2GQQA

Crystal structure of e. coli leucine-responsive regulatory protein (lrp)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
153
structure length
153
Chain Sequence
LDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFIQGYTALLNPHYLDASLLVFVEITLNRGAPDVFEQFNTAVQKLEEIQECHLVSGDFDYLLKTRVPDMSAYRKLLGETLLRLPGVNDTRTYVVMEEVKQSNRLVIKTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Escherichia coli Leucine-responsive Regulatory Protein Lrp Reveals a Novel Octameric Assembly.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Leucine-responsive regulatory protein
total genus 19
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gqqA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gqqA02
3M7GA 4RGRA 5LHGA 5HS8A 1J75A 1WQ2A 1D8KA 2FRHA 1S7OA 2CWEA 2ETHA 2LKPA 3QOPA 4ENJA 3L00A 4LD5A 4G8XA 2OQGA 3GF2A 3JAMK 2V9VA 3BWGA 3U1DA 2ZBKA 1S8NA 1YFHA 5CVVA 3N97A 2A3SA 2VODA 5A2QK 1CF7A 3JTGA 2DK8A 1U78A 3IHUA 2BV6A 4IRIA 1ZG3A 3FXUA 2O3FA 3BROA 3F3XA 2TDXA 3IL2A 4Y15A 4KIFA 1ZARA 1FSEA 2E1CA 2NYXA 2IP2A 4ENKA 1HW2A 1DPRA 4N9IA 2JSXA 4KNYA 2RN7A 4BNCA 1TQMA 3E6CC 1FP2A 3EUHA 2LDUA 3L09A 4GCVA 4HX7A 5F6FA 4RB3C 2IA0A 4EM1A 3IRQA 1ONVA 1R1UA 2IVMA 1RI7A 4GXOA 4M6YA 3KEQA 4Z2YA 4AWXB 3ROUA 2ESNA 4CO8A 4UXNA 1TW3A 1T98A 5JHUA 2CQKA 2QQBA 4M74A 1FBUA 4I02A 4KYWA 5TJJA 5L3DA 4MHGA 1FWZA 2DLLA 1IW7F 3R60A 4OIQF 3MAJA 4DQ2A 1P4WA 1IN6A 3REOA 2GZWA 1I1GA 1SMTA 1G3WA 6PAXA 1O3TA 3H3ZA 5LRSA 1HW1A 4HX4A 5D6FA 1UFMA 2NAZA 3I54A 1T2KA 5LEJA 4P9UA 2ESHA 3P9IA 4AIHA 4LFUA 3E97A 2QWWA 2M1BA 4AVPA 3JAMZ 4A5MA 1TBXA 2A6EF 1F9NA 1WKMA 4WF2A 3G73A 2L4MA 3LSTA 1P92A 3C1DA 5CVUA 3KZYA 1MDMA 1MJBA 1R1VA 1R7JA 2KKOA 2DJWA 1KU9A 1TTYA 3EQLF 2EFNA 4EJOA 5DEQA 2A61A 2VE8A 5DYMA 3TOAA 3DF8A 1B4AA 1OPCA 3E6MA 2YPRA 1BIAA 4ZYDA 3R61A 4HQMA 3E5QA 1TW2A 5KVRA 1ZREA 2RGVA 4HX8A 1RUNA 1B9NA 2Z99A 3BPXA 4PDKA 4ON0A 4U7BA 4CDGA 1OKRA 3I71A 4IVNA 2V6CA 1R1TA 1BBYA 1FYKA 2C6YA 3WODF 2P4WA 2XROA 1FT9A 3QAHA 2VBYA 1U6GA 2Y0MA 2JTVA 1SMYF 2QUFA 5FGMA 1SD5A 5HLHA 2LSOA 1UHMA 3F22A 1FC3A 5DD4A 1H9GA 2NNNA 4NB5A 1SAXA 3BDDA 4MTEA 1XCBA 4WXHA 4YIFA 4UV9A 1BI0A 1KU2A 4RAZA 2A6HF 3S2WA 4FT8A 1GXQA 1ON1A 3R0JA 3LAJA 4ESBA 4BQAA 4ESFA 1XB4A 1KYWA 2CGPA 2EV6A 2L4AA 3NRVA 1FP1D 3LQRA 3R0AA 4XBFA 2P5LC 4R8HA 4ASNA 5BMZA 3M1EA 3CUOA 3FXRA 2PLYA 2GIVA 1LQ1A 3E6DA 2IW5A 4FHTA 3ZMTA 1FNNA 5LEKA 4RS8A 1J0RA 2UZKA 2ZO4A 2GA2A 4A5NA 1TLHB 2X0LA 4LJZF 4KIGA 1FOKA 3QP6A 3JTHA 2A69F 2QLZA 5DDGA 3TDZC 2K7LA 4PZJA 3RKXA 4CYDA 5BPDA 4LB6B 3L2CA 4EJWA 1G4DA 3V8LA 1FZPB 2IJLA 4B8XA 4BYYA 3MFKA 3BOQA 3K0LA 3HRSA 2CYYA 4CZZA 3H3UA 1TQIA 3I4PA 3BPVA 3E5XA 4P55A 4MTDA 1QBJA 1U5TB 4CGZA 2Q0OA 2EFPA 1R23A 2OQRA 1WRJA 4OIPF 2QENA 1KU3A 5E20A 1I27A 3P9KA 1D8JA 5F64A 1B9MA 4M72A 5D5UB 4PGGA 4IXAA 3GZ5A 3TO7A 3FMQA 3RKYA 1OYYA 2ZFWA 3O3KA 2W25A 1OR7A 1YQAA 4AD9A 1A04A 2PMUA 3M9AA 3WE3A 3PFIA 5JR3A 3IWZA 2ELHA 4GYIA 2IPQX 3WTYC 1ZRDA 4KA4A 3ABUA 3FXQA 2EA2A 3HTSB 1Y0UA 1F4KA 3FHZA 1ZRFA 2LNBA 3GW2A 3KP2A 3CTAA 3KLNA 5JI6A 5L3EA 3NQOA 3GO5A 4UV8A 1JE8A 4EJVA 3F21A 2E1NA 1BI2A 4EJTA 5DUIA 1C0WA 4EMSA 2ZXJA 3F8MA 2WWYA 2P6SA 1XGNA 3HUGA 2ZJ2A 5HOOA 5DCFA 4IPAA 4E70A 2FBHA 4I2OA 4LLGF 3NEUA 2X4HA 1R36A 5K5RA 3CLOA 2P7VB 4LLNA 1MGTA 1UHWA 4ZZDA 3KP7A 3ZP5A 5ILUA 3KETA 1JHHA 3IWFA 3ECOA 2O8XA 1R5GA 2FA5A 5CVJA 2KJBA 4HW0A 3V8KA 1T0FA 2F5CA 1V3FA 3K9TA 2J5PA 4DNCA 1BI3A 1ZHFA 5HDGA 4HDUA 2YSRA 2VBWA 2VN2A 3KP4A 4EM2A 5FLXK 3QU6A 2FNAA 2EV0A 2NRAC 5IT9Z 3K1MA 5IT3A 4A0YA 2FXAA 2O6GE 4BHCA 1ZG5A 4LMYA 2RNJA 2W24A 4U0YA 3E3VA 4HF1A 1YW9A 2H09A 4LG0A 2ISZA 3RTRA 3FM3A 5LBQA 4LB5A 3GXOA 1S7AA 3Q9SA 4AIKA 3RIRA 5A2QZ 3P7NA 1S29A 4Q48A 4IRHA 4CXFA 4OINF 4P96A 2JSCA 4O5VA 1UCRA 3EDPA 1PDNC 2FSWA 1IZ1A 2ZNZA 1JHFA 3TGNA 3LWFA 5CVIA 2EFWA 1RIOH 5HS7A 1GHCA 1HKQA 4QWQA 1IXCA 4O3MA 4XSZF 2P5VA 3I59A 1K6OA 3KFWX 1O7FA 3FX3A 4UVBA 4A0ZA 2R3SA 5ICFA 2NS0A 3V7RA 5H6RA 5L3CA 3HRUA 4M71A 1YO5C 3R6SA 2H6BA 3HIFA 3LA7A 2ZKZA 5D8KB 2BEOA 2FQ3A 1MD0A 2HYFA 4BHPA 2XUBA 4EJUA 3PQKA 2VBZA 1Z7UA 3L9FA 4ESJA 3N4MA 3F8BA 2W85A 4UNOA 2A5YB 3PQJA 2OZ6A 1O7LA 3ELKA 3FMRA 3VOEA 1BJAA 4M73A 1V4RA 5TRDA 1WWXA 4RB2C 1XDUA 4RGUA 3E6BA 4MEXF 1FPQA 4HBLA 2QVOA 3E5UA 3J80Z 3VEPA 3KP6A 1KA8A 1KQ9A 2XKOA 2QBYB 2IA1A 3J80K 2L54A 1K79A 3F72A 3MWMA 1SFEA 5HDKA 2HDCA 3CO7C 2EK5A 2RKHA 3ZMZA 1PP7U 4KT5C 3RPUA 1F1ZA 2L02A 1QPMA 4M9ZA 4HOBA 2UXXA 3HOSA 3GX4X 1J2XA 1YW7A 1R58A 1FBQA 2XGXA 1GXPA 4YFKF 3I59B 2K4JA 1HSJA 3ZMDA 2V1XA 5CYVA 2FE3A 5K5QA 4WK8F 2GXGA 4YFNF 3HSFA 1MZBA 1J7KA 3MEXA 5J8FA 2HQNA 4L18B 1USSA 2F5DA 3ECHA 4G7HF 2PFBA 2QM3A 1O3RA 2FEZA 5JFRA 1I5ZA 1B1BA 1G3YA 2GXBA 1IXSB 5BOXA 4IJAA 1RUOA 4H0EA 2PN6A 2D1HA 1I1SA 3F6VA 4UVCA 2K4BA 1TNSA 1U2WA 2OAZA 3FM5A 1ULYA 4G9YA 4IHTA 3SZPA 2V1UA 2MC3A 5FD6A 2IA2A 3B02A 1YYVA 2BYVE 2XAFA 1IN4A 2V1DA 5CJ9A 4A6DA 2D45A 2RC4A 3FF5A 2PEXA 5D5VB 2HR3A 3KEOA 2FMLA 1G6NA 3B73A 1HKSA 3I58A 4N0BA 2FF4A 1XGOA 3CUQA 2HTSA 1S6LA 4EQQA 3TDUC 1J5YA 4PCQA 2P8TA 2HZTA 1O57A 4L9NA 5L3BA 2GAUA 5DD8A 3GFMA 1B59A 3U9GA 4OMZA 4RAYA 1Q1HA 3QPTA 3IKVA 3HRTA 2ZNYA 3LAPA 4JQFA 3F8FA 2YR2A 2COMA 2BBYA 3WG9A 3M8EA 1BC7C 1P6RA 5FB2A 2Q8KA 3FWEA 3GFIA 3GWZA 1L3LA 3R4KA 3RJPA 3GUDA 2JPCA 4QLCU 4U88A 4R79A 2A68F 2XHKA 4K2EA 2M30A 2ZMEB 5E8GA 3K69A 2DAOA 1SD4A 1LEAA 2M87A 2AXLA 4LG0B 4L5IA 5HDNA 5BS6A 4LGWA 2DFIA 4ETSA 4G6DA 4PGHA 4OMYA 5FFZA 1KU7A 1XGSA 1Z9CA 1SD7A 1BOAA 3TO6A 3WGHA 2ADUA 3HSRA 2VT2A 3HRMA 4UHTA 2EB7A 1ZLKA 3HOTA 2PG4A 4GO1A 4I09A 4I0AA 1LB2A 4EV0A 1W5TA 3IKTA 5LGUA 3WTUC 1OYWA 1YTYA 1HKTA 2D2WA 3ZN0A 2M8EA 4I01A 5DCMA 5K1YA 4ENMA 4ZYGA 3BZ6A 1R5HA 3I5UA 3V4GA 2MH9A 4I7HA 1P2FA 2HYGD 4L5JA 4KN7X 4BXUA 2A07F 4L0YB 3F8NA 3I64A 1QO0D 2DU9A 3J81K 2HEOA 3BP8A 4WXDA 4ZYHA 5JVTA 2KJCA 3I53A 2VC1A 5LRRA 2M5WA 2OBPA 1ZRCA 3RPQA 1EV7A 3K1NA 4ENNA 4KMFA 1YW8A 4M9SA 1ZLJA 4IRGA 1XD7A 1E2XA 2UWMA 4EVIA 4N9HA 1KQ8A 3RKWA 1BIBA 4EM0B 3U2RA 1FBSA 2OD5A 3DKWA 3P9CA 3ML6A 4G7ZF 3JSOA 2RQPA 2VONA 1QZYA 1S3JA 2HKOA 4KN4X 2J5OA 1KYZA 4A6EA 4BHBA 5HLIA 2CFXA 1Z1DA 5EEHA 4XLPF 1LDKB 4KDPA 1I6XA 4MEYF 1JXSA 3RI4A 5ILVA 2V79A 4WXCA 3QU3A 4HV6A 3TO9A 3QP5A 1ZYRF 2WTEA 3EYYA 1LEBA 2P6TA 2O0YA 3WTXC 1K78A 4AIJA 1P4AA 4Q47A 2Z9OA 2BGCA 4FX4A 2Z3YA 1J9IA 1HXDA 3TKYA 5CLSA 4CICA 5DV5A 4L9TA 3T0YA 5FFXA 3GYHX 4A12A 2H6CA 5EEGA 3O6BB 2OA4A 1MDMB 2XASA 2JPBA 1DUXC 5E17F 4RGXA 4KMUX 1T6SA 2F5EA 1LDDA 5K5OA 3DQVC 3CUQC 3ZPLA 4A0XA 4F7ZA 3BJOA 2XKPA 2MA3A 1D5VA 3ZMUA 1B6AA 1G3SA 1U8RA 5LGNA 3IC7A 5LHHA 1W7PB 4MNUA 4JBAA 1YS6A 3KE2A 3MZYA 2WV0A 4FX0A 2DQRA 3T8TA 1LDJA 4Y17A 2ACJA 3ZMVA 4MQ9F 2JZYA 3V7CA 5F1RA 4HLXA 4HQEA 3T1BA 2L01A 2FNPA 4OOIA 4RGSA 2H27A 5E1XA 2YX4A 4CHUA 2XAGA 1EH6A 2XAJA 3C18A 3BJ6A 4NQWA 5H20A 1STZA 4M9XA 4HA8A 2IT0A 1MJ9A 4M6XA 5D6EA 3QRFF 2IRFG 3ZN1A 1IN7A 3HYIA 1U3EM 1K78B 1YS7A 1ODDA 5HVQC 1SFUA 4Q5SF 3SHFA 2GWRA 3HSEA 1W7PA 2YU3A 2G9WA 1MJAA 2CSOA 2VOOA 3GFLA 1H0MA 3HTUA 2EA4A 3CJNA 3C3WA 2DPUA 2PMHA 4I0BA 4JK1X 1ZG1A 1FX7A 1CF7B 1FYLA 4S04A 2PBIA 3C7JA 1DPUA 2K86A 4Y13A 3IRRA 4O6JA 2RV8A 1OYIA 3FZVA 3H92A 1BC8C 4UVAA 3ABTA 2HFHA 2LF8A 4YFXF 4YIIA 1X3UA 2EFQA 1ZGAA 1J59A 4MGRA 4KIBA 3DEUA 5AONA 1PUEE 2HWVA 3EYIA 2YX7A 4OIOF 2FBIA 2MH2A 1R00A 1IAWA 2FU4A 2MLGA 4B09A 1XCVA 2FBKA 3DFGA 3LA2A 2HKXA 1KGSA 4WX9A 1LNWA 3TOBA 2HS5A 4P5OA 4ZYEA 5D4RA 2CW0F 2DO7A 3ERED 4S05A 1BN5A 4I98B 3KCCA 3CUQB 1CGPA 2F2EA 2STWA 1DDNA 3F23A 3G3ZA 4OIRF 3Q9VA 4HAMA 2WC2A 2K27A 1AOYA 2E7XA 1T38A 2DPDA 1R22A 1XGMA 4U7DA 1XSXA 1HSTA 1FSHA 3BJAA 5LLQA 1RZ4A 2B0LA 1W4MA 3GZ6A 3WGGA 2Z33A 2HOEA 4L0ZB 2M45A 5LGTA 2H94A 5HS9A 4YG2F 3GEZA 2KIUA 5FD5A 2ISYA 3W6JB 5D8LB 1AWCA 2ZCWA 1XMKA 1XSVA 2MBFA 2E7WA 1UB9A 2EJRA 3LQQA 5L3GA 1D3YA 3WU0A 1O3QA 1RNLA 4U0WA 3V8JA 3SQNA 4D0PA 4KUMA 1DP7P 2VC0A 3ULQB 2HGCA 3QPHA 4P9FA 2FMYA 3RYRA 1QZZA 1JGSA 4OU0A 1U5TC 2EWNA 2Y75A 1XMAA 1NHAA 2VOPA 3EETA 3J7AO 1GVJA 4LK1F 4IHSA 1QGPA 2Z4PA 3I0TA 4G94A 5ERIA 5FLXZ 3SFZA 1Z6TA 3VFZA 2XRNA 1IN8A 5D5WB 1MKMA 1PP8F 5E1WA 5IT9K 4GYGA 1FY7A 2DTRA 3T8RA 2GA1A 3MZHA 1XN7A 2EFOA 1ZH5A 5ED4A 3JSPA 3KP3A 2XAHA 2OU2A 3OV8A 1WI9A 2ZMEA 2XAQA 2CVIA 3LFKA 3RDIA 2NNYA 1E17A 2O03A 2R7FA 5D5XB 3MQ0A 4XSXF 4WCGA 4HF2A 1BI1A 4WWCA 3JW4A 4G7OF 3D0SA 4HYEA 1QNTA 1IN5A 2K02A 1BM9A 1XDSA 3Q5FA 1LJ9A 2KIMA 3KLOA 4XRFA 4KFCA 5L3FA 4RB1A 1EH7A 2FOKA 2CG4A 3CDHA 3RYPA 3V7SA 5FO5A 3LA3A 3KP5A 2MLKA 2Q2EA 5E1ZB 1O3SA 2STTA 2XVCA 2DW4A 4UUVA 4A2UA 1TNTA 3F8CA 2W84A 4HZFA 3AAFA 4HDVA 2QQ9A 2F5FA 4GGGA 1IXRC 3DXJF 1T39A 3DV8A 3WGIA 2VT3A 1H9TA 2LF7A 4NHJA 5ICCA 1Z91A 5E18F 3FMSA 2L3DA 2Z5UA 2CO5A 2XIGA 3SXYA 4EGYA 5J8CA 4HF0A 3O2PE 5KK1A 1P4XA 3WTVC 1W7PD 2VXZA 3WTSC 1U5TA 1YIOA 5J6XA 2MD5A 4MQVA 4EGZA 3OOPA 1YLFA 2PI0A 1YG2A 2W57A 2ZBCA 1SD6A 3WTTC 4R1HA 3MCZA 2VE9A 4U0VA 2QQAA 3DPTA 1USTA 5E8IA 4KICA 3K2ZA 2UXNA 1ZAOA 1SFXA 3DP7A 1KQ0A 2PJPA 1HBXG 3BY6A 2QYOA 2DT5A 5D4SA 1VTNC 4LLLA 1K7AA 2DI3A 1ZGJA 4XLNF 5CVRA 1G3TA 1IRGA 2DBBA 3SZTA 3CO6C 3ZMSA 2G7UA 4L9JA 2KIFA 4TV7A 2DQLA 1ON2A 2G7HA 5DCMB 3D5LA 2XV4S 1LVAA 3VODA 2JRTA 1Z05A 3GFJA 3WU1B 2KRFA 3GLXA 5ICGA 4L9VA 3M8FA 3DPLC 2D1VA 2PQ8A 3WE2A 2VBXA 2E1AA 5HLGA 2HQRA 2O61A 4ZH4F 5AIQA 3TQNA 4RB0A 2JT1A 2AS5F 1FYMA 5ICEA 1W5SA 3WTWC 4HV5A 3T5XA 2P5KA 2BE5F 4IF4A 2QZ8A 3GVAA 4HLYA 1TQPA 2QBYA 3COAC 4ZZLA 5BQTA 1IF1A 3HHHA 2RVCA 1EH8A 1HQCA 3K1PA 5ILSA 5DUKA 1WSUA 5H6QA 2R7DA 1IUYA 3KZZA 2OZUA 2RDPA 3W6KB 3HHGA 1F5TA 1L0OC 5AIPA 2HTJA 4BH9A 3WTZA 5BPIA 3L7WA 2EV5A 4Q4ZF 2P7CB 4G6QA 1FLIA 3J81Z 4BAYA 5LHIA 1XSDA 1QQIA 3VB2A 2DK5A 1Z6RA 3F6OA 3ISPA 4LK0F 1OMIA 1IRFA 3ZQ7A 1REPC 1ZN2A 2GQQA 2Y48A 1HW5A
chains in the Genus database with same CATH superfamily
1N8RT 3PNIA 4B9VA 1OPZA 3UDEA 2E1MC 2D74B 5HS8A 4F91B 1J75A 1RP5A 5HP1B 2FRHA 3M3YJ 4JI4F 2DT6A 2LKPA 3QOPA 3S93A 3GFXA 4G8XA 3JCUC 3QYFA 1ZAVA 1X1CA 1KVJA 3O1LA 3JAMK 3BWGA 5DETA 1XG1A 1S8NA 3TP3A 3H9GA 1YFHA 5CVVA 3HOYJ 2HQ3A 4FXVA 5G4DA 1CF7A 3J7Z5 4IOBA 4MFBA 5D0HA 2E2IJ 4OIXA 1VJQA 2BV6A 4L75A 2EINH 4LITA 4LBHA 2OFHX 4ZPVR 1WC6A 4OYPA 5J1EB 1WG4A 3IL2A 4KIFA 1OFCX 4HHHA 1FSEA 2DA5A 2K7JA 3DGPA 3HX9A 3LA0A 2E1CA 2XB2D 4JI7F 2IP2A 1GNKA 2YWGA 2DNYA 3TI0A 1HW2A 1XS9A 4FE4A 4Y00A 2E9RX 1S1XB 2WA0A 1OWXA 3VHQA 2JMWA 1FDBA 2H51B 1A7GE 3OL7A 3IP4B 3K4MA 3AJDA 3EUHA 4HX7A 3KDNA 4GCVA 4DV0J 1M1HA 4RB3C 1Q8BA 4IUFA 3MR2A 4DR6J 4ELVA 3P45B 3MM6A 2W7AA 1HBNA 3V6KA 5J1PA 5D4OA 2IVMA 3TUIC 5KFHA 3KEQA 5ETOA 2VKEA 3DI6A 3H1CA 2XPWA 2CV2A 1FVQA 4UXNA 1TW3A 1T98A 2ATLA 5E3MA 4MIAA 2LC2A 3GFHA 4TQSA 1NJIT 5JHUA 3Q0VA 1AZSA 1RHJB 2POKA 3R8YA 3LAKA 2FY8A 2WAEA 3KLHA 4CYUB 1X7VA 4ID8A 2BX6A 3R60A 2ZDOA 1VQNI 3MAJA 3MEEB 2VJJA 3REOA 1GAOA 2IRYA 3AOCA 1I1GA 1TFYA 1QA6A 1RTJA 3CCTA 3IR6B 3SI8A 3NCQA 4L3NA 3JTOA 4XN3A 2MGZA 3H3ZA 2XSJC 4HX4A 5D6FA 2W1OA 3G1OA 2L9RA 3UN5A 4ZVSB 4CYCB 2DNMA 3HO1A 4O3OA 3IN5A 3X3UA 2GJ2A 2KPMA 4P9UA 2ESHA 3TZXA 2XC9A 3E97A 4NCGB 2QWWA 3A12A 3OYCA 3LOCA 3FDYA 2WK4A 2A2DA 3G4SI 4OQJA 3CD6S 4A3IJ 1FD2A 4OYMA 2VA2A 3V4MA 1F9NA 2E36A 2UXBJ 2L4MA 3LSTA 3N05A 3C1DA 5CVUA 1UETA 2AX1A 3E51A 1G1XA 1KU9A 1DQAA 2MGQA 4PSWA 1WVRA 3KK2A 1BR1A 2M9KA 2H5IB 1FTTA 4LIRA 2GZOA 3DF8A 2B8PA 3VGVA 4BC7A 3T5JA 1WG1A 2J8AA 3QT6A 3E6MA 2YPRA 1VQ4S 3UE2A 2DIUA 1BIAA 1RCOB 2K7KA 3VGUA 2FJEB 4QR1A 4LSNA 4UY85 1TW2A 3ABLH 1FDAA 2GQ2A 4BE1A 5KFYA 5C4XJ 3W5ZA 5LXYA 4RMNA 2EC2A 2KU7A 1TKDA 1NHVA 2A0FB 2XMKA 1MW7A 3BN4A 2X1FA 1OKRA 2A10A 2IM2A 4V19X 3EUHC 5K7FA 4F55A 1XR7A 3HSJA 1FYKA 4Y33A 2DFFA 2P4WA 3KK1A 1WKLA 2L7KA 4MMOA 4NLQA 5H9EK 2XI3A 2VBYA 2Y0MA 4CO0A 2F4VJ 1VBYA 2PSZA 1CVJA 2QUFA 1UP1A 5FGMA 3MR7A 1MH3A 4FF3A 1KONA 2LSOA 3CXCR 1WSVA 2KP6A 1FC3A 1BOBA 1Z4UA 1F9HA 5CABA 3EGVA 4YIFA 3OSFA 4IH7A 4UV9A 5IWAF 1KU2A 4RAZA 4ERDA 3PSIA 4MYUA 5LFAA 3LAJA 3FBEA 5KG7A 2LMIA 1EP4B 3C2BA 2M8GX 4PG7A 3TANA 2CGPA 2MABA 2L4AA 1JTYA 1FP1D 4XBFA 4ASNA 5BMZA 3M1EA 3FFIB 3DI6B 2PLYA 4Y2CA 3M8QA 2CJJA 1FKAF 2BOPA 1GMUA 2GOMA 4I99C 3M30A 3ZMTA 5LEKA 5HLTA 1SH2A 1J0RA 4K5SA 2DGUA 3W2VA 4OFZA 2UZKA 1R0BG 2X0LA 2FVQA 1XERA 1FOKA 3JTHA 3G9CA 5DDGA 1IKWB 2K7LA 3TZZA 5B09A 2QV6A 1N33J 1YITS 1X4GA 4L3KA 1FFWB 3LW5C 1VQSA 1NDCA 2GAHC 4DZPA 5CKTA 5CAAA 3OV7A 3V8LA 3U7JA 4BCAA 1RPWA 1P6TA 2H3EB 4UT4A 1RTJB 2KM8B 1JKRC 3IFEA 1GT8A 1ZBTA 4BYYA 4JYAF 1K1QA 1N5VA 3QO9A 2FD5A 3FBIB 3S32A 4FQGA 3N28A 3VALA 3HRSA 1KBRA 4CZZA 4CYCA 1W25A 4O3RA 4P55A 4FS1A 3CD0A 1QBJA 1U5TB 4A8QA 4NZ0A 4ES1A 3BC8A 2MQLA 5GMKa 1VI7A 4MAKA 4OIPF 3DHWC 2QENA 4OX9J 1KU3A 1S0VA 1I27A 3P9KA 1B9MA 3JXOA 3RUBL 3ZZTA 1XK8A 2IDLA 3MGJA 3BG5A 4LMZA 3GZ5A 2QCOA 2XEXA 3DWLE 2X1CA 3FMQA 2EIMH 3GZ7A 1OYYA 3C6TA 1LUJB 3O3KA 2XPUA 1N36J 1BC6A 2WSFC 2VQFJ 2A3JA 5IOZA 2HHPA 2XQCA 1YQAA 1V6HA 4U8VA 4LF4F 1R8PA 4A48A 1IBMF 2DR7A 2NVUB 1RTHB 4NLOA 4URQU 3CMES 2RD5C 5F8NA 4FPRA 1W2BR 3O8HA 2JQ7A 3IWZA 1DAXA 4TY8B 2HEKA 4B3SF 4AQYJ 1SJRA 2IPQX 3P4UB 3WTYC 2EBIA 2E5ZA 1ZRDA 4KA4A 2LREA 3VPRA 4B3AA 3OYDA 2MSSA 3A4CA 1YX2A 2UVVA 1Y00A 2OCCH 2ATCB 3VZHA 3FXQA 1U0JA 4PFOA 2DEIA 2WADA 3FHZA 1ZRFA 1N0VC 5C25A 3HHLC 4WTOB 3BN7A 1SV5B 5L3EA 2DHAA 4C2TA 1RA6A 3GO5A 4JV5J 2WY7Q 3JR9A 1S79A 1JUMA 3DRRB 2I5JB 4QR2A 1FMWA 4HACA 1VQOI 1YJTA 1LW2B 1HI1A 5EX3A 4JI6J 3HJEA 3OOUA 4RLEA 3D5RC 2ZJ2A 4CO3A 5DCFA 2XZWA 2PX9A 1FF2A 1XMOJ 1YBUA 3CPWR 1NK9A 5JHFA 4LFCF 2ZXHA 4NEZA 1R0AB 2HGNA 1QUPA 5K5RA 4EMDA 1I3AA 4LLNA 1MMGA 1UHWA 1YVFA 4IX7A 5IV3A 2DMQA 3HHEA 4R25A 1HW8A 2AHQA 2IGKA 2B9YA 2CNKB 2L5QA 4DXLA 4UW2A 3Q8SB 2IJRA 2UXBF 3IWFA 1GV2A 3EVMA 3ECOA 3ZGKA 4NCAA 1OSDA 3V4IB 4D1QA 5CVJA 2NXCA 2KJBA 1H0HB 5F8LA 1IV8A 4IO1A 4HW0A 1T0FA 4JV1A 2J5PA 1TMJA 1EA3A 1N33F 1BI3A 4X4OA 4CDIA 4QIWN 3IG1A 2ZE2A 2OD6A 5IQQA 2VBWA 5F8IA 2VN2A 2J9EA 4EM2A 5HMYA 3IXQA 5IT9Y 4P52A 1EHWA 1S57A 3R1HA 2COLA 2I8EA 5FLXK 4OWRB 3KLFA 4OI0A 3SQOP 3K1MA 4A0YA 2RKIA 3DNCA 4DV5F 2O6GE 4BHCA 4EZ6A 4DFKA 4KPYA 3OD2A 4ILRA 3IAS2 4A3EJ 4DZ6A 5D0GA 3CJTB 1FWLA 2LK2A 2HHVA 5B0GA 1X4BA 3H0PA 2L08A 3C16B 2H09A 2BM1A 3H7HB 2ISZA 1Q95G 3FM3A 3E7LA 4MK7A 1S5ZA 4DR1F 1RT6B 1JLEB 1AKHB 4C2UA 3CD5A 4I2QB 3O3LA 3Q9SA 1SPBP 1X58A 2BJEA 3ZZZA 4AIKA 1S29A 4HL9A 3DU5A 3OW2R 4J9QA 4CXFA 4OINF 2JC0A 4P96A 1J5OB 4IQ4A 1B8IB 1UCRA 3AD9C 3O44A 2ZNZA 2ASYA 3S17J 3WDOA 5KFPA 3M6UA 1YBAA 4YEAA 2EFWA 1FRIA 5HS7A 1GHCA 4WU2A 3QZ7A 2NQPA 5FKLA 3NL0A 2VPYB 4XSZF 1UFKA 3IAM2 1APSA 3I59A 4L76A 1Q82T 1LNQA 4EYHB 2BACA 1CQMA 1Z77A 3GMGA 5EWGA 2VPWB 1J5EF 4BE0A 3KFWX 1O7FA 1D09B 4A0ZA 2ZD1A 2W9CA 3I4MJ 2V6AA 2R3SA 1M1KT 2NS0A 3V7RA 2X6OA 2L9WA 4XLAA 5H6RA 1X2MA 2DK2A 3HRUA 4M71A 3D9BA 4WKYA 1VQ7I 4M3FA 5JVGF 3ILJA 3C14A 1Y0HA 3MHYA 1HDPA 2DFEA 3IV5A 2R8JA 3OT9A 3DDKA 1VDHA 1MD0A 4BHPA 3T19A 2JA2A 4FVMA 4EJUA 2VBZA 4JI0J 3FBFA 1B70B 3AODA 2HHWA 5L1LA 3L9FA 1XTZA 4C3LA 2ZD1B 2W9CB 3GIJA 2ROGA 4OYBA 4QIWD 1X4PA 2VJUA 3CQZJ 3KIOA 3GJSB 3UQSA 2M5YA 3HJVA 5F0CA 4Q2LA 3KXDA 1S48A 2BABA 1TAQA 3JTNA 4LSLA 3DLGA 4RGUA 3BB5A 1IUJA 3J80Z 3NGKA 6FDRA 1K0TA 1KQ9A 4TYBA 1MH4A 2ACYA 2XKOA 4C30A 5BYQA 4F2RA 1HLVA 3LSPA 2IA1A 5I3UA 3MECA 1K79A 3JRGA 4JI5J 3NARA 4D3GA 3GJQB 3MOJB 2AGQA 4TYAA 1UG2A 3RQ4A 3OR1B 1R0AA 5A8WB 4RBOA 4DZJA 4C48A 1UHSA 2UXXA 3C15B 3QOEA 3CULA 4LRFA 5G0RB 3CIZA 3DRPA 5LM7E 4DR2F 4Y2KA 3JSRA 1GXPA 2MB0B 4ZKAA 4YFKF 2LG4A 4O0NA 1FX4A 2K4JA 3ZQHA 3AD8C 2V1XA 2ZMEC 2MZRA 4I2PB 3SFIA 4LF2A 3OIQA 2OUGA 2HNDB 3RB4A 1TWAJ 3I4HX 1ZA1B 3G6ES 2GXGA 4YFNF 3HSFA 5FIIA 1MZBA 1J7KA 3DRSB 5KFNA 2K9NA 2CZ9A 3BGFA 4ZVQB 3PYDA 1XC9A 2KI2A 5KG3A 4PJJA 1GMWD 3GTKJ 2WBMA 2QIFA 3GMEA 1S5LC 2F5DA 3ECHA 2C2RA 1IBLF 2FEZA 3NP5A 2QYCA 3H59A 5FKOA 1FO1A 1Y3KA 2C2KB 4ECSA 1WNEA 1ZR4A 3QJPA 4H0EA 1RHQB 2BVMA 1SL0A 1T9WA 4J9NA 2PN6A 2RF2A 1I94J 4V2FA 1N5QA 4DR3F 4B9MA 4UVCA 1OLTA 3FM5A 1ULYA 2WONB 3EPIA 2K9LA 1RADB 2W9BB 3SZPA 2HHSA 2IXSA 4HH1A 2F4IA 1D1BA 2W82A 4M3BA 3PACA 2ZE2B 3ZRGA 3FQKA 4GO5X 3H2UB 2BE7D 2MKYA 2GIFA 2XAFA 3L9ZA 1IN4A 1QHHD 1S7IA 1F9FA 2W8LA 5GADI 2MQQA 2H1LA 3MMJA 2C3PA 1FE4A 3KLFB 2ME6A 5KFEA 2R5YA 5D5VB 3G6XA 4QIVA 2FMLA 2FD2A 5GAEU 2RQKA 3B73A 1M0SA 2K3KA 2X3DA 1I5OB 2FZGB 2ZH6A 2ZSIB 1WEZA 1RA7A 5CD4A 3HDSA 3TDUC 1YRUA 2JLEA 1S0NA 1HBOB 1PYSB 5AXKA 2LKZA 1WOPA 3OWTA 3CWJA 5L3BA 3VV2B 8ATCB 3BQ1A 4YB7A 2ALZA 3OPKA 2DJIA 2QE5A 3M8ZA 1B59A 5M5YJ 4RAYA 1PAEX 3QPTA 3DRSA 2IS1A 3LAPA 4JQFA 1C2PA 1BLUA 1Q0NA 4OJ1A 4LJMA 3BKUA 1LE8B 3FK7A 4UZCA 1P6RA 5FB2A 2M8HA 2HQAA 2EIKH 1UW4A 2WHOA 3HUGB 1KTQA 3LPEA 5CQGA 3FWEA 3GFIA 1ZELA 3GWZA 1L3LA 4NZ7A 3TUZC 1WCMJ 5C2CA 1RCXB 1IWAA 1HDDC 2LECA 4I7FA 3H5RA 2MMYA 2W9BA 3BQ2A 1W36D 1S59A 3X1LB 2D3ZA 4AXJA 4DS4A 2V2ZA 5IP9J 2Y9ZA 2XZDB 5F1JA 3M6XA 2M87A 1K47A 4RW6B 1CQTA 5CYJA 2CNOB 2ZOMA 2QTWA 3QWPA 1YJWS 2AZ1A 4Y3OA 4LGWA 1MROA 3DGPB 2D3OR 4ETSA 3IM8A 4PGHA 3K59A 3GV7B 3PZPA 4JYAJ 3FVYA 4XK4A 3WGHA 2HWIA 2B9WA 2ADUA 2VT2A 3HRMA 2BJ8A 4EU0A 1RK8A 1MMAA 3HVTA 3GYXB 1RKIA 5SUHA 2XNRA 3W60A 2BY2A 2XLKA 4F92B 2LFVA 2H1KA 3UI3A 2B43A 4DR6F 2BHYA 3WTUC 4RWWA 5EHHA 4PUOA 1F60B 1WC1A 1HA1A 2J7UA 2AJ4A 2M8EA 3MAQA 4CH7A 4K0KJ 3NKYA 3OL3A 4MYTA 5J2QA 1ZZFA 2DXDA 4M5GA 3EUKL 3BZ6A 1FFGB 1FXDA 2BZ2A 5L1KA 5IT9U 4I7HA 3KUHA 2FX0A 1TVRA 3ICLA 4AD6A 1FCAA 3V6JA 2ZH1A 5KG0A 4LF6J 3DOLB 2ZITA 3LGNA 3BP8A 4WXDA 2WY8Q 2HFVA 4FVCA 4IKAA 1KOHA 1KTVA 3I53A 1KOOA 1H89C 3J7AY 2QYGA 3UD5A 1WF0A 3DLEA 1NTCA 5GAGU 2VQHA 1NJXA 1TFWA 3P6YC 5FLXY 2F9JA 4ENNA 3MAHA 2UWMA 1FTZA 3CDIA 5AJ3F 1WTFA 4QJVA 4N9HA 4GRIA 3RKWA 4XORA 4CTAA 4G7ZF 3B4MA 2RQPA 2MLXA 3RKQA 2F6CA 1HWIA 3Q89A 4XOTA 2VKRA 4X4SA 2JA7J 2HKOA 3M8YA 2CQHA 3TNVA 4ZDOA 4AT1B 2CFXA 5EEHA 4XLPF 2DGXA 1UCNA 4F3MA 1LDKB 2C2ZB 1WOSA 1JLFB 3U1NA 1VZ0A 3GLLA 5L1IA 2IBOA 2V79A 2XWXA 2MSYA 3QU3A 4LF5J 2HS3A 3BBCA 3OR2B 2E60A 5FLXU 5T7LA 4GC7A 1Q5YA 1VQ8S 3QP5A 2WTEA 4FP9A 1JB0C 3WTXC 2BGCA 5GMEA 2Z3YA 3M9MB 3TW7A 1J9IA 1N48A 1KQSR 1LWCA 1RAFB 3D68A 1TK5A 5CLSA 3FRZA 4WFNQ 1H98A 2AEMA 2LYVA 2CQIA 3F56A 1D1CA 5FFXA 3OYHA 4A12A 1VQ5S 2VPLA 3WU2C 1SJFA 1Q7YT 1XNQJ 1T03A 4HHJA 1S1WA 2KL8A 1NPKA 3S1QJ 2ZWPA 5IM0B 4CA0A 1LW0A 2C1EB 1QU3A 2DR5A 1T6SA 1LDDA 2WAQA 2QEXI 2QSHX 2KZVA 2L9VA 2LA6A 4F7ZA 4PK4A 1MWYA 4LSLB 3GP9A 1VQ5I 2LVSA 2BRKA 4IG0A 4EZ9A 2PEBA 5IP7J 1NU4A 4LR9A 3KLHB 4FBUA 3BZQA 1BR4A 4I1TA 1U8RA 2YKAA 1VMBA 3GR1A 5HVHA 1IR0A 3EGZA 1W7PB 3LSIA 3K4JA 4RPFA 3S3NA 1BY9A 3EZ5A 2Z0GA 4CYUA 4MQ9F 3KJVA 2KZMA 3ZZ0A 2X3GA 3CZ6A 2DEJA 3MMBA 5F1RA 3F44A 4HLXA 1IQZA 3V81A 2H27A 2BE2B 3VTIA 3C18A 4NQWA 3QWUA 2AWZA 1S99A 1X9WA 3PIPF 5H20A 2YU9J 1SQFA 3DTEA 1U1PA 1YJ7A 2KL4A 2I6WA 1WI3A 2NUHA 4HI1A 5I3QA 3FCHA 2HI3A 1U02A 3ABKH 1S1UB 5B0AA 5HVQC 4WE1A 5J1RA 4Q5SF 4IFYB 2BQRA 2GWRA 3DLJA 1ACMB 5L9NA 2ZKTA 1V5GA 3S3MA 2LD5A 1CEZA 3GFLA 4AE5A 5DQGA 5M3FJ 4LR7A 1S4EA 4XDCA 4I0BA 1C1BB 4E0DA 4JK1X 4AIDA 3TA0A 2BANA 5D0RA 4JI2F 2BJ7A 4DV6F 4S04A 2Z2LA 2K86A 4Y13A 2VUGA 4OZ1A 2HNYA 1OYIA 4EEFG 4IRDA 2VQLA 3FZVA 2V63A 1BC8C 4UVAA 1JIHA 2HFHA 2N3LA 1ZTWA 4YIIA 2EFQA 4FF1A 1W36C 3MR6A 1ZGAA 4FF4A 5ITHA 2BV3A 1AROP 3C14B 1PO6A 4MGRA 1U1LA 2GX8A 1DFDA 1MBEA 4JI4J 3HVTB 4ED4A 2HWVA 2FLOA 3M8PA 5F41A 5EN1A 3M6WA 3HBLA 2MH2A 1R00A 1Q1KA 4N4OB 3LA2A 2OMLA 5CCMA 4P5OA 5D4RA 3P5BP 4DU8A 4KKOA 1O5JA 1LFBA 5D3GB 4O0IA 5KFJA 5FKMA 3TJ9A 1B72B 4OZNA 4I98B 3CUQB 1UMQA 1CG2A 3S1RJ 1NCLA 3G3ZA 3VAJA 4YHHJ 2GV1A 1CJVB 2FLLA 2K27A 2E7XA 4QR0A 1KSPA 3OYKA 2JLFA 4NC8A 5SZTA 4YQWA 3CJTA 2RREA 1XNRF 4OJ3A 4E7SA 4BE2A 4A46A 2ME0A 4B43A 2ZBIA 1UL3A 2H8WA 2MHEA 3A0BC 4NRTA 1UZCA 2FPHX 4Y28C 1G6BA 5LLQA 2B3TB 2B0LA 2JWTA 5HLFB 4Q2MA 3Q8RB 4GVBB 2Z33A 2ADBA 1FRKA 1JQGA 1V55H 3ASOH 1RWOB 4EWTA 2DR9A 5EWFA 3ZZRA 4DBQA 1G8XA 3ITHB 4XIDA 1K9MT 3MUMP 4I6ZA 5HS9A 3GEZA 4O4GA 2KIUA 1VI0A 3BQ0A 2DA2A 3OTDA 2GLOA 2CPXA 3OXLA 4IFVA 1U1KA 1RWWB 2HNYB 1XSVA 4R5PB 2E7WA 3HEFA 2NPFA 2ZH9A 2DHXA 5DM7F 3MR3A 1UB9A 4ZDNA 4U7UK 2J0XA 4F4YA 5KFXA 2HQDA 2JA5J 1EARA 4A3GJ 5L3GA 4DUTA 3PM1A 1SJ3P 1O3QA 2WB1N 5DLGA 5E3AA 4D0PA 1DP7P 4G6VB 1MLAA 5DG8A 1IJEB 3G8QA 4DG1B 4HH0A 4P9FA 2H9ZA 4O4GB 3HGYA 1AUSL 2JHEA 2EWNA 2Y75A 1FVSA 1U49A 3CCSI 1XMAA 3B6BA 3OTCA 4K4SA 2XMTA 3K2AA 3K10A 4YFUA 1SFOJ 3BBFA 2F8EX 2Z4PA 4USJC 1TAUA 4PPZA 2RB7A 1JLBA 1CQNA 1H72C 1HBUA 3BGUA 3N0VA 1IN8A 5D5WB 3KUGA 1HYSB 3AB4B 3IRXA 2JJ7A 3CCES 1Z1ZA 4ED1A 2GA1A 2B9SA 2K40A 3MMBB 3T1YJ 3UDCA 1ZOTA 1XN7A 1ZH5A 1KFDA 2VDHA 5HNHA 2FTRA 3DLLQ 3KYLA 5J4YA 3DOKA 4DX7A 1WI9A 2BW3A 1QRYA 1TT0A 2XAQA 3PM9A 4YN3B 4GKJF 3LFKA 4IEJA 4C4WA 5EZHA 2R7FA 4IQJA 3A1YG 2OV7A 1RT1B 1BI1A 3KLEA 2ZDPA 1NHUA 4RJVA 1VQNS 1WI8A 1QNTA 3OJSA 1WORA 4CCJA 1BM9A 3Q5FA 2KFNA 3HHLB 1E3HA 4OX8A 3UWTA 4B9UA 3W9HA 2CZVC 2XO6A 3OYMA 3GILA 1R49A 5LSOA 2ELKA 2B51A 3LA3A 3LOUA 4GFBA 2E1RA 1VC5A 3BSCA 2X1GA 5H9FK 3SEOA 4RUHA 1TNTA 3I31A 5CYQB 2M0CA 1XEZA 3AAFA 1DP3A 2L0KA 5F0WA 1KKHA 3C3LA 4GGGA 2RS8A 1W26A 3QQCD 4WCEQ 4BXFA 2PJRB 4ID5B 1Y8QB 4G65A 5JLWA 3CC4S 3OYJA 2VIHA 4NHJA 5ICCA 1U1RA 4JYKA 2Y3YA 3I5AA 2M3DA 4XLFA 4L6V3 4K5RA 4G1QB 2L3DA 1WWHA 5LMNJ 2CO5A 2I2YA 2JOQA 2KHMA 1GMWA 2O5DA 1VQ4I 3R97A 1S1VB 4HF0A 3KLGB 2WCXA 3MPDA 2MQPA 1RB0A 1NH8A 2FYXA 1U5TA 2HBYB 1XMOF 4CO5A 2MD5A 2KDOA 4IRCA 4MQVA 2K9SA 4E7HA 3DPUA 2RHQB 3DMJA 2J76E 2KG0A 3G2XA 2W57A 4BWJA 4XIUA 2B9XA 3OJUA 3WTTC 1OYEA 3ZCOA 1CC7A 4R1HA 1EX8A 2VE9A 5DG9A 3LP2A 3AOAA 1USTA 3K2ZA 2AZ3A 1P9YA 1JLCB 3BR8A 4FPIA 5E3PA 1ZAOA 3CMQA 2HHXA 3K6GA 2ZHBA 1IBLJ 3VQSA 1VTNC 5D4SA 1N36F 1W0TA 2LDIA 4DL2A 3M1CA 4XLNF 4GKJJ 3ZZOA 4RM2A 1VC0A 1RESA 3DBLB 4U95A 4DV4F 3J7ZI 4XLHA 3SZTA 3CO6C 3TZYA 3M32B 2PI5A 3T9ZA 2G7UA 1NRKA 2FDNA 2MJUA 1EETA 1ON2A 3AOBA 2G7HA 2NXNB 3PKYA 5J2QB 1LVAA 3VODA 3GFJA 2YKMB 4K2XA 5L9XA 3W2AA 4OHYA 5ICGA 2VB6A 2D1VA 2PQ8A 1GX6A 2ZJQF 4ED6A 3T6BA 4DQRA 3J7YJ 5HLGA 2HQRA 4F2SA 5DZ7A 4UF4A 2I38A 2O61A 3WHBA 4JB8B 2HNHA 5J47A 3TQNA 1WDDA 3OVSA 4DSIA 4RB0A 4A8KA 1UVNA 2QLFB 1N32J 3PEJA 2AW0A 2CPZA 2UXDJ 2C2EA 1OJLA 1UJ8A 2V50A 4HV5A 3BF4A 3T5XA 3I0SB 1SVMA 4FNIA 2BE5F 4M5KA 2PT0A 5IY5H 3HPHA 1MIJA 4I67A 2VG6B 5I3UB 5KFTA 2W48A 4HLYA 1X3ZB 4HG2A 4S0HB 2YPYA 4EUVA 4NNJA 1FJCA 2P2CB 3VDXA 2DT7B 1HIYA 4RA2A 4PXDA 4NX9A 5ILSA 2NVYJ 4AL6A 4E7KA 2MKKA 1YRXA 1WSUA 4PWDB 4CCHA 2R7DA 1IUYA 3ZQQA 1CBKA 2RDPA 1VK8A 3BR3A 3A3OB 3W6KB 3HHGA 1C0UB 1L0OC 3HXLA 4TLQA 3OR2A 3RRKA 3TJAA 1GH8A 4BH9A 2C3UA 2M7BA 4RU2A 2W1BA 4DCOB 2P7CB 1UPMB 1FLIA 2W4DA 5GAGJ 5LHIA 1XSDA 3VB2A 1FI4A 5DM7Q 4WFBQ 1YWXA 2DNGA 3ISPA 4LK0F 1TR0A 1IRFA 2X6XA 3OS2A 1AA7A 3KK3B 2Y48A 3K4BA 4M1KA 5IXUA 3BSAA 3JSYA 2OPQA 4RGRA 3CB4A 5HQ8A 5KOWA 2XI2A 1RU2A 1P1TA 3CMEI 3RAXA 4NBQA 2HNZB 4K59A 3Q2TC 4PJ0C 5ETPA 1SIZA 3KEYA 2ZBKA 2MQNA 3VGTA 5A2QK 3EDQB 4JI1F 1BQNA 2OPTA 1NAQA 3OYGA 3OTOF 1WC3A 3HHLA 3PXGa 4PQAA 4Y34A 2D41A 2O3FA 3BROA 3CJ3A 3OUYA 3F3XA 2TDXA 2VF3A 3BCBA 4Y15A 3M1VA 4DJAA 2FVCA 1VQOS 1T56A 3G1LA 3I5BA 4PWDA 2EG1A 2ZZNA 4BS2A 1SXLA 1UEVA 1LXNA 3WBZA 4A3JJ 1QPIA 4AU7A 1TQMA 2NPIA 2XDVA 2TRTA 2LDUA 5KAKA 3QYEA 1HA8A 2HQCA 2IA0A 2OGUA 1EB0A 2GMHA 3IRQA 2OEJA 1ONVA 4KJIA 3BR0A 4PFPA 1R1UA 3S2HJ 4OZLA 2QRRA 4GXOA 1FHTA 3CJQA 4KHMA 4JUZA 3EDRB 4C0BA 3BDPA 2XY6A 3K4LA 1Y4ZB 4Z2YA 4AWXB 2B8QA 2YQ0A 3OL9A 5CYMA 2FVSA 4QPTA 4USVA 5B1AH 3H5YA 1OQ6A 1FBUA 1KHVA 3GCMA 4I02A 5L3DA 2D5VA 5AE2A 5BR8J 2DXIA 2MQOA 2HXOA 2DPIA 4QPQA 1FK9B 2P0WA 3BTJA 2B7EA 2QC3A 1T94A 1RQ0A 2KTQA 3DN9A 4OIQF 5L38A 1T02A 4Y3CA 4AC0A 1P4WA 1IN6A 5IPAA 1YG0A 4RUAA 1HNVA 3I82A 3RSNA 2XM3A 1BJZA 2NR0A 5KFDA 6PAXA 5ETMA 2ZHAA 5LRSA 2BOAA 4DZDA 1YLXA 1B0PA 4RBUA 1OCOH 1GQEA 1R4NB 3HM5A 5LXRA 1HHSA 5DDQC 2W01A 1ETQA 5LEJA 1X4CA 3TW6A 4AIHA 2HRYA 3SCKE 1RKJA 3CIMA 1SC3B 1U25A 3P5TL 4P2SA 4KIAA 3QLHB 2A6EF 3B54A 1RXOB 5CZVA 2DNKA 3TBIA 4C8MA 3KZYA 1MJBA 1D5YA 1R1VA 1OS5A 4II2A 2CDQA 1SIWB 4EO8A 3PO2J 1W5CC 2A61A 1S6UA 2J5AA 4BWMA 5EF6A 2F9DA 3VR1A 5JJBA 2IRUA 4K7QA 2EK6A 5DZ6A 4WP3A 3NWRA 3NOCA 4ECUA 2XYPB 2PA3A 2V8HA 1FEEA 1OPCA 3U1MA 3LP0B 1RTDA 1JLAA 3I32A 3DEWA 3MAAB 3DEEA 1IKVB 5HVGA 3R61A 4J9OA 4HQMA 1D0ZA 3M8SA 4OHVA 1VRUA 6FD1A 1B9NA 4IOCF 1XQIA 2VPZB 2Z2ZA 3K7AJ 4LBPA 3DDIA 4U7BA 4OI4A 5J3LA 4XKBA 4ZVEA 4JI8J 3WHIA 4K50A 2JX2A 2V6CA 1N77A 2MHNA 2AEJA 1UPPA 1FE0A 3DLEB 3IA0A 3C2HA 2XROA 1VQ7S 2BBEA 3THTA 1CS4A 2FZKB 2QQ8A 2ZJRQ 4M8LA 4J19A 3LPYA 1U6GA 2XB5A 2C3YA 4L72B 2RRAA 1T3OA 1SMYF 4ED5A 1OQYA 2YS9A 2UUBF 3FSYA 1SD5A 1HQ2A 1PKUA 2B7BB 1F9EB 3W3CA 4DR3J 4DYRA 1IDZA 1KLNA 4RUBA 3MM8B 5DD4A 5CD4H 2NNNA 4IO9Q 3PIOQ 4HLBA 1SAXA 3L1PA 4KJZA 1EETB 1XCBA 2QKMB 3N4WA 1VQ9S 1XWLA 2F7VA 4C8ZA 3SFUA 2VKDA 4IL6C 3PX4A 4JI5F 3R0JA 1WEYA 2R5ZA 4ESBA 2HAIA 3BR1A 4ESFA 3L7OA 1NMEB 3D4JA 3SV3A 1QAJA 1OMSA 1KYWA 2EV6A 3WQPA 4H4OB 3R0AA 1VQKS 2M2EA 2CAJA 2LA4A 1H3DA 3AT1B 1EIYB 1T9YA 1NG6A 2MZQA 1JLEA 2CADA 3BV8A 2BW7A 2ZO4A 1BMQB 2M0GB 1YJRA 1JLGB 2KIQA 1TLHB 4LJZF 1GXTA 1Q79A 4KIGA 3QP6A 2A69F 2QLZA 2UUCF 4PZJA 1SKUB 3RKXA 2VFUA 3QBCA 2XSJA 1Y5LB 1QUVA 4F36A 5IC6B 2W00A 1S1VA 1FZPB 4B8XA 3MFKA 3OBIA 3MCNA 4EFAC 2B4OA 2HIQA 1KQFB 3ET6A 2CYYA 4X65J 4DR4J 4ZLNA 1TQIA 1X2NA 3H25A 1DLOB 2M8DB 3GTJJ 1G2HA 4CGZA 2CNLB 1VC6A 3E1SA 5EGOA 1R23A 5D8HB 3KOAA 2BE9B 4YR2A 3KG0A 3V4IA 4Q5VA 5D3GA 3BBBA 2V94A 5F64A 4N8NA 3FK6A 3QATA 4I6AA 3VYSB 5DDOC 3PW0A 3W65A 1Y9OA 2E5JA 2QLWA 4ID5A 2F8HA 2Y0SN 3OVAA 1FESA 2B6AB 2LRDA 5F0FA 3BCAA 3VWSA 2ELHA 4GYIA 2EZIA 2DOAA 2CQ7A 1MSWD 3P96A 3ZQLA 1IKXA 4Q44A 5HK4A 2DFHA 3BQZA 4DSEA 5E79C 3K0JA 1X4HA 1NK0A 1SUQA 2V4RA 3JSBA 3HZGA 3HTSB 4DV6J 3PNVA 1F4KA 1R8BA 3MPVA 2JFDA 1ENHA 2LNBA 4PRFA 1RWPB 4OLPA 3KLNA 1K6YA 5JI6A 3FEXB 3NQOA 2X1BA 4KO0A 1TK8A 2VJVA 4F4AA 2DGOA 1LWEA 1BUXA 1LWXA 3SQGB 1RT4B 1RWMB 5HROA 3I0RA 4NLUA 4H4KA 1MMDA 3NCRA 4BS9A 5DUIA 1C1CA 1YRNB 4EMSA 3F8MA 3TJ8A 1IBKF 2C2MB 2P6SA 3HOVJ 2E5LF 1JKQC 4IPAA 4E70A 5EZGA 3N01A 3OVBA 2RQCA 4PKDB 5A76A 1BQNB 4RUCA 3FMBA 1HQUA 3M32A 4LLGF 3PW5A 3PEHA 4EBDA 1R36A 3ILIA 4FKYA 1LWFB 2P7VB 3D1NI 4KGVB 1RHUB 4A8FA 1MGTA 4Y7NJ 4E2FB 5H2FC 3JRBA 3KP7A 1SJQA 3QT5A 3PIPQ 2DN0A 1OPIA 5M5WJ 3CJ4A 3Q8YA 2KH9A 2DHSA 3MKYB 4BBYA 4DEZA 2CIMA 3H98A 5FJ4A 1LEOA 1K8AT 1OJ4A 5AE1A 4HNVA 5J1EA 4I56A 4ETZA 3V8KA 1E6YB 4DNCA 1FA0A 1S76D 2QO3A 4J7CA 4A3FJ 2LQBA 3JAMY 3BTIA 5ETVA 2Z57B 2DCEA 4X62J 4B1RA 4X0GA 2CWKA 3TA2A 4OYWA 1FRHA 2VI6A 3NMRA 3CJRB 4BGDA 4B3TF 4GKKF 5IT3A 2ZM6F 2YY3A 2BY3A 1OIAA 5A6WA 1Y11A 1KFSA 1GLNA 2FXAA 2F4FA 1TKZA 1Y6IA 5BXIA 3R5BA 1ZG5A 1BGXT 4CLPA 3QNWB 4DV0F 1OCRH 2CH0A 3S15J 4U0YA 2F4OB 5GAEJ 5D4NA 1LWEB 4WP9A 5EX0A 2V2KA 2R8KA 4LG0A 2DA1A 2V4JB 2RU9A 1ZTTA 4IYQA 2MD0A 3HK2A 4DBRA 2XO7A 4BU2A 1TL1B 1W1WE 4I6WA 3GXOA 3FISA 3I6PA 4AYBD 2G4BA 2CQPA 4FYVB 3D0HE 1PC4A 2DNQA 4J9RA 2J6SA 1RAEB 1XNQF 3GTLJ 2A1BA 4IRHA 3CD7A 3FIWA 4YIRX 3EDPA 1PDNC 4NYZA 2FSWA 1IZ1A 2BY0A 2AMCB 3SSSA 1HWLA 2LP0A 4FZVA 2QKLB 3I56S 2Y1JA 5DTDA 1HKQA 3QT8A 3OHAA 1HD0A 2G13A 3AHPA 1JLGA 1R3NA 3R5AA 1TP4A 2P5VA 4CH1A 2P9GA 1U0SA 3EX7B 2DDBA 4RNNA 4ABZA 1K6OA 3FX3A 1ZS6A 1WJAA 2UUCJ 2FLPA 1V3RA 4NXMJ 3D28A 2CJKA 3RB3A 1PYTA 5L3CA 3I56I 1Q5VA 4H4KC 4DF4A 2HAFA 3V6HA 4S0MA 1B7FA 3CLQA 1ZAWA 4I6YA 2BEOA 1RYSA 1MWQA 3PQKA 1NH3A 4DV4J 3DYAA 1HWKA 3DLHA 4ECRA 1WH7A 3EPZA 2W85A 1U7LA 3DDNA 2HURA 4IR1A 3PQJA 1V5FA 5A8KB 1X4OA 2RRBA 1C1BA 2WVDA 4Z37A 3KLVA 3ELKA 3FMRA 2IM3A 1RHMB 4KRWA 1L3SA 1BJAA 1V4RA 1BR2A 4RKUC 5TRDA 2EW9A 2BUNA 2L3MA 5KFBA 4U8YA 4P73A 3EJMA 5KFLA 3GZNB 3MCOA 3H9QA 3H40A 1Z3YA 3VEPA 3A8EA 4WYWA 1KA8A 4BUPA 3BG3A 4PXBA 3AB2B 3M4XA 1TKTB 1EKRA 4IDKA 3P49B 2BMBA 1QM9A 1RUSA 2IS6A 4E8UA 4A8SA 5KNLA 3TX0A 4UUWA 3ENAA 2EK5A 1N88A 2XLJA 4DSKA 3E01A 1PP7U 4KT5C 2L02A 4I7FB 5KFAA 2ILYA 1Q53A 2R2RA 2R7UA 1VRUB 4B9SA 3IAS9 1SAUA 4Z7CA 4X4VA 1I6HJ 3B82A 2GMLA 3TUJC 1FBQA 4F26A 2YNGB 3PX6A 4IRKA 2O67A 3I59B 1VRTA 3ZTPA 1HSJA 3ZMDA 3BG9A 3Q2SC 5CYVA 1RGVA 4QIFA 3PRVA 2IC3B 3ADAC 1MG7A 2DXFA 1UVIA 3MEXA 1L5UA 1KLMA 4W90B 4OI3A 2HQNA 4P7VA 3CJQB 1USSA 2F8MA 4OV1A 2ZXWH 1O3RA 2GW8A 2LEAA 4CLUA 3EVOA 5KG5A 4NDLA 2GXBA 1IXSB 1U09A 3F41A 4IJAA 3Q8QB 1BXNA 5A2QU 2U2FA 1BQMA 3T5LA 4RW6A 3W6VA 1UKUA 4KE5A 3OL8A 1I1SA 2I0XA 2OHDA 1TNSA 1U2WA 3N9UC 2F4VF 1YJWI 2E9ZA 3CCJS 3DLLF 1U6ZA 2GIRA 4KT0C 1FTRA 2IGMA 4A6DA 3R5GA 4B48A 5FRMA 2B63J 5J1NA 1WGXA 2H4WB 3FF5A 2HOTA 3J80U 5HQMA 1SH0A 2P81A 3OSNA 5HMXA 4DR5J 2EI5A 3R5DA 2R9LA 2ADCA 2FQ4A 2FF4A 4N0BA 1LXJA 1AUDA 2Y2ZA 4CLFA 3OLBA 1S6LA 1T9XA 4EQQA 5EWEA 1OY9A 2AHOB 4PAAA 2AO9A 2VG6A 2NVQJ 1O57A 3PO5A 2HVSA 1TKXB 4NI2B 2MFZA 2RRNA 1ZM9A 2D69A 4A69C 5GADU 1PJ7A 2GAUA 3K58A 3RRHA 4CCKA 1FRMA 2KVQE 3U9GA 2CNNB 4OMZA 4QSHA 4DCJB 4KTQA 1U6FA 1VFJA 1TQLA 3J7ZT 2BJ1A 1WTBA 4IHWA 3V2UC 4RAFA 2BBYA 3SQGA 5LMUF 1BC7C 4HSTA 1M1GA 2RDDA 2Q8KA 1LVKA 1PCAA 1SV5A 3IO1A 2XMVA 4CTAB 2IIHA 1K83J 3FZ2A 2JPCA 4U88A 2VH7A 3EGNA 4R79A 3H0GJ 2E2JJ 3M8WA 3PRBA 1K73T 2BKOA 1VGYA 2ZMEB 2HVDA 3NWTA 1G4CA 2KFZA 5E8GA 1MBKA 1F2HA 5LT5A 3SCJE 4UUSB 3OSGA 4LG0B 4NLSA 4Y2IA 2CQ4A 2RIJA 1S0MA 2JJ4D 5HDNA 1FRXA 2W2MP 3IRXB 4K4WA 3MTKA 2R92J 4BY1J 5JLXA 4BQNA 4OMYA 4A3MJ 3RYLA 1UA1A 3HSRA 3PJRA 4UHTA 2PFFB 2LXUA 1K44A 4J9LA 4ZVTB 3GCXP 1XR5A 3I9V2 4WIIA 4EV0A 1W5TA 2IGNA 2E66A 3IKTA 2RMLA 2IAJA 3SDEA 5CH7B 2UUAJ 1WHUA 3C6TB 4HI2A 1YTYA 4USHA 3KLGA 5E2QA 3BSNA 4PABA 2OTLS 1VQMI 1LV5A 3HZEA 3K8WA 2O66A 5K1YA 3DBRB 3UPFA 3IBFB 3UR0A 3OYAA 4ALZA 1XR6A 1JKHA 1KVKA 2MH9A 2HYGD 2GGPA 4BXUA 5K8OA 1UVLA 2A07F 4HTIA 3QRPA 1U8SA 2VG5B 3I0SA 3HHLD 3HM9A 1NUEA 4DV2J 2OPRB 2Z2MA 4KGZB 1JJCB 3CCEI 4DQIA 2KJCA 4AUKA 3MECB 5LRRA 1D8ZA 1ZRCA 3K1NA 2RAQA 3KKFA 5DS9A 3NS6A 1U0HB 1A0OB 1XD7A 2DO4A 1E2XA 1D3WA 4EATA 3G1MA 2G2OA 2ZJPF 4EVIA 3AFGA 4ZP7A 2AQFA 4NPOA 4ZCLA 3JYTB 1BIBA 4EM0B 1FBSA 2KJVA 3UCGA 1E6VA 3TRGA 3K8VA 3ML6A 5KT3A 3JSOA 2VONA 1QZYA 3B8HA 3AAWB 2HGMA 2XMJA 2J5OA 1RT2A 4A6EA 5KG2A 3VAFA 1LWCB 1FEHA 1Z1DA 2WZ1A 1KC8T 4KDPA 3J7AN 1I6XA 5KAFC 2ZVSA 2W4PA 1Q86T 1Q8LA 5DGAA 5ILVA 4HSRA 3MDFA 1YDLA 1Q16B 4WXCA 3MEGA 4HV6A 4KV8A 4BKXA 3TO9A 3M1VB 5IOYA 2ASLA 1DURA 1ZM2A 3EYYA 3BKFA 2O0YA 4D5CA 4F4ZA 3H5UA 2Z9OA 2YNHA 2BA9A 1R5ID 4CH0S 2ALYB 1P7IA 1RZMA 1PSDA 4CICA 2R0QC 2NYIA 5DV5A 4ZOSA 4RW9B 1JWWA 1T08B 4CLSA 2DNHA 3O6BB 1MDMB 1T05A 1ZTRA 1KS2A 2XASA 3AQPA 1S77D 4OZ3A 2TCTA 2F5VA 3RRGA 5E17F 2E29A 4GO7X 4DL4A 3H2VE 4PYAA 4KMUX 4PWUA 1T03B 1ULRA 5K9FA 5DRKA 3NGDA 4RW7B 2J0SD 1C0UA 1WZ2A 3ZZYA 2MA3A 1D5VA 4B3XA 4UUSA 2VG7A 3R5CA 2DH8A 4ZJQA 3ZMUA 4BDYA 1B6AA 1EJ9A 1PYOB 5HSPA 4W97A 3KK2B 2LBFB 5F08A 3IC7A 1NPRA 4DR2J 4ECTA 1B7YB 2C42A 1RDRA 1TL7B 3GTQJ 1RT7A 4ATNA 5B0CA 1G59A 4C2MJ 1NK6A 1AKHA 2DQRA 3T8TA 3CJ2A 1LDJA 4Y17A 2ACJA 1FOWA 3IH4A 1U4BA 1IV6A 2GIQA 2JZYA 4XTTA 3GJRB 3NGSA 4MO7A 3Q23A 5IWAJ 3T1BA 4WKRA 5F27A 4OOIA 2R2SA 2XGDA 4RGSA 3JREA 4RW4B 2B56A 4CHUA 2WVCA 3BJ6A 3SMZA 1Y3JA 2RNGA 3J7YI 4DR7F 1F3FA 2B7CB 4K2JA 2M7AA 2IRFG 4KFBB 2BW2A 1IN7A 