CQ1A 3BG5A 4HF0A 2QKMB 1S99A 1EKEA 2RHSB 1P8GA 1FI4A 3CCTA 2KL8A 3OL8A 2XNQA 3KHGA 4J01A 1GAOA 3M4OJ 4IH7A 2CJXB 4KHPF 3QT7A 4DR5J 4NNJA 2ADCA 3J7AO 3KTQA 3FIWA 3QT6A 5U47A 4DCPB 3MPUB 1K6OA 2PMZD 3ZQGA 1T7PA 2PX9A 1H7XA 4C2MA 3DOLA 1T8EA 2FVPA 2JEGA 1R27B 2JEJA 5KFSA 2XGCA 4H4KC 3P5BP 3K4KA 3BGUA 1YJNI 3HOSA 4LFCF 3CD6S 5ICCA 1FD2A 2Z0GA 3HKZD 5L1JA 1IWAA 4MTPA 5KG1A 3UW1A 3DFGA 2OTLS 3F0CA 4FX0A 2BJ8A 4KGMA 3U21A 3K59A 4HKQA 3JRGA 3HOXJ 3R5DA 2CWEA 3NGTA 1MN7A 3J7ZI 4YIRX 4HVZA 4NLYA 5AE2A 1R7JA 1RWPB 4LR7A 1UMJA 1BW5A 4C6AA 4G7ZF 1RT5A 1F1ZA 1H89C 4ZPWR 3G6ES 1LKXA 1RAJA 2CNLB 3A3NB 2QLZA 3JS9A 3RQIA 2R7XA 2HNZA 4PJMA 2R7OA 1S1VB 4D3HA 1ZQ3P 1CPZA 4K0KJ 1EETB 1X3UA 1YX3A 2VJ5A 3FDYA 1D8JA 4QIEA 1RPWA 1S0MA 2XSFA 4QQBA 3DFEA 2VA3A 2AT1B 3QATA 3QAEA 1YHQS 5C44J 1LDDA 3A3OB 4HNUA 5DM7Q 2ZH2A 2IJLA 5B66C 3JXOA 3EICA 2C2OB 3M2VB 3U9GA 2M8DB 1M90T 2WTFA 4PEOA 3O8HA 1TUWA 3NS5A 2IC3B 3BGRA 1ZS6A 5HP1A 4UOFA 2IS4A 4PUOA 5D3GB 3RJMB 2JPCA 3RYLA 3ABTA 2WV0A 3PY8A 4DN9A 1TW2A 2NSBA 1WKLA 3BREA 2EB7A 1S4FA 2XSJB 1B9MA 3SCLE 2Z4PA 1R58A 1HR0F 1I94F 1FWLA 2Z57B 3OSFA 4EEYA 4PRFA 2L4MA 2A2DA 4C2UA 1HWIA 4HT7A 3HSDA 3I4MJ 2UUAF 2EZHA 1Q95G 2VFRA 3K8VA 1RWNB 1PBAA 5IT9U 4PYDA 5J1RA 4RB1A 4HI2A 2LXIA 4DV7J 3C19A 4OLPA 3VOEA 1DPUA 1TWFJ 2NYIA 3JYTB 3DPUA 1QVUA 3OYJA 4Q47A 1RE1B 5F3ZA 1KD1T 4AXIA 3BSOA 4G65A 3ZR8X 2M4MA 1S9HA 2PC6A 4RW6B 5K8OA 3PW0A 1KTVA 3K17A 2HOAA 5KFDA 3BJ6A 2KT0A 5DUIA 2CPHA 4DOZA 3DOKA 2CUFA 3OPKA 3RUBL 4B3TJ 2HFOA 1UCNA 3PACA 4FXWA 2LF8A 2QSGX 3PIOQ 2VE8A 5EWFA 3DMJB 1UW9A 3ABKH 3TO6A 4GRSA 1JKHA 5KFPA 1UW4A 4DW6A 1OCZH 5L3GA 1NH8A 3FK4A 2ZMEA 2LXUA 2AD9A 2DKOB 4HPQA 3HOVJ 3RIRA 1RA7A 2EIJH 5HROB 2CQ2A 2YUSA 3O2PE 2DEIA 2CNNB 2F2EA 5F0WA 2NUHA 4HF2A 2VG7B 3MFIA 3ELHA 3D1HA 1ZKGA 4OQJA 1EJ9A 2AJFE 3E6MA 2HQFA 2O3DA 4RWWA 3IH3A 5ED4A 4K4WA 3GZ6A 3G1MA 2HIYA 4KNYA 1UEKA 2U1AA 1HQEB 4IRCA 3G87A 4I2OA 2HKXA 1ZG1A 3BR6A 1DLOB 2B7CB 3HXLA 2UWMA 2FQQB 3M7GA 4L75A 1R0AA 1QO0D 4HG2A 4J9NA 3IFEA 1LDJA 2LF7A 3CDEA 3CO9A 3HFVA 1TV6B 3CF5F 2JC0A 3ZFVA 1GH8A 1H0MA 5E3LA 2DYSH 2BHZA 2VUMJ 1N5YA 3HULA 4X4NA 3RAQA 1FNNA 1MMAA 2MQQA 1QBJA 1B7FA 1UVKA 5B0GA 2ZKTA 4Y3CA 1FJLA 3MMYB 5E20A 2M34A 5DCFA 2MZRA 2XQCA 1T38A 3BQ2A 1JJ8C 2G0JA 1XTAA 5HMWA 2E5HA 3F73A 1X5SA 1O8BA 1Z3YA 1DY3A 4FCYA 4CO5A 1Y7PA 1IG7A 1FJGF 2X1FA 3S3MA 2QLXA 2HWVA 2Y1JA 4LVOP 1IBKF 4JOMA 2KKOA 3LA2A 4GYIA 2HEOA 2QMUB 5E1XA 3HSZA 5LSRA 2Y9YA 5KHDA 2K02A 1TQLA 5HS9A 3FMQA 1JJ6C 3D28A 3BCAA 1A5JA 1AXQA 1WTBA 3Q22A 4DL0C 4KISA 4FASD 1S9EA 3CJQA 2RGVA 1BI0A 1MD0A 2VXDA 5HNHA 4QZVB 4KKOA 5AXLA 3MR3A 3K4BA 3D5LA 1H8AC 4L5JA 3EQLF 3GYGA 4IQXA 1QUVA 4ECYA 4X64F 2AX1A 3N5FA 5J4VA 1UEUA 1DTQA 3LAMA 3OWTA 4I6WA 2SXLA 5CHCB 4HL9A 2PMUA 1B64A 3DOMA 3GXOA 3CCRS 3K70D 3AB4B 3P3DA 3ADAC 2YNHA 1S3JA 3IUOA 4FE4A 4ZCKA 3BG9A 3S8PA 1SAUA 3TAPA 4ELVA 4F36A 2C28A 1RKJA 3PKYA 2XLIA 3TZYA 1RT7B 5FKOA 2B9SA 2OTJI 1TMJA 2AV5A 1V54H 5K5RA 1S6UA 3PJXA 1LXJA 1WG4A 3GV7B 2BM1A 3FCVA 3BR9A 4X1EA 