2GQQA

Crystal structure of e. coli leucine-responsive regulatory protein (lrp)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
153
structure length
153
Chain Sequence
LDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFIQGYTALLNPHYLDASLLVFVEITLNRGAPDVFEQFNTAVQKLEEIQECHLVSGDFDYLLKTRVPDMSAYRKLLGETLLRLPGVNDTRTYVVMEEVKQSNRLVIKTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leucine-responsive regulatory protein
publication title Structure of the Escherichia coli Leucine-responsive Regulatory Protein Lrp Reveals a Novel Octameric Assembly.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 19
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gqqA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gqqA02
2XKOA 2DPUA 2A69F 4RGRA 2P4WA 1T0FA 2V6CA 5AONA 3J7AO 3GUDA 3CUQA 4GO1A 1XCBA 2H09A 3F3XA 4EGYA 2CO5A 1T6SA 4ENJA 1T38A 4IJAA 1SFUA 2LDUA 1R5GA 3V8KA 4HQMA 4G9YA 3DF8A 2W25A 3DKWA 5F6FA 2DPDA 3DXJF 1DDNA 1BOAA 3Q5FA 2FBKA 5F64A 4CO8A 3G73A 2QUFA 3CUOA 3CO6C 1XCVA 1FSHA 4EM2A 2EFWA 2ZJ2A 1FYKA 1DPRA 4PDKA 2EB7A 5E1WA 1ZHFA 3GF2A 3L00A 4MTEA 3QU6A 2L54A 1Z91A 5HLIA 2P8TA 2E7WA 3GYHX 2OU2A 4TV7A 1ZAOA 1U6GA 2F5CA 2RQPA 1XDSA 4QWQA 1K79A 1L3LA 4A6EA 3HRUA 3ZQ7A 4RB2C 2P6TA 2K27A 2ZNYA 3HRSA 2ZXJA 1UFMA 3BPVA 1FLIA 2MC3A 1KQ0A 2RNJA 4EV0A 1ZG1A 3I58A 3I4PA 3N4MA 3TDZC 1MZBA 3HYIA 4B09A 3HRMA 2OBPA 4R1HA 1KGSA 4PGGA 1UHWA 5LBQA 1JHHA 4IXAA 1J7KA 4ZYGA 4DQ2A 4ZYHA 4HOBA 2HKOA 4O6JA 3U2RA 4B8XA 3J80Z 3ZMZA 3S2WA 3GFIA 3SZTA 3DP7A 3KCCA 4A0ZA 3GWZA 2Q8KA 4A5NA 4PZJA 3F6OA 5L3FA 1KYZA 1QQIA 2STTA 3ABUA 3R4KA 2GA1A 3RYPA 1CF7A 4BHPA 4YIFA 4KICA 3H3ZA 4L9NA 1YW7A 3QP5A 4L5JA 2RN7A 1BBYA 4BH9A 4EJVA 2RKHA 4Y17A 2W84A 2K02A 3IRQA 2HDCA 2ELHA 2QZ8A 2HZTA 2LNBA 1RNLA 3R0AA 2XHKA 1YYVA 3LQRA 2A6HF 4ESFA 1IRGA 1JE8A 5LGTA 3GO5A 1U3EM 1B6AA 2IRFG 2YR2A 1IN4A 1EH6A 1HW1A 5K5OA 3CUQC 5H20A 2HTSA 1TLHB 1F5TA 2HTJA 4EJTA 1V3FA 1RUNA 1IF1A 3K9TA 3R0JA 4P96A 3HSFA 4N9IA 4MHGA 2IT0A 2MH9A 2HS5A 3EDPA 5D5VB 3KETA 3QRFF 5TJJA 1ODDA 2EJRA 2F2EA 4PGHA 4G8XA 1IN5A 1HQCA 2W24A 4RB3C 3H3UA 2CYYA 5D8KB 2NRAC 1QBJA 4I0AA 2FA5A 3KLOA 3EETA 5E1ZB 2R3SA 5HS9A 2C6YA 2H94A 4UV9A 3RPQA 2Y0MA 3WE2A 2ISYA 3ZMDA 3KZZA 5ERIA 1I5ZA 4CHUA 5ICFA 2J5PA 3CTAA 4G7HF 2EV0A 4IRHA 2D1HA 1LQ1A 4P55A 1HXDA 1UHMA 1R7JA 5L3EA 4AD9A 1IUYA 2XKPA 3RI4A 3WGHA 1E17A 1R1TA 1U5TA 2P5KA 2W85A 4IF4A 2QWWA 1NHAA 5D5WB 5FO5A 4M6YA 5AIPA 2FSWA 1S7OA 5LGNA 1F9NA 4L18B 2VODA 3IHUA 5H6RA 2VBYA 3GW2A 1K7AA 3COAC 4HAMA 4KUMA 