3RW6A 1U3EM 1ODDA 1S9EA 5HBMA 1SFUA 3NG8A 3SHFA 2J7KA 4OHZA 2E9TA 3GIKA 3UDLA 2G9WA 3BTCA 2CJYB 1VBXA 3GYNA 2VOOA 2WB1D 2OD4A 3QIPA 1H0MA 3HTUA 2EA4A 2FHKA 4P75A 3M9OB 1J09A 1SKSA 1VFCA 2IAJB 1FX7A 1Q8KA 1LK7A 1B8IA 5ETTA 4JI6F 1FYLA 4DIQA 1IBKJ 4XOPA 2PBIA 3CF5Q 1UA0A 2OIHA 3G71S 1WJFA 2W4SA 3IRRA 4O6JA 5CA5A 2DOFA 2CQBA 3H92A 3OR2C 4F8RA 3R27A 3L2VA 4NLXA 1IM6A 4FKXA 2MDAA 1T9VA 3MEDB 3AH6A 4XDDA 2NZCA 1J59A 3THVA 3OS1A 1EAYC 3F0CA 1HL6A 4N77A 2AIRB 4DSJA 4ER8A 5AONA 1PUEE 1GTEA 4F93B 2ZBQA 1RACB 2FBIA 1IR1A 2V68A 2MLGA 2N82B 1JGGA 3TZWA 5BYSA 4NLPA 2Q1LA 3Q0AA 3TOBA 2EKYA 1S4FA 3ERED 3MEEA 5KG6A 3A03A 2VPRA 1BN5A 2XSDC 2QMUB 2YWHA 3DOKB 2F2EA 4WWSA 1ACIA 1YX5A 5E3CA 3X2QH 2H5EA 3F23A 1H6KX 2QSGX 1RT2B 2WC2A 2DYRH 1AOYA 3NOGA 2LMDA 2DPDA 1XGMA 4U7DA 4HHUA 3IS9A 3W3SA 4Q7AA 1HSTA 5EG0A 3M2UB 2BDPA 2QA4I 4DV1F 1E0EA 3TX8A 2JH3A 2LEPA 1W4MA 1JNZB 2VFVA 4WPAA 2AYMA 3GZ6A 2DXEA 4NLGA 4AXIA 4J9MA 2I5UA 2HOEA 2OSRA 3TP2A 4WFAQ 3TAQA 4F67A 4K4YA 2H94A 3VQTA 5DQIA 4USUA 3RBDA 4C3JJ 1YJUA 2OP5A 1GMVA 1FDDA 1O4XA 1XMKA 4XNFA 1WC4A 2MBFA 2XNQA 1MNMC 2H65B 3ZFVA 3GWCA 2PIIA 2EJRA 3LQQA 4KC5A 2DA4A 5KHDA 1Y5NB 3WU0A 2KT5A 4PJLA 4A8MP 2R5ZB 1ETYA 1R6VA 3SQNA 3A8JA 4G6TB 3QYBA 3W7BA 2VC0A 2QLXA 2HGCA 1ICEB 3LAMA 1TWFJ 4P2MA 1LWFA 2VG7B 3CC4I 2WVBA 2FMYA 1QZZA 4I69A 1DZ5A 4TKTA 1RETA 2B5JA 2HMIA 4CP5A 1Q81T 4K4VA 1PUFA 2VOPA 3J7AO 1GVJA 4IHSA 1SC7A 1QGPA 3OIPA 1NDLA 2BVZA 2HWTA 5C42B 5ERIA 1BQMB 3MD3A 2XRNA 2QSWA 1UFLA 2MKJA 4DDFA 5K8MA 1MKMA 2DT9A 3D1HA 5E1WA 5IT9K 1YI2S 4GRSA 3M7VA 3ENQA 2KLOA 2R3VA 1HQUB 2CUFA 4A3DJ 4TLRA 1X1BA 2GO9A 3C16A 3LQVA 3K5OA 3FEZA 4ZYAA 3D2WA 1R43A 2E7VA 3SIPB 3KP3A 2XAHA 1DY3A 3IM9A 3OV8A 2MKHA 2XY7A 1GDTA 4JI3J 5IYDJ 2RILA 2HOSA 2NNYA 4KPCA 5E3OA 1TL8A 1YI2I 4LQ9A 1AB8A 4IH6A 1HMVA 4U7UD 4YUDA 4IFVB 1VCTA 2KVIA 2ECBA 3TAMB 2I9SA 3VCDA 2OMOA 1R71A 5I3PA 2GC8A 1D0EA 3QIPB 3KLOA 4XRFA 2BOLA 3E2EA 3CC2S 2HDWA 3N6NA 4G1IA 3BO4A 3S7RA 5L3FA 2YKNB 1GX5A 2C22A 4RB1A 2ZH8A 2E5NA 3CJ8A 4KHRA 2E71A 3HMJG 3PW4A 3R2CJ 3CDHA 5ETQA 3RYPA 3V7SA 3D7SB 3OS0A 2CU7A 2MLKA 2B9EA 2VL1A 3ISND 2STTA 2YWFA 4UUVA 4G1QA 4A2UA 3RZDJ 4ZP9A 5ETRA 3UVJA 3ZTOA 2W84A 3DKXA 4HZFA 4C9YA 1VBZA 2QQ9A 2F5FA 3JRFA 4BJTA 2K3IA 3CCVS 1T39A 3WGIA 2NYHA 2VQFF 1NDKA 4URGA 2LF7A 1JKOC 2FC9A 2H54B 2CV0A 3F73A 3K5MA 3CCRS 4LRDA 3HVWA 3UKGA 4FYYB 1U9NA 2OPPA 3A8IA 3FMSA 2QLBB 2RQQA 4M95A 2UU9J 4OAZA 1PC5A 4RNHA 4OJGA 4C98A 4LBIA 4Q43A 3US5A 1S1TA 1TZLA 3WTVC 2ZUAA 2BKNA 1YQHA 2E1PA 3Q22A 3H5XA 3POTB 2LOOA 4R8UB 2QFJA 2M0MA 2UXDF 1FXRA 1YLFA 3KHGA 2G1DA 1SD6A 3SSQA 1LFUP 3MCZA 3C46A 2XGPA 2XG8A 5GAEI 3KTQA 4UUXA 3PHEA 2OSQA 2MQMA 1TL3B 2CFOA 2YNIB 3UW1A 2MY7A 1KQ0A 4DUZF 2QYOA 2DTJA 4DPYA 2IM1A 5E7OB 4I2QA 1FJ7A 2DI3A 2LCWA 2HVIA 1LKXA 3J81Y 1IRXA 1AYEA 2KDZA 3KHRA 2L7ZA 1G3TA 3HG9A 5LMNF 2W7OA 2DBBA 1PUFB 3FBCA 3PUBA 5GTHC 3IUOA 3CC7S 4U7CA 2DQLA 4Y4RA 1YK9A 4LF5F 1BL0A 2FIUA 3EXCX 3D5LA 5C42A 4ICLA 2KT0A 2JRTA 1Z05A 4ZCMA 2LY9A 1F36A 4A8WA 1J5OA 1YZ7A 3IS9B 5F8HA 2AYBA 4PUOB 4IHVA 1VQKI 1S1WB 5EEAA 1GTHA 4WTYA 2JL9A 3U02A 2VKZG 4G1PA 5AIQA 5LSLA 1OYDA 4ZPCA 2APOA 3ZTQA 4PXCA 3DLAA 2FJAB 3H42A 5ICEA 1W5SA 4V2GA 3WTWC 5GAHJ 2FY1A 4JP0A 2VHGA 1DARA 2DGVA 2W9AA 4LF8J 5D77A 1U0HA 4DWIA 3GV5B 4IF4A 2MKCA 3AY0A 1QAIA 4A4JA 2HVRA 4XLCA 1NSKL 1IF1A 1Z2LA 1FK9A 1TTHB 3CF2A 1EH8A 1FTCA 2ROEA 3NWSA 1S1XA 1REGX 3ZO7A 1SEUA 2IY5B 1RSCA 2V8VA 5DDRC 5J2NA 1ZETA 4EEYA 4F4XA 5AIPA 3CVKA 2XY5A 2F48A 2VKVA 4KB7A 1N6QB 2HHTA 1TL7A 2R7RA 2DGSA 3O2IA 3L7WA 4B08A 3AJ2A 3MUVP 2CQDA 2NVTJ 2WB1A 2B4VA 4B3TJ 4GKKJ 2LY1A 3BLYA 1RR7A 3B6AA 1QQIA 2MTLA 2QL7B 3QPIA 2D3UA 2BJ3A 3RAQA 1VLYA 1Z0XA 4OZ2A 3F6OA 3MM9A 5FROA 1ZN2A 2M52A 3RR8A 2LFBA 1B3TA 4UB6C 3M7GA 3AG1H 5LHGA 4OYXA 2DMPA 5J2MB 1D8KA 3GONA 1S7OA 3L3CA 2ZH3A 4AVZA 4ENJA 1FFSB 2LKXA 1J5EJ 3L00A 2OQGA 3C66A 1HOMA 1Y1WJ 1MBJA 3HVRA 3M8JA 2NLWA 2V9VA 3HCXA 3MAAA 2N8GA 2BEFA 2R7VA 3TP0A 1JXVA 3U21A 3ASNH 2GMJA 2WW8A 4UZBA 3N97A 2A3SA 2VODA 2JFKA 3HKWA 3O5TB 4A8XA 5L39A 2HPMA 2JEGA 3KMSA 2GVDB 1ZKGA 1TUVA 3SBMA 2DK8A 1U78A 2RDJA 3R9LA 4U6PA 1P9QC 1U8WA 5B3SH 2HFSA 4NOHA 1ZG3A 1N5SA 3FXUA 1RT7B 5HJYA 1WHXA 2HYJA 4PPDA 4WFXA 2MW8A 3FKIJ 1IBCB 5KT4A 3V6DA 3QRQA 2HVZA 2NYXA 4OYZA 3L95X 4ENKA 5CCLA 1NK5A 2IEKA 1SL1A 1DLOA 2VQCA 3WG7H 1UG0A 4BNCA 4WXOA 2XHWA 3VVTA 3H4BA 4F25A 2GIZA 1N56A 5F6FA 5C2GA 1Q4RA 4F4WA 4NI2A 3OIOA 5H1SV 3BR2A 1IKYA 1EF4A 4EM1A 1I50J 3KHHA 5B1BH 3A8KA 1RWNB 1A5JA 1DTQA 4F04B 2XS7A 1S97A 5A8RA 3JTPA 2V4QA 2GS8A 3ESWB 4NCBA 3V42A 2D9PA 2ESNA 4CO8A 1LQ9A 9ATCB 2CQKA 3L7UA 2QQBA 4M74A 1IR2A 4PQUA 1RT5A 4QIGA 3OXFA 2R5YB 1D8YA 2WAFA 5TJJA 2HFOA 2DLLA 1Q8IA 4ZJLA 1AA1B 2X1EA 1IW7F 4ETXA 1X4AA 2N4CA 5FD1A 3PJWA 4QIEA 1PIEA 3S2DJ 1S6PA 3M9NB 4BLGA 1SUQB 2GZWA 2R42A 3R3TA 4AM3A 2EPIA 3FHNA 3DOMB 1K1SA 2G0CA 1SMTA 1G3WA 2W2QP 2V8DA 1C4AA 3MF5A 3SDEB 4E7IA 3BTLA 1UFMA 1RAAB 2NAZA 4YRVA 2V6EA 3QGPA 4LFCJ 1RR8C 3MM5B 4II3A 2GQCA 1JX4A 4ANEA 4LFUA 4FDFA 5BR8F 3JAMZ 1RAGB 2F4MB 2V1NA 4CNZA 5HANA 2UV8G 4ECQA 1JJHA 3G73A 5FDLA 2A6MA 4NWBA 4QWCA 2CQCA 4DL0C 2GNKA 3AXKA 6AT1B 2KKOA 4HEA9 2UUWA 2GHVC 4LVNP 1JK9B 4NE9C 1TTYA 3PFEA 5B0DA 2EFNA 2R8HA 4WZMA 4CCMA 1X60A 1GT0C 3BZKA 5DEQA 2YWEA 2VE8A 3C6UB 2Y1IA 5DYMA 5FKKA 4NLTA 3TOAA 4HR2A 1B4AA 1FX2A 5CYMB 5MLCV 1ZZNA 4H54A 1E3OC 3CCQS 5A8KA 3G6EI 4KR0B 3LSGA 4ZYDA 4V1Ak 7FDRA 1U2FA 4O44B 4HX8A 2IBDA 3T5HA 3BGRA 1RUNA 2JA8J 4YOEA 1Z67A 2LDYA 1IKVA 1NEEA 4C8YA 2J9CA 3GR0A 2B4UA 2OPQB 3VGSA 4EYIB 4IVNA 4MFDA 1RU1A 1FNOA 1R1TA 2NSCA 1AZSB 4M63A 4I76A 4BDZA 2R8GA 5IP6A 3A2KA 2AD9A 3FJ2A 3TEHB 3PHTA 1GXLA 4UQGA 1R9TJ 1RBOB 2L9DA 1TKZB 1NK7A 2XMWA 4KY3A 2BZTA 5KFIA 2JTVA 1S1TB 1KR4A 1HW9A 5D15A 3JS9A 2C28A 5HLHA 3F22A 1NK3P 2GJIA 2G0JA 3FUYA 4NB5A 2H8RA 3MM5A 3BDDA 4MTEA 1H38A 3E8OA 4O3SA 3BGOP 1BI0A 2DY1A 3S2WA 3DKYA 1ON1A 9ANTA 1NLKL 2OJED 2YNGA 4RL1A 1R4MB 2JEFA 5KT2A 2ABYA 2XMAA 3LQRA 2UP1A 4PG5A 2M4GA 3GPAA 4R8HA 2KRHA 3FXLA 4CCNA 3JQJA 3CUOA 2NOGA 3C15A 2GIVA 5B0EA 1PJRA 3HD2A 3QJLA 3UD4P 2F3JA 2VA3A 3E6DA 4FHTA 2YVSA 2CQGA 1FNNA 4ZHRA 2ROPA 4L74A 1F2GA 2CQ3A 1H7WA 1AW0A 4WFZA 2GA2A 4PQUB 3C6UA 4GC6A 1S6QA 2HU9A 1DHMA 4ZC3A 4ZLJA 5E3QA 4N5SA 4C3MA 3QGGA 4NXMF 5BPDA 1J2VA 4LB6B 4PR6A 3KNAA 3L2CA 3ZNUA 3VF0B 1N5YA 1G4DA 2IBKA 2Y8YA 1LW2A 1SB6A 3W8GA 3IC1A 2IJLA 5B66C 2EKNA 4BHQA 3MR5A 1UJ4A 4ED8A 3BOQA 3KUEA 4KH0B 3QQAA 1EKEA 3H3UA 2ZJPQ 3QFHA 3TQEA 4QW8A 3BPVA 4MTDA 2J9DA 2ACMA 1FWPA 3CSKA 1EQ0A 5ETLA 3NNHA 2Q0OA 1RT5B 2EFPA 4IG0B 2KZZA 2OQRA 1I6JA 1WRJA 3IAM9 4LF8F 4OLOA 3PR4A 2KXFA 1OY6A 3LP1A 5D5UB 3TO8A 4KHPF 4PGGA 7AT1B 4Y2AA 3BR5A 4IXAA 2DNLA 3OYFA 1ETVA 2Y0SD 2O9LA 3I55S 1OR7A 3MOZA 4AD9A 2KISA 1A04A 2K1RB 1MN7A 4DV3J 4USIA 3CDAA 3SCLE 3PFIA 1D9FA 5JR3A 1RWUA 2XYHB 5K7HA 4E7ZA 3DLKB 1R6YA 1G3OA 1UZHA 2RDIA 3OYBA 1QD1A 3LP1B 2VJIA 2HPIA 1XJWB 3D0IE 2MC4A 4LT6A 3ABUA 3HULA 3CCJI 3G82B 4DL6A 2VD3A 3OHBA 3I9ZA 1M5HA 3S6EA 3KYCB 2HLUA 1TUWA 1X0PA 3IP0A 4DR1J 5E3NA 1T9TA 4BXXJ 3D5MA 1TL4A 1Y0UA 4N41A 3GTGJ 3MM9B 3G6YA 4ES2A 2UU9F 4E6KG 1JE8A 2NCKL 3F21A 2UV8A 4QWAA 4EJTA 4ZP8A 2KHCA 3DTKA 1H74A 3ZQFA 2F5GA 2GBYA 1C0WA 4DPTA 2ZXJA 1J27A 2WWYA 3W61A 1VS3A 3GG0A 4NXNJ 2J9DE 1OSCA 2KRBA 2RKIB 3HUGA 1D1AA 5DM6Q 2HNZA 2DA7A 5HOOA 1C1CB 5F8JA 4LREA 5IOLA 4JX5A 4MFBB 1U1QA 2PEHA 4I2OA 3RBZA 4CNYA 1G7CB 3DRRA 2YH1A 3V81B 5KOXA 1XMQF 2FJDB 2X4HA 2DHGA 4GVBA 3CLOA 3H5SA 1ZPWX 2CV1A 4ZP6A 3CJSA 3EE3A 4DN0A 2E5LJ 5DM6F 4GDFA 2IC3A 5ILUA 3DCAA 2EIJH 1JHHA 1KRPA 3TWZA 4N47A 4YEJA 2O8XA 3NLCA 3BGLA 4ZA1A 1HD1A 4C11A 1S6PB 3OUYB 2F5CA 1V3FA 3K9TA 4K8RA 3DYAB 2BM0A 5JMNA 2YUSA 2MYFA 5EGYA 4HDUA 2WVEA 2CPDA 3U1KA 1T3NA 3SV4A 3KP4A 2EC0A 4X4NA 4HVZA 5K7ZA 4B17A 4RU9A 3QU6A 1EKSA 3NAUA 3G82A 2AGPA 2R2TA 2EV0A 2LQ8A 2NZ4A 4ZVOB 1VOMA 2OKQA 3RW7A 1P8GA 3G8SA 5GAHU 4LMYA 1JLBB 3MD2A 3GB0A 2RNJA 3CJRA 3VZIA 4J9SA 4DOZA 5M2RA 4HPQA 5J2PB 3E3VA 1HI8A 4MJKA 4HF1A 2HRUA 3OR1C 1YW9A 2HMIB 1V5IB 1B0TA 1C4CA 3ZC4A 3AXMA 4D7MA 3ZOBA 1UVKA 4IDKB 3M6VA 4XM3A 2QMXA 3QT7A 2C2DA 3NGUA 5F3ZA 4CM0A 3RIRA 4MH8A 3P7NA 4RLQA 3KJFB 1SFKA 2GHWA 2UUZA 1CJKB 1CJUA 2W8KA 4M5DB 3D1OA 3IBCB 3W9IA 1JHFA 4FNHA 4P2FA 5E5NA 3TGNA 3LWFA 5CVIA 2J7WA 4QPXA 3UCUP 1UAAA 4QWQA 1IXCA 2CJQA 4DU7A 4FYWB 3W9JA 5HMZA 5IV4A 5FDLB 3PYEA 1HMVB 5GPCA 1IC8A 3M8RA 5KFVA 1RT3A 2BXJA 2KQRA 4OX9F 3E0JB 4TVAB 5HMWA 5ICFA 4RW4A 4IO9F 1F43A 1XN9A 2K85A 1YO5C 5B7WA 2UVUA 2G0EA 1R8AA 1EP4A 4B44A 2CPHA 4BL0B 2H6BA 5D8KB 3Q83A 2VJ5A 4E7JA 2FQ3A 4RR5A 2XS2A 1NK4A 3UD3P 1I94F 1Z7UA 3FFIA 2P9CA 3O8WA 2GAGC 4OI2A 9RUBA 3N4MA 4I68A 3NNAA 1ORKA 2NS8A 3F8BA 3MMAA 3MFIA 3JRHA 1OO0B 1URNA 2ZFUA 1NSPA 4MKVA 2OZ6A 2LLZA 4LOCA 2YKMA 2E1OA 2AP6A 3I0RB 3IMQJ 4WFYA 3CW2C 4ELUA 4M73A 3N6MA 1K0VA 4C8LA 3MM7A 4HYKA 2CUEA 2O3DA 4BEHB 2EZHA 3HLUA 1FPQA 2IGOA 1QLNA 3E5UA 3MEDA 3ZNJ1 2WRMA 3OQ2A 1A9NB 3CCYA 3KP6A 5IZHA 3TQ1A 2RQMA 2EEYA 1PILA 5B08A 2F40A 5HO4A 1L3VA 3UVJB 5KFFA 4F0HA 1PBAA 3CCWA 4UQTA 3K4KA 2L54A 3VSKA 2VXDA 3F72A 3Q8UA 1SFEA 5HDKA 5D4PA 5EGOB 2HQ5A 2AT1B 1ROFA 2HDCA 2UXCJ 3CD6I 4XMYA 3DHXA 1NNDA 3ZMZA 3RPUA 1F1ZA 4M9ZA 3PRDA 4ILMA 4X4PA 1JLQB 3GFZA 3HOSA 4X4RA 1J2XA 4CWBA 2KT3A 2IMOA 1YW7A 2K9MA 3HHNB 1DRZA 3TL4X 2W7NA 4V19K 1UEKA 4NEYA 5CXTA 2HRTA 4FYDA 3W2WA 3A3NB 5GPAA 4TU7A 3UNGC 2A6OA 3CTRA 2NUUG 2XMMA 2FE3A 2E44A 3S8SA 2DYSH 1DGWY 4N7TA 3PNTA 1SVOA 1TV6A 5K5QA 4ZJOA 3CJ0A 3V5RA 3MM8A 4RAGA 4MTPA 1QJHA 2KYZA 1U26A 3PW2A 1U47A 4YMEA 3QPSA 4L18B 2L9NA 2XF5A 2AX0A 2WBRA 1QVTA 4B4CA 5E41A 4HDHA 3CCLS 2QM3A 3FXJA 5T14A 2E34A 4FN5A 2MJNA 5JFRA 1VQYA 5DJBA 4IKFA 3WZ0A 1B1BA 1G3YA 3VAHA 2R4GA 2VQEF 2ZFHA 4IH5A 3VWBA 2GCFA 1JLCA 2RSQA 1TL1A 3GQCA 1GUUA 1FEXA 2YWKA 2D1HA 4RZRA 2OAZA 3NNCA 4IHTA 1W7WA 5E3LA 2LH9A 3D67A 4RO0A 3K17A 1RISA 3CCLI 2BQUA 2MC3A 1IJWC 1YX3A 1YYVA 2JLGA 1JKHB 3B4DA 5T41A 1R27B 3AL0B 2ZXIA 4XK8C 2KHDA 1YOVB 2JEIA 1PBUA 2V1DA 2DRBA 1MBGA 1IBMJ 5CJ9A 2OPSB 4O3PA 2I1RA 5IM0A 2D45A 3OLAA 5KG1A 3DKDA 2JA6J 2XHCA 1HNIB 2RC4A 1VJWA 1H73A 3KEOA 4ECZA 3H0DA 4IOAQ 2B5JB 3K57A 4OZJA 1X5TA 1HKSA 2RH3A 1T8EA 5FRNA 3CCUS 1POGA 3I58A 3JYTA 3CUQA 2N7YA 2OTLI 1FIAA 3PTWA 2EG2A 3D6HB 1T8IA 4PCQA 2ZH4A 1D1UA 2PGCA 2W2NP 3RTVA