1HHSA 4LB6B 4CCHA 4MH8A 4ITVA 4A5NA 1WWXA 4YB1P 5M3MJ 2UV1A 3RAMA 4ZYGA 3H5UA 2MD5A 4BYYA 2BRLA 1R3NA 3M8PB 2KDZA 4FNIA 1PYVA 2ZSIB 1NHKL 3W63A 1VQ4S 5J1UA 4NXMJ 1RYRA 2HXOA 2DFFA 2P7CB 3DEEA 3M8JA 4J9OA 2XYPB 2YWFA 5FD1A 1B4AA 1BR2A 1GDTA 3AB2B 3VAMA 2YPYA 2JVHA 1TL3B 3KLIB 4WU2A 4Y2CA 1QDUB 1NSQA 4WBFA 2ZHAA 1F1BB 1IN8A 1HD1A 2LD5A 4IKAA 3JB9k 3RB0A 2DNHA 2GIFA 2BOAA 1TKTB 5HDGA 2D1VA 1T98A 2ROPA 1UPPA 1YSJA 3H7HB 3GTLJ 1JUMA 1AU7A 4OMYA 1CBKA 4JI5J 2X3DA 4LFBF 3U27A 4DL3A 1X1AA 2QZ8A 4OI0A 1R22A 4BBRJ 2VPRA 2DYAA 2W4SA 2LLZA 3MMAA 5E3QA 3WTTC 4UUXA 1N52B 3GWCA 5HOOA 1F9EB 1XSVA 2OPPB 4DX8H 4QYZJ 4M71A 1TELA 5KT7A 4A6EA 4O6JA 2BYVE 3CCYA 4RLQA 4N4NB 1FESA 1PSDA 2F4VF 2B5JB 2PMZA 2IS6A 1O6XA 1PYOB 2QT7A 3Q23A 2VPLA 1U7LA 2NNYA 4H4MA 3K5LA 1WHWA 1JIHA 5DZ7A 5KFAA 3AL0C 1RTIB 1RWVB 4LVNP 5E33A 3MUVP 3SFZA 3NCPA 2QL9B 1JLAB 3I9V9 3FHZA 2IFXA 4M5IA 1LW0A 5CKTA 2HQRA 5KFUA 4UY8I 4RNMA 1Q7LB 1R6RA 4F26A 1M5VC 1RTIA 4WTOB 1FSHA 1PBUA 5CZXA 3T5XA 1SL2A 3ZRGA 3ZTRA 3PM1A 1P7JA 2PIIA 5DQIA 1X5TA 4Y0FA 3VCDA 3HZGA 2K9NA 1QTMA 3WTYC 4ECTA 3LSPA 3FBIB 2OPRB 3I71A 2ADBA 4Y34A 1WI8A 4FPRA 1VFCA 3ZZPA 2YH0A 3L4BC 2OPPA 2ZFWA 5LXYA 3PIOF 3ZN0A 2E2JJ 2LEPA 3PEJA 4NA3A 3F56A 2GNKA 3I0SB 1VQ8I 2WB1A 4KSEB 1WHXA 2YKMA 1HC8A 3VZIA 1IN0A 3Q8SB 4HACA 1QAXA 1RBLA 1F6TA 2PJRA 4NQWB 1PG5B 3TL4X 2GMHA 2MJNA 4Y65A 3OTCA 3T6JA 4NYZA 1E3HA 4EM0B 5E3PA 1IN6A 4Z7YA 2YBVA 3ILJA 2V0NA 1T9UA 4BJ6C 1OS5A 3RZOJ 2HS5A 4X0GA 4J9PA 1XERA 4RB0A 2AKWB 1TL3A 3TEHB 3FXQA 3IL2A 2NS1B 1BJAA 3MWBA 2DR7A 2I38A 3K5NA 4QSHA 3FEZA 3C15A 2DPUA 5KVRA 1KFDA 1MG7A 3CCQI 1IO2A 5D6EA 2LECA 2VE9A 4ECXA 1Y56A 3IBFB 2AGQA 3SFUA 1UG2A 2EINH 3M6UA 2HVZA 2MC3A 4S04A 1PGZA 4DYQA 4PKDB 2D74B 5K7FA 1RB0A 1JHFA 1FRJA 2BKPA 1XNRF 3BS9A 2CAJA 3WODF 4ERDA 1MSWD 1H98A 5J2QB 2J9EA 3KK2B 3LF0A 1UA1A 3J80K 3PO3J 4QR0A 1OSCA 5ETLA 4UUSB 2HS0A 1YLFA 1DDNA 2FVCA 4DSIA 1ZR4A 3D6FB 4NRTA 2O67A 2BJ3A 3QO9B 4EMDA 5F8NA 4PYAA 5FJ8J 3ZZUA 5EYRA 3A1YA 1C1CA 2XO6A 3CMAI 5LXRA 5LRRA 1N56A 2A5WA 1UFLA 2ELKA 5JHFA 1FRKA 1U1KA 3R4KA 2YNHB 4JV5F 2Q8KA 4PPZA 5IFMA 1NH3A 4ESFA 3E51A 1MMNA 2NYHA 5JXSA 1XR7A 5H2FC 2K3FA 1Q5VA 3PZPA 2AJ4A 3BPSP 4YFUA 4URQU 3C7JA 3T1YJ 2HXIA 4BGDA 4WX9A 4J9KA 3R5AA 3AJ2A 2VBYA 2BY3A 3M6WA 1KQGB 3G6XA 3TW0A 2QENA 2CPJA 2V1XA 2QX0A 1N75A 2Y69H 3SXYA 4RBOA 2YKOA 3IGVA 4FYDA 5D3GA 2DCLA 4LRDA 2LVWA 4IHWA 1BQMB 1ACMB 2BBEA 2DCEA 4QR1A 5DETA 3AJ1A 1X9WA 1XBWA 3CP2A 2OI2A 1FXDA 3S6EA 1GVJA 1N5VA 3NCRA 3R5GA 4OL8A 4LF5F 3HKWA 3JTNA 2MH2A 4M72A 2H54B 1NK4A 3JSMB 3GTOJ 1XJWB 4X4QA 4R0EA 2RD5C 2RU3A 4OYXA 3WBZA 1Y5IB 4U0VA 3SZTA 3Q89A 1OYYA 2VDHA 5K8MA 2EV6A 4OV1A 4IOAQ 2WAQA 1SD6A 2CJ9A 4A3IJ 2BE2A 2EV0A 2VIXA 2VPWB 2A07F 2VPYB 5F8HA 1X1CA 2MLYA 5KG6A 3LAPA 3QRRA 4N41A 3R60A 5H6RA 2JWNA 3W64A 3BJOA 1SJFA 1FOKA 5D0EA 1ON1A 4NLSA 2ISZA 1WF0A 2DR5A 2H09A 3ECHA 3QAHA 3MMAB 4RZRA 2ISYA 1Z7LA 4EJUA 3KK1A 1Z21A 3GFMA 5CPRB 1R31A 4EJTA 1RT4A 2JSXA 1MJ9A 3ASOH 5FLXU 3WTZA 4LF9J 3KCCA 3FKBA 2L5QA 1H0HB 3DRYA 1SB6A 1W5SA 3VAKA 4UB6C 1X9SA 3L2CA 3E01A 4N7TA 1HWLA 3HHDA 2P7VB 4UV8A 2V63A 3CCLS 4I6YA 2MLGA 3OFGA 4PG5A 3OOPA 4Y17A 4DFMA 2RC4A 5GADU 1RBOB 3ZOBA 5A8RA 4M9ZA 5GAEJ 2E1MC 2V67A 2OMLA 4PQUB 3OYBA 1HKTA 3TX0A 2IJFA 3OL3A 3NRVA 4PG4A 1TV6A 3T0YA 3PO5A 3H5AA 4U87A 2UUBJ 2HYGD 1RESA 3KMSA 2FHJD 4D9JA 4BQQA 3B6BA 2JX2A 2X7IA 3SDEA 2MGZA 4FVMA 5C42A 1K8AT 3D6TB 4C3MA 3SFGA 2KFYA 5G4DA 2YNGB 4DSJA 3RB6A 2HYIB 4B3AA 1AB8A 2R7QA 4OOIA 3B8HA 2XY7A 2HAIA 4M9XA 1AYEA 4FQGA 2XVCA 2CS3A 2B7EA 5FRMA 2E1AA 3N0VA 3D6MB 3QFWA 1FX7A 1QAJA 2RNEA 2W4PA 2XLJA 2QA4S 2LY1A 5J3LA 5E0OA 2QL7B 2VJIA 5JFRA 3UN3A 1EH8A 2R2SA 4PG7A 4LG3A 1QZZA 4WFYA 2KFNA 2NREA 2OEKA 3S3OA 5CD4H 4LBPA 3H0GJ 4OJHA 4C0BA 3G4SS 1RRJA 3BPDA 2MG4A 2OUMA 2PMZN 1GXQA 2ZH5A 2DCUB 5J1EB 3TBIA 5J2MA 2Y0SA 1XN7A 4ZH4F 4DPOA 5FGMA 4OYIA 1ZA2B 1AKHA 4TY8B 4NXMF 4KICA 3C2GA 1PP8F 3VTIA 5DDRC 5HMZA 2R9LA 4C9YA 3PW2A 4L9VA 2XKOA 1LQ1A 1E6YB 2DJWA 4YFXF 4MK8A 2ROGA 3KFWX 4PPDA 1QQIA 1T9YA 2W2QP 4KBIA 2GBYA 2MW8A 2O0YA 1ERDA 1U1LA 2UVVA 3DRRB 3KOAA 5L3FA 4Y13A 3DXBA 2A0FB 2IYGA 4DX7A 1YE9A 2FBKA 4XLEA 2GIRA 3ZTOA 2KN4A 3TMOA 2BXZA 2LDUA 1VOMA 3MF5A 2UUZA 2VPZB 3RU0A 3N6LA 3QZ7A 3I4HX 1KN6A 3AOBA 2N7CA 1HHQA 3OQ2A 2UXDJ 1KVKA 4HLYA 4E7IA 2EZIA 2OLWA 4X64J 1BQXA 3W2VA 4EO8A 1T11A 3SIPB 2LP0A 1NHVA 1LV5A 3NOCA 3C14B 4WWCA 4BDZA 2DODA 2EZKA 3PL8A 5DEQA 3AG1H 2DITA 3D3CJ 3GFZA 5I42A 3LSHA 1UB9A 3DOLB 2HFZA 1KEKA 4TYAA 1TNSA 3MCNA 2ZH9A 1IAWA 4P6QA 5J1NA 4BQAA 4NL5A 4ED4A 3OTOJ 4ZP8A 4NZ0A 5ETVA 2DGSA 2OPSB 4PAAA 5AIPA 3RPUA 4ZZDA 4XR6A 1LJ9A 3DXSX 2TRTA 2QTWA 4PJJA 4DUTA 3VGTA 1S1TA 2WVFA 1RQ0A 1S6QB 4HDHA 1IUJA 3TANA 4RLEA 3DXJF 2EV5A 4D7NA 1TUGB 4KO0A 3VF0B 4I0AA 4WP3A 4R0JA 5KAFC 5B5EC 2XS5A 4DV6J 3MAAA 3GZ5A 1L3LA 4FS2A 5B0FA 4J37A 4MNUA 4I76A 2X1CA 4P74A 2PN6A 1RSCA 4IFYA 3HP6A 2VUGA 3I5BA 1J7KA 2AQ4A 4ES2A 1MIJA 3CPWR 4IH5A 2P0WA 3W5XA 1KS2A 1HNXJ 4JUZA 2Z3YA 3OJSA 3FRZA 5KG3A 2AGOA 3H9JA 2RIJA 3G82B 2DEJA 4JI0F 4ZZLA 1NAQA 1QA6A 2ACYA 4RAYA 1VS3A 1YJ7A 4WK1A 3CCRI 1HW8A 2MLKA 5GAEU 2KHCA 1ULYA 3BR5A 2U2FA 2DOFA 2DMNA 2Z99A 1VC5A 3TJ8A 1H3DA 4QJVA 2OPQA 4CCLA 4LG0B 4DYCA 3O44A 5IC6B 1IUFA 4RR5A 3SCJE 4O3SA 1DQ8A 3FBCA 1ZM9A 4CLUA 1F9FA 2M4GA 3LMMA 3MKZA 5C4JJ 2WY7Q 4A48A 3G6YA 5LGUA 3A4TA 4NOHA 1R36A 3CJNA 2XY5A 1MWQA 2PQ8A 1BUXA 3S1RJ 3HL2A 3H25A 3HO1A 1MMGA 3RKXA 5G0RA 3UQSA 2KHMA 3KK3B 3M9OB 1BL0A 1OLTA 3JSOA 3DKYA 3FQLA 5EDWA 4A8MP 5D77A 2QFJA 5GTHC 1ETVA 3HHKA 1SH2A 2NUUG 5D8LB 2G4BA 3MZHA 5E3AA 2FZKB 1SC1B 2N4CA 1S29A 4QCLA 3VB2A 2ZWPA 3CD0A 2V4JB 3ZMSA 4GFBA 1RKWA 4ELTA 3X2QH 5HATA 4RW4B 2NLWA 1RAOA 3JQMA 3KJQB 4F0MA 4WJBA 3VQSA 4DUYF 3OVSA 3HOYJ 2BYCA 1JMTA 4JI4J 3D2WA 3R7BB 1GMUA 4CGZA 1RT1B 3HT0A 2AYGA 3DLGA 2COMA 5KG4A 1H6KX 4R5PB 1Q8BA 2VHGA 2V7FA 2HFNA 3LTOA 4USVA 2F65A 2XGPA 1AA1B 4F4AA 3R5JB 1HW1A 2UUCF 3TYTA 5LLQA 3SDGA 2GGPB 3AD7C 5KFNA 5B08A 3NNHA 4U8YA 3R0AA 3W7BA 2IAJB 3K1NA 2YXLA 3GQCA 1LFBA 2F5CA 3I59B 1FXRA 3MR7A 1S9FA 3HFKA 4LLLA 3Q0WA 5FFZA 2H5EA 4FVCA 1SUQA 2C6YA 2NXJA 4CO2A 1G6BA 3MZIA 3OHAA 1U24A 2JJ7A 3CT9A 4KH0B 4X4OA 3C2BA 3ZQLA 3NWTA 4C8KA 1KU9A 4V19J 3BY6A 4F91B 3IGNA 3LSJA 3UKGA 2GS8A 1NG7A 3M6XA 3LOCA 3CEDA 1TNTA 4CZCA 1YKWA 5CYMB 3M2UA 2EWNA 5ILVA 4EM1A 3KUGA 2WY8Q 1YG0A 3HJFA 4DEZA 1PVEA 1KQKA 2MKCA 3PUFA 2OZUA 2R7DA 3ABUA 1O5JA 4X62J 5H9FK 1ICEB 3EWGA 2XF7A 3QLHA 3ZNUA 1ODDA 2F63A 4HDGA 3TQNA 3OL9A 2E1OA 2HHHJ 3TUPA 3G96A 4Q0BA 5I3PA 1Z05A 1FRXA 3NBPA 4O5VA 4BKXA 1A36A 1Z3XA 3W8PA 1GT0C 4ZVHA 1MKMA 2WBMA 3G71S 2KXFA 1WCMJ 2AF6A 3MEEA 1YG2A 4WKYA 5BMZA 1VQPS 5F8JA 3F41A 4IRIA 4JI8F 3ZMTA 4R79A 4BY1J 4NI2B 4DV5J 3FF5A 1HBUB 1N36J 4ZKAA 4BC9A 1YZ6A 3T1YF 3BR1A 4XN3A 1REPC 1HLWA 4ZVSB 1YJNS 5FJ4A 1UHSA 1JLEB 3IWZA 1NM2A 5AJ3F 1BY9A 3TOAA 1K44A 2V34A 5BYSA 3RW6A 4ZYDA 1SMYF 2O61A 4ATNA 1U1MA 5IP6A 1YRTA 4ID8A 2PD1A 1S1TB 2YVSA 2DDBA 2LQ9A 5I4MA 1VISA 1HLVA 4EVIA 4OAYA 1FPQA 1JTXA 4EJOA 1B8IA 3PO2J 2WONA 4M5KA 1QZEA 2G2OA 4O4GB 3TZWA 2HVEA 1KU3A 5E1ZB 5LRSA 1ZM4A 2QKLB 5K5OA 4TQRA 3DLHA 4A46A 2W1BA 2G2ZA 3IHUA 3CUOA 1D8KA 1TKZA 3HM5A 3MGJA 2FHKA 3ZQHA 5A8KA 1IM4A 2MFZA 2GQ2A 3KZYA 1AFIA 2V8VA 3TQEA 2MSSA 1T2KA 3ABMH 2FHMA 5L3BA 1Y11A 1MMSA 1YW8A 4RW4A 2OJED 4XPCA 1D3WA 3G9CA 4OZLA 3KDOA 3HRUA 1YW7A 3GIJA 4MKAA 1SH3A 2IBKA 4P10A 2C2DA 2VG6A 3P9KA 1P7IA 1X2MA 4LRBA 4RS8A 1YW9A 4DBRA 1UL3A 2PFFB 4ZLJA 1NPPA 2LQJA 3EZ5A 4ECUA 2J0WA 2V2QA 3GPAA 3QGIA 2YNIA 2OD4A 1RR7A 3DDKA 4DI6A 3I5CA 3IMQJ 2A10A 3S2WA 5IM0A 4LT6A 2XEXA 1FFGB 4N9IA 3MEGA 4P9FA 2NVUB 4RX6A 3CUNA 2GJIA 2KLOA 2C42A 1PUEE 1N5SA 1BBYA 3PNTA 3BG6A 4EMSA 4ZP7A 1L3TA 4O3OA 1JHHA 1P1TA 5KFWA 2RNGA 1KYZA 3OY9A 4RW9B 3R6GB 2VN2A 1LW2B 2VKHA 3OJUA 2JFKA 2HZVA 1VIOA 2LBFA 4J7CA 3K6GA 2NOGA 2YQ3A 5ICEA 3BG7A 1T08B 3TOQA 1KLNA 2OAZA 2E1PA 2F5DA 1RP5A 4CNYA 4OMZA 5L1LA 2JQ7A 3MFKA 2MZJA 3NKYA 4QPXA 1RNLA 1RKIA 4FETA 2EG2A 4NA2A 1N88A 3FXUA 2HVRA 4TU9A 1WGXA 3BKUA 1QRYA 2VQFJ 1WKJA 4NMLA 4A8SA 2FVSA 3CDHA 3QO9A 1NLKL 2DNNA 4JI8J 4V19X 3CQZJ 5D5XB 3DYAB 4TN2A 4KFBB 3BQYA 4CO1A 1UVJA 5DD8A 2M87A 3JRIA 4B9LA 2D1CA 3D68A 1NSKL 1HA8A 2WAFA 3KK2A 1LEOA 1VQNI 1F9HA 4PXDA 3CCUS 2J0XA 1HBOA 4PABA 1XGMA 1EARA 2ESHA 1NK0A 1B59A 2CG8A 3E3XA 1A0OB 4FT8A 4B3RF 2IM0A 4HR2A 5D8HB 4ZPCA 2K9MA 3EX7B 2E7WA 2VJ4A 4PJ0C 3BTIA 4BBYA 3M8SA 5L3DA 4N9HA 3F23A 2WW4A 3U1LA 2CV2A 3OYEA 1WACA 1WH7A 1GMWD 1CJKB 2AZ1A 3EXCX 3GLJA 4KY3A 5HDKA 4ICLA 3L1PA 2JEIA 2DNQA 3FNNA 1HPZB 5LFAA 4HW0A 3OR2C 4KN4X 1UFWA 1VQYA 3GG1A 1K61A 2DNPA 5C24A 3CCQS 2L9SA 1Z2LA 2GXAA 1SV5B 3V4MA 5KOXA 1VC0A 4UUTA 3BM7A 3RRGA 3CB4A 1S8NA 2IVYA 2D3UA 3SEQA 5T7LA 5K7ZA 1RT4B 1U02A 3BDDA 3W2AA 2YKMB 1U0HB 2HWTA 3D3BJ 1FK9B 1WWHA 2R8KA 4OIOF 4NX9A 2M70A 5JVGQ 1QSSA 5L3EA 2EH3A 1S0NA 2XHKA 1HQ2A 6AT1B 1R71A 1DBDA 2EBGA 3V7SA 2BXYA 3JRCA 3QMQA 2FB0A 2YKAA 4R1HA 5FDLB 1ZTTA 1QVFR 2QBYB 3ILLA 2DHSA 1CJVB 3ZXWA 5JVHQ 1VQPI 3MEDA 3CNQP 2DK5A 2COLA 3PFIA 2AU0A 2L08A 2CQCA 1HQEA 3MM5A 3KPHA 1VK3A 1I94J 3WTXC 1KZHA 4OYOA 3TUIC 1F2GA 4NEZA 3PJWA 2BRKA 5HVQC 4P5OA 3KP3A 2ZNYA 2D7SA 4ZYAA 4ZC3A 1H72C 1RT2B 2XMMA 3SYTA 1TP7A 3C66A 4MIAA 1CF7A 4YUDA 1I5ZA 4G1QB 1TU0B 4DV7F 4XKVA 1PIEA 3OIQA 3MEDB 1N32J 1MBHA 4I2PA 3D1NI 2DRDA 1NB2A 4P96A 4L73A 2DA7A 2HZAA 1DHMA 3K69A 2IRUA 5GMDA 1RLDA 4BUPA 5HVFA 1HKSA 4Y7NJ 3GLXA 2ZC3A 4DNCA 4DFPA 5I3QA 1U6ZA 2IRYA 1TL7B 4QU6A 2DYRH 4NBQA 1N6QB 5K20B 1W26A 1F5CA 2CV1A 4IFVA 2K7KA 4A3KJ 1ZLJA 5HLTA 1P92A 2RSQA 4KH1B 3OFHA 1E6VA 4DUYJ 2WCXA 3OYMA 2Y8WA 3TDZC 2V9PA 1PJ6A 2D41A 4XNFA 4IG0A 5C4XJ 4B9UA 3KP7A 1LE8B 1ZYQA 1IVZA 1LWEA 2X1BA 1PUFA 2CQPA 3QJJA 2KJCA 4A3BJ 1YQHA 4XDCA 5CVIA 3IV5A 4K7QA 2V8HA 2NXEA 2WVDA 2B6AA 1X8DA 1JB0C 2DGVA 2Z1DA 1IKVB 1UZDA 1DQUA 1HPZA 3NGDA 2ATLA 4O3MA 2O9LA 2Y30A 4H0EA 4NCAA 1JLEA 2DT7B 2Z56B 3OL4A 1NB7A 4XIUA 1E17A 1RLCL 3KHRA 5LMUJ 2IMOA 4HACB 4WXHA 1HI1A 2BJ1A 1R5ID 3OYAA 3I0SA 3TA1A 2AYMA 5IC4B 1OCOH 4USMA 2E9TA 2N3LA 4WXDA 3MKLA 2FGOA 3UN2A 2VKRA 4YY3F 1RI7A 1SVDA 2R7FA 2XWXA 3KG1A 1FIPA 4U95A 3K4NA 2LXFA 3UVJB 1XCBA 2ZHOA 1XC9A 3CDUA 1UAWA 4QLCU 2GAGC 3D1QA 3G71I 4DSKA 2GO9A 1NBEB 5E41A 2Y48A 1V9OA 2HNDB 2QMWA 3PHTA 3BO2A 2BQRA 2NS8A 2Y3YA 2JLEA 3AQPA 3NARA 3D9BA 2YKNA 4KGXB 3MVPA 3DBLB 4XDDA 3IS9A 4ZCLA 1X4PA 4CLKA 3O5TB 4DR2F 3I32A 3T1AA 2XMAA 2LYVA 4HAMA 4BJTA 3C14A 2RE1A 4XSZF 3JRFA 2HKOA 4Z2YA 2LU2A 1RT5B 5DGBA 1JNZB 4C8ZA 4K4TA 1IJEB 2K3PA 1LNQA 4X4RA 2DTJA 4IO9Q 4LFCJ 3WX8A 5IT9K 3A8JA 3QQCD 1MU2A 1R5GA 3QYEA 4RGRA 3VZHA 5J8FA 3HSGA 1RDRA 3PUBA 4ZJQA 3LUYA 2MQOA 3T1HF 5CVUA 1X0FA 3LAJA 4Y6IA 4MYTA 1FWPA 2JUCA 1FWKA 3DPTA 2AQEA 4AWXB 2GGPA 3HSRA 1G2HA 1ZH5A 4DV2J 1XN9A 4MLOA 3X3UA 5BYQA 2ID6A 1MROB 3EMTA 3F72A 5LOQA 4DPUA 4HYEA 3PO4A 3B02A 3TP0A 4HV5A 4I09A 3DLGB 3T9NA 2HQCA 5K14B 4OZJA 5M5XJ 1S1XA 3W1YC 1Q86T 3KLGB 4HQEA 3EXYA 4IR1A 5THWA 1OQ3A 4UVAA 3LP0B 4B9VA 2GO8A 2XAUA 3KJNB 2CVEA 2NQPA 3WE2A 3IBCB 1OCPA 1YWXA 3NRBA 2E66A 1VRTB 4KRWA 1FIAA 3RG6A 3W61A 3NGRA 4CZZA 1YBUA 4I7HA 4Q44A 2BV3A 4CLTA 2XYHB 3DLKA 2GQQA 1FYLA 3IWLA 4L5EA 5DRKA 4EYHB 4DS5A 3UDLA 3C2PA 2FRHA 2DJNA 5FB2A 2J7UA 2VH7A 3ECOA 4PZJA 3PM9A 4HHUA 4ZK7M 4R8HA 3HOUJ 2VZ9A 4DL2A 1JKOC 4HSRA 4HDUA 1LPQA 2LDYA 3CVKA 3K4CA 1HBNB 2W2OP 4M3BA 2MZQA 1RZ4A 4NCGB 3KIOA 3HC7A 2WHOA 4NXNJ 3DLLQ 1SANA 2FIUA 4RKUC 1TP4A 2V50A 2CV0A 2Q6CA 2ZBRA 5EG0B 4DFKA 1GV5A 4PR6A 5DQGA 1CSJA 4L3KA 2PA8D 3DU6A 3CJKB 1ZR2A 3UFCX 1OKRA 4NLOA 3GIMA 1NUEA 3ENAA 3O3LA 4BDPA 1Y00A 1VQ9S 3GIKA 3HDDA 2L41A 3DCFA 2QCOA 1S12A 1S7OA 3H90A 3K2YA 1IBCB 4BBSJ 3K8WA 4PGHA 2Z9OA 3AODA 3MM7B 4PQUA 4YY3J 3RYRA 4WFNQ 5FKKA 1UFKA 2BW3A 3MMCB 2ECCA 1UAAA 5AJ3J 1GX6A 3TJAA 1Q7YT 4PSXA 1DAXA 2OAUA 2WK4A 2W4DA 3WQPA 3QSYB 2VT3A 3ICLA 1REGX 1GFWB 3PNIA 4JX5A 3CE8A 3KEOA 2A6TA 4XKCA 1R8AA 2NVQJ 4XIDA 2HBYB 1NJIT 5F8IA 3G3ZA 3UD3P 4LIRA 2XIGA 3ITHB 1BQNA 3LL7A 4D3GA 2DQRA 3RBDA 1MU2B 3I3LA 2B9YA 1KQ0A 4ZJOA 1HYSA 2M0MA 4ZPAA 2JH3A 1VQ7S 2V6AA 4Z7CA 2DA5A 3FMRA 1O3QA 4FYWB 1SJRA 2H4WB 2HQ3A 2VKVA 3M30B 4NPOA 2QGFB 2BY1A 1M5PC 2BZ2A 4OI1A 1BC6A 2PI5A 4N77A 1DTTB 4KFCA 3W5ZA 4HNVA 4B09A 1OY6A 4LJZF 3RKYA 2ZKZA 1U0JA 3GONA 2OPSA 3TZZA 3U02A 3VGUA 3QAUA 3V5RA 3DLEA 1Z7UA 3L00A 3I87A 3ENQA 3DDNA 4C3LA 3DLEB 2F40A 2HHHF 3VODA 3OUYA 1M5HA 1CC8A 1XG1A 1DQ9A 1IBMF 2PDAA 4A93J 1IKWB 1SJ3P 2QO3A 4IEJA 1NJYA 1F2HA 1DURA 1RWOB 5CVVA 2WOMB 3UVJA 3J81Y 1R8CA 2CO5A 3VV2B 3N5BA 2XAJA 1RU1A 3LSRA 1V55H 1MBGA 3DKXA 1WDTA 1SIWB 3CCUI 1ZAOA 2MH9A 1P6TA 2VBWA 5A2QU 4NI2A 4UV9A 1BC8C 1ZGAA 1FJGJ 4USWA 4KQZA 3PX4A 2EFGA 2OTJS 2I5UA 4HLXA 2FD2A 5EEHA 3V7CA 1X9MA 2CGPA 2JNJA 2MMYA 2MZSA 4CLWA 2M88A 5D4OA 3HKZA 3CCEI 3LSIA 1UMQA 4A47A 1APLC 2GLOA 2EVZA 2QSFA 1B72A 3BPVA 2EWHA 1NZAA 3UNGC 2RAEA 1G7CB 3HSFA 3HHLB 3ELKA 3V8KA 2XGQA 2CUJA 3DN9A 1FY7A 1IC8A 4ZCIA 1NK9A 1SC7A 5F0FA 1ETWA 4B9NA 2HGLA 1TR0A 1GNKA 1X1DA 2CNOB 1LE8A 1E3OC 3QGPA 3WG7H 4W4MA 2P9EA 3D6HB 4YP3A 4LF7F 2VIHA 4OX6A 2MQLA 1R1TA 1RHJB 3FHNA 4BWMA 3HVTB 2I10A 1Y1VJ 1GT8A 5JMNA 1ORKA 1TFWA 2C2MB 2DTRA 3L7OA 2OC6A 3B6CA 4I64A 5ICGA 4LD5A 4IO9F 2IDEA 2GJFA 3DEWA 2LMIA 4UZBA 2R8HA 2ZXJA 2YWWA 5A8WA 4LG0A 3GJSB 3HB9A 1J59A 1HW5A 4JK1X 2DW4A 3OIPA 3DQVC 3Q8VA 3GTGJ 2W9AA 4L6V3 2HDCA 2HRYA 2GXBA 2J5OA 4G12A 1B72B 3Q9VA 3VPRA 3CCES 1U26A 2LKXA 2C3MA 4GCVA 1R1VA 1SIZA 3JTPA 5A76A 1X2NA 3VALA 4YQWA 4JI5F 2XCAA 4Q2LA 4XSXF 2QEXS 3H20A 2IXSA 2B4OA 3H5RA 1MN9A 4MKVA 4X4TA 1SXLA 3MM9A 2FPHX 3ILOA 3HTSB 3DLBA 1CJTA 2GIZA 5AE1A 5HLFB 1ZM3A 3CUQA 2RB7A 3PSIA 1OR7C 4FF1A 5KFOA 3COAC 1IQTA 5B0BA 1WOOA 2WZ1A 2P6TA 5IQ6A 1S1XB 5BPIA 3QPHA 1Z1ZA 4AT1B 4NASA 3TZXA 4ZDNA 2R7TA 1IZ1A 5ERIA 2DTZA 4ZVEA 2HK3A 1BI3A 5A8RB 1YDLA 2FA5A 1PP7U 3PYGA 2LY9A 3P7NA 4B3SJ 1FEEA 1JLBA 2APOA 1VQ7I 2KB2A 3L09A 5L46A 2DA4A 1LFPA 3DGVA 1KFSA 1LB2A 4XOPA 2OD5A 5EGOA 1MMLA 1VQMI 1YJVA 4RL1A 4E7JA 5IOYA 1KSPA 3QOEA 1VQ8S 3CO0P 1HI0P 1D8ZA 3M1VA 4LSLA 3PQKA 4U9RA 2C3PA 3CCLI 1RAIB 2MQ8A 4MFBB 3VWBA 3ZP5A 3MM8A 4F2SA 2QYCA 3CMAS 4KGKA 3LSTA 5LT5A 4KHRA 4NMXA 4JI4F 1EP4A 1N5YB 1WZ2A 3ZZYA 4PFPA 3S3NA 3GJRB 4ETSA 1TMMA 1Y0HA 2E1MB 2HNZB 4DSEA 3IRXB 1O51A 1S76D 2G7HA 3I53A 1NKBA 3JAMK 3DGPB 4XONA 4OJ3A 2OZ6A 4IOAF 2NXCA 4NLGA 1S1WB 2O3FA 3J80Y 3BZ6A 3RAXA 1IXRC 1TT5B 3W3CA 5BXIA 4CT8A 4HV6A 4RAGA 5A2QK 4IF4A 3M8YA 2HNDA 4JX4A 2X1EA 2XI2A 2DXIA 4HBLA 5GAEI 2Z2SB 3QQAA 1T9XA 4B3MF 2B4UA 3WTVC 1IV8A 2RJZA 3U2RA 4LF8J 1LKZA 1LXNA 4ED2A 4W1UA 1L3SA 2XMTA 4B4CA 2V5HG 1KQ9A 2ZMEB 4CCJA 5DDPC 3K0JA 1SEUA 3ET6A 2YH1A 2XF6A 3EETA 4IRHA 1IRGA 1F9NA 4X4UA 1H73A 2W8KA 4TY8A 1D9AA 1SC6A 3BH7B 1XK8A 1JGGA 4UVCA 2W9BB 2X1DA 1F4KA 4M63A 2RU9A 1IRZA 1Q5YA 2KP6A 5IXUA 1STZA 2CQDA 3K4JA 2F4FA 4J9LA 1GHCA 2OA4A 4JB8B 3SCKE 2MLZA 4QPQA 2VPXB 1CQTA 4O3NA 2GFFA 2VQCA 2DR9A 4USKA 4L0YB 4IZZA 2TDXA 2ZJ2A 4DL5A 2HKEA 1SQFA 3BDEA 1RWMB 2V26A 2V9WA 3F8MA 3H3VK 4UY85 2H1YA 4LF4J 1KBRA 2A6HF 4QWQA 5ILUA 1UHWA 1FYKA 4XK8C 4ED6A 4LQ3A 3ZTPA 4LIVA 1YOVB 5T41A 4ECRA 1SKUB 2E71A 5D5UB 3IP0A 2O5DA 3R7NB 4YB5A 2YR2A 1GK8A 3L2UA 2BKOA 2JC1A 4KJIA 2M52A 1W7PD 1R00A 3M8QB 4DPWA 3CCJS 3ULHA 2NVTJ 3B4MA 1W7PA 4QR2A 1K79A 3TX8A 2W2NP 3TVZA 4BHCA 2KT5A 3ZQQA 1X5PA 4OZ5A 2Z2ZA 1FFSB 1FNOA 4DR1F 3QWPA 3J7YU 2DBBA 1S1UB 4DV3J 3DKWA 4NYPA 4YFNF 3ZZTA 1I1GA 1RTZA 2NAZA 4QIWN 2AW0A 2DIVA 3BV8A 3GB0A 3OMYA 4USUA 1YIOA 2DR6A 1KGSA 1XQIA 2GMJA 3WIUA 2DXFA 1N77A 5KFLA 2MYSA 4E7KA 1FRHA 1SKRA 2PT0A 4G3IA 1MROA 1SFUA 2Q43A 1K0VA 1ZGJA 2D2WA 3JRDA 2QSWA 2W01A 2DNMA 4GVBB 3H8YA 2B8QA 2WC2A 4L9NA 1AZSB 3E7LA 1T0FC 4IG3A 3EZOA 5EUHA 4MFDA 3KHHA 1YIJI 1X4DA 2PJRB 1G3YA 3GE9A 3BB5A 2R5ZB 2HHPA 1Y4ZB 4ZYEA 2WSEC 3MM6A 2MABA 3PJ9A 1QNTA 4ZLLA 4YR0A 4DQSA 1N8RT 1XMXA 4UXNA 4Y3OA 3NNAA 1VHFA 5IOZA 1DRZA 1W25A 1FOYA 4LOCA 2CQQA 4YDXA 4C0OC 2ZXHA 2DO7A 1MBKA 4G6TB 4I99C 1X31C 1YTYA 3D54A 1WC0A 4OHZA 3S32A 4AIKA 2Q66A 1SVOA 2EPFA 4MIMA 5J2PB 2A6EF 3PXGa 4P9UA 2XAGA 3OS1A 1U8BA 4N76A 1I39A 1K47A 3BYPA 1U5TA 1T95A 2RS2A 1QSYA 4KV8B 2DN0A 1HNXF 3ZMUA 1ZAVA 4F0KA 1Y5LB 4DL4A 2OCEA 1Q1VA 2GMLA 1N33F 3LWFA 3MAJA 1T3OA 1OYIA 3OHBA 2IGKA 2J0SD 2R7RA 4F25A 2MY8A 3ZN1A 4JI0J 3EJMA 4J5OA 4YHHF 2KL4A 2Y0SD 3DI6A 1L5UA 4G8XA 3EUNA 2M4KA 2RRNA 3MOJB 3EVMA 3EVOA 1HBOB 2BR0A 2W82A 1M5KC 1R43A 3Q2TC 1AWCA 5SZTA 3LP2B 3QRQA 2DOEA 1OPCA 3WTUC 3S14J 4EV0A 1QU3A 2XF5A 5KNLA 2DO4A 1D5YA 3LP1B 5D0GA 1J75A 1HQUA 2ASJA 3JAMY 3BTLA 4FBTA 1UJ5A 1IBLF 5IQQA 3PSFA 2I1RA 1IXSB 2JLGA 1X4OA 4UUWA 4KC5A 3W60A 1U2RA 3I54A 5HBMA 1FDBA 3RDIA 3BN4A 4DR1J 3KE2A 2XO7A 2EZLA 2YKPA 1LEBA 4CLFA 1IKVA 3SXLA 1QSLA 5I3UB 2IVFB 4JI3F 3BG3A 4I2QA 4CDGA 2HGMA 2ZITA 2QA1A 2QUFA 4QWCA 3H2UB 3MOZA 1D09B 1ELOA 1H74A 2GW8A 2ADUA 3AD9C 3S93A 2EBEA 1Q8KA 1R8BA 4WIIA 2D1HA 2KZVA 3QIPB 4F55A 1HDDC 3HDSA 2E5ZA 4OWRB 4ED5A 1LFUP 4P2XA 2RHQB 3C16B 3CJTB 2IPQX 4Q45A 2DPDA 2NNNA 3HVRA 5CLSA 2IT0A 4DCJB 1D5VA 4DUZF 3NQOA 5F3TA 4K5SA 3M8PA 4RNFA 1FMWA 2W84A 5JVGF 3PFEA 4NLUA 3QYBA 1PCAA 3LO3A 2DGQA 3V6KA 1XC5A 2LNBA 2L7FP 2KJWA 2HHQA 4RDUA 4E7HA 4UNOA 5BQTA 3ZQCA 1GEHA 1CF7B 1U6FA 2Z2MA 1H2TZ 2KDOA 4CSWA 4RW7A 3D5SC 4ALZA 2DJIA 3QSIA 1ITYA 3FZ2A 4FYXB 1AUSL 4E98A 1YBTA 1WTFA 2EC0A 1SJ4P 4A0XA 3H36A 2RQKA 2XPUA 5GAHJ 3RW7A 3SQGB 4J9VA 1JLGB 2ZOGA 1JLFA 4DPXA 5CQGA 4HI1A 3VHQA 3U1MA 2HNHA 1VBZA 2J9DE 4ZVRB 4M3EA 2AEMA 1J2XA 3OSGA 2CZ4A 2V2ZA 4PZVA 5EZGA 2K9LA 4DV0J 3J80U 4IQJA 3LFUA 2EBIA 4N4OB 4I56A 2HVDA 4M73A 1HW2A 2N7YA 1SJQA 2DA3A 1JJHA 1FVQA 1S10A 4P9SA 1K78A 1J27A 3HLUA 1UTAA 3D4JA 1HI8A 2MPUA 5IZHA 2JWTA 3BQZA 3QBCA 1ETYA 2A3SA 3H3UA 5EHHA 1TWHJ 5ADZA 3GYXB 2IMWP 3V7RA 2WOMA 1MW7A 2X3GA 4NLDA 1S0OA 1O3RA 2RUGA 3TUJC 5FLXZ 1FOWA 4ZMMA 1T8IA 3NY0A 3OTOF 1N32F 1J2VA 2DQLA 4DG1B 5CQEA 5E3OA 2AJ0A 2RKIB 2NS0A 3F44A 1VQ9I 1IRXA 4N0BA 3CZ6A 5HVGA 3U7JA 5KAKA 1D0XA 3S2DJ 3Q8UA 1XMOF 1TVRB 2OSQA 2VKZG 1YFHA 3K5MA 5JR3A 4F67A 4AYBA 5IV4A 1OCCH 1QZYA 4MK9A 1FX2A 2QC3A 1BR4A 4AIDA 2VC0A 2HHXA 5KT5A 1Z9CA 3GF2A 3U1DA 1KP6A 4I02A 1CS4B 2LOOA 2AO9A 2D3O1 2RDDA 1XGSA 5KCMA 4KYZA 3MI7X 3KP2A 4KT0C 5CYVA 4QIVA 3HZEA 1ZZFA 1BQNB 6PAXA 3KJVA 2CQBA 1MJBA 4DV4J 4GRIA 3ML6A 3Q3SA 3KG4A 4TLRA 3KG0A 3GO5A 1TL5A 4FXVA 4KJZA 1OMIA 1I51B 2YX7A 3W3SA 2AXTC 2QFIA 2ETHA 3IG1A 1BIBA 1LWFB 3BTJA 3BZQA 3VYTB 2IS2A 2CW0F 1FWZA 1WJAA 4JV2A 2Z5UA 1R8PA 3M2RB 3H5XA 3R8YA 1JKHB 1WI9A 4CICA 4X4SA 3IXQA 3C18A 1YX2A 3K4LA 3T5LA 1X4FA 4O23A 2E60A 3MD3A 4UHTA 1BHNA 1U49A 3NNCA 2GOXB 1BWEA 5KFKA 2FNAA 1XD7A 1EZZB 2XGDA 2M0GB 1EH6A 1RYSA 4ER8A 2W7NA 4A3LJ 3DTEA 5IV3A 2MKSA 2LLKA 5ETTA 5MLCV 3G86A 2N82B 3WU0A 4KMUX 4DU8A 1P4XA 2VDIA 3DCAA 4AFFA 4KGVB 1ITPA 3A01B 1D0YA 1IJWC 2JRSA 4C4WA 4AIHA 1YS6A 3A3PB 5F0UA 4JI7F 2ATCB 3DRRA 4ILRA 2D69A 2I5JB 3G73A 1CG2A 1RT7A 4RGXA 1P9QC 3K5OA 3FBFA 4CO0A 1JLAA 3L7WA 3KETA 3DU5A 4A5MA 4JYAF 3KLFB 2GCFA 3PW7A 2M3AA 4HH0A 2DPJA 1Y8QB 4TY9A 3DLKB 2FZGB 3L9FA 5J2MB 4C0HA 4M3DA 2FLNA 1X5OA 3OFFA 3DBRB 3BQ1A 3ESWB 4X62F 1KVJA 1KYWA 3FFIB 2DNGA 2IP2A 1S6OA 2EK5A 2VBZA 1S9EB 4Q4ZF 5K14A 1C1BA 1GXPA 1MWYA 1WOSA 1F5BA 3QIPA 4JI2J 3FBBA 1YIJS 1YJ9I 4X65F 1UWAA 3TA0A 3A0HC 5KG7A 2O5RA 3F22A 2C3YA 1KLMA 2MQMA 4LFAJ 1TKTA 3FXOA 3GIIA 4LRAA 2ZKUA 2FVRA 2IVMA 3N97A 1X3ZB 4OYMA 3S1TA 5KFBA 2F48A 2GQCA 3QWUA 4GKKJ 1VCTA 3BWGA 4DQPA 1URNA 4DR6J 5LHIA 1T05A 3T19A 2G9WA 2E19A 3ERED 1Z6RA 1C2PA 4WIQA 5IT3A 3KUHA 2XB5A 2HWHA 3R2CJ 4LGWA 2CJBA 2DGXA 4FPIA 3HRSA 4HX7A 1XSDA 1FO1A 1VQOS 2BQ3A 5HLHA 4G6QA 3GLLA 4DZJA 4M3FA 1HBUA 1WOPA 4LF8F 2L0KA 1JT0A 3BJYA 2IIHA 3Q0AA 2Y1RI 1BOAA 2FJBB 3JR9A 3LWMA 4Y33A 2RDIA 3KLHA 4CTAA 4B9MA 4OMFG 1LWFA 3PFOA 1AROP 1FE4A 3MM9B 1CJUB 5KFJA 3VGVA 4YR3A 2W7OA 4KYWA 2DT6A 4Q0BB 1FVSA 2BANA 1N33J 2XDVA 3ZZRA 2CUZA 3E6DA 3TO7A 3OR2B 1TAUA 3IRWP 4NWBA 4J9MA 2M5YA 5DO2A 4LQ9A 3GILA 4B17A 4I67A 1WH5A 2GZOA 4ENOA 2G0IA 3KP6A 1IUYA 4HZFA 3K2AA 2EILH 2PA3A 2E2HJ 3R1LA 3C2HA 2FC8A 1OCTC 1Y6IA 1KQFB 4LR9A 2QIFA 1HL6A 3PX0A 2G0EA 2AWZA 1OQYA 2XC7A 2NSCA 2ZBCA 1K1QA 5J8CA 1IBKJ 1NPRA 2DMTA 3IRXA 3GTQJ 3CJQB 2OH2A 5K5QA 1RWWB 3CIZA 3R2DJ 1JK9B 4LF6F 1A35A 1SD4A 2OTLI 2CWXA 1LK7A 1FX4A 2ZZNA 1YJTA 5JLWA 2LH9A 3I55I 1PYSB 2XRLA 2F1FA 3HHGA 5F1RA 3IKTA 4CNZA 5LD2C 3L7UA 1X19A 3BSNA 3MCSA 2EFQA 1W2BR 3EDPA 5KG2A 2F4OB 5KT3A 3HF5A 2CADA 4F02A 4OAZA 1PC5A 3I64A 3CUQC 3BQ0A 2MEWA 1JLCA 5IP9J 1WVRA 3S1NJ 2CW8A 1JLQA 2W4CA 4DQ2A 1RJJA 3M9AA 4M6VA 2X6WA 1OPIA 4D5CA 4DHVA 4B44A 3CCVI 5DJBA 3KX2A 1VQKS 2HVSA 2UZKA 1GXTA 1BIAA 3B54A 4CRJA 2OUGA 1PO6A 3DF8A 3UO0A 3UCUP 4B3RJ 2N8GA 2EKNA 2XM3A 5K9FA 3PIPF 1YJWS 4NC7A 3TOBA 2XAHA 4ED8A 3BP8A 1HMVB 2OU2A 3SQGA 1B1BA 4JX6A 3SHFA 3V8LA 1M1HA 3GU0A 2AMCB 4ZOSA 5C3EJ 5E17F 4BQNA 2B51A 2BUNA 2BW2A 5IS2A 3MTJA 3F0NA 3HUGB 2STTA 2OKQA 2QQBA 3JRHA 2LDIA 3T6BA 2NOJB 2V4JA 4CUGA 2RQCA 2DPIA 3RR8A 1IXKA 2RH3A 1YITS 2P8IA 5DG7A 1V3ZA 4RNNA 2XBPA 2HFUA 2HHWA 1J09A 2H4YB 4B3OB 3DC2A 1B8IB 1GQEA 2WONB 4JV0A 5KFXA 2I5JA 3LAKA 1WORA 2H5IB 1IJFB 4IKFA 4Z37A 3EGWB 4BNCA 3LFKA 4ZPDA 4C3IJ 3FK7A 4GKKF 4ED1A 1UVIA 2C2ZB 1EHWA 1XNQJ 3MZYA 4I98B 3DMJA 4A0YA 1CEZA 2QQ8A 4N8OA 2CPYA 4AL7A 3CCVS 1MDMA 4E4HA 1QLNA 3OL7A 1OCRH 3OYNA 5CVRA 4M1KA 1JLCB 2CQ4A 2MKYA 3TJ9A 1U0HA 4CWBA 4Q8FA 2KISA 2RILA 5E3MA 1JJCB 4JV1A 2WVBA 4OZ2A 4LSNB 2VFTA 3DBHB 4BXXJ 4Q7AA 4RW6A 3M2RA 3C15B 5LJ5Y 2BABA 4LF7J 2HSEB 3VGSA 2F4MB 3V6JA 5HLIA 2RNJA