2FBHA 3JW4A 4ON0A 1FZPB 3IKVA 3QPHA 2P5LC 2M45A 3TO7A 5DUIA 5DCMB 2P7VB 4KMUX 3TOBA 4FX0A 3IC7A 1FBUA 4LLLA 1QPMA 1YO5C 3MEXA 1P4AA 2RV8A 5E17F 1SFEA 4S05A 4Q4ZF 2Z4PA 1YIOA 3MAJA 3F8MA 4D0PA 2GWRA 1B9MA 2UZKA 2BV6A 2VC1A 3DV8A 1CGPA 1TTYA 2BYVE 5BOXA 2M8EA 4KYWA 3F8FA 4EQQA 2E1AA 2IJLA 4EVIA 3PQJA 4OMZA 1FC3A 2J5OA 1K78A 3WTUC 2ZMEA 4FX4A 1XMAA 4CZZA 3T8TA 2EA4A 2HGCA 2JT1A 2Y75A 3KEQA 3P9CA 3KP3A 2OQGA 4XLNF 4M9SA 1XB4A 3DEUA 1XSDA 5D5XB 1H9GA 2XAQA 2K86A 4YFXF 4MNUA 2QM3A 2XROA 4WCGA 2Y48A 5D6EA 2W57A 3GZ5A 2OA4A 1O3SA 3ABTA 5L3GA 2MLKA 3LAJA 1JGSA 4JQFA 4U7BA 1W7PA 5DV5A 4NB5A 2A5YB 3T5XA 1YTYA 3RDIA 2A61A 2XAJA 2EWNA 5HS8A 5DD4A 1TNSA 1H9TA 4EJUA 2UXNA 2P7CB 1REPC 1Y0UA 1ZGJA 2QBYB 3MCZA 3HHHA 3GLXA 3ZMVA 4U0WA 5BPDA 3BY6A 4EM1A 1AOYA 1ZRDA 2XAFA 4WXDA 3SFZA 2FXAA 2K7LA 2FEZA 3GFLA 2CFXA 2IVMA 3F6VA 2FMLA 4Y13A 1F4KA 5L3DA 3PFIA 3E5QA 2OD5A 5LGUA 1UB9A 2DT5A 2M1BA 1T39A 3ZMTA 3SZPA 3NQOA 5ILUA 3SHFA 1MJ9A 3F8BA 2PG4A 3FZVA 4UVCA 3E6MA 5CVIA 4PCQA 1FYMA 3LQQA 1BI3A 3GFMA 2ESNA 1BN5A 3ZP5A 2EFQA 3GEZA 3LSTA 2DQLA 2ZKZA 2H6BA 1WQ2A 2FF4A 3L2CA 2K4JA 1FNNA 2DK8A 3TGNA 3ULQB 2PI0A 2VT2A 1QZZA 2YU3A 1D8KA 1MJAA 2P5VA 3GFJA 5DD8A 5K5QA 4A12A 2QYOA 3KE2A 1IXCA 4YIIA 4U0VA 4G6QA 3I64A 3RJPA 1KA8A 1OYYA 4LFUA 5HOOA 3WTYC 4ZYDA 3HSEA 3SXYA 2M87A 5ED4A 1BM9A 1J2XA 1BI0A 5ICCA 2QQ9A 4IPAA 4KFCA 2YPRA 2Z5UA 3MZYA 4FHTA 3WU1B 4HA8A 2PN6A 4UNOA 3KZYA 3I71A 2ESHA 2MBFA 1Z7UA 3VB2A 5D6FA 3CLOA 4LLGF 4MEYF 3C1DA 3WTXC 2L3DA 2Z33A 2GIVA 5EEGA 2MA3A 3I54A 2A3SA 4GXOA 3TQNA 4RAYA 3LWFA 5DEQA 5E8GA 2RC4A 2YSRA 2LSOA 1Z6RA 3FWEA 2DU9A 1I1SA 4A6DA 1P92A 6PAXA 4RB1A 1XGOA 1W5SA 3F72A 1U2WA 4EM0B 4Q47A 1SD5A 1ZN2A 3JAMK 1QGPA 3WU0A 3VEPA 3RIRA 2DTRA 4L9TA 4LK0F 2ZCWA 3PQKA 2O3FA 1ZH5A 3GVAA 3ML6A 2CGPA 5LHIA 2KRFA 4EMSA 3DFGA 1TQMA 3WGIA 1UCRA 2COMA 1XSXA 1VTNC 3KP6A 3KLNA 2DO7A 5K1YA 3I59B 1MDMB 1J75A 3WTWC 4Q5SF 1BIBA 4U7DA 2FOKA 3W6JB 1GXQA 2L4MA 4AIJA 2CWEA 1DP7P 2KJBA 1XSVA 2LF7A 4HV6A 4CYDA 1ZGAA 1R36A 4ZYEA 1SD6A 1CF7B 4GGGA 3LA2A 4N9HA 1OYWA 2UXXA 3KEOA 4AIKA 4XSZF 2PFBA 1IXSB 5L3CA 4YG2F 2DJWA 3M8FA 3NEUA 3U9GA 4U88A 1J59A 3C3WA 3Q9SA 2QENA 2YX7A 5DDGA 3ELKA 4KIFA 2DW4A 2VT3A 3C18A 4ASNA 2OQRA 4G6DA 1T2KA 4NQWA 2L4AA 2KIFA 3TO9A 3O6BB 2V1DA 5K5RA 2VBXA 5BS6A 1WKMA 2IPQX 1R00A 1O3TA 5L3BA 1TNTA 2VN2A 4U0YA 4L0YB 2GXGA 4KDPA 2XVCA 1HBXG 1GVJA 1O3RA 1USTA 5FD6A 1S8NA 1ZARA 3LFKA 4RB0A 1SD7A 1YS6A 2HQRA 5KVRA 3TO6A 2OZ6A 3GXOA 4H0EA 3QPTA 4RGXA 2NAZA 1LDDA 2NNNA 4BNCA 4O5VA 4L5IA 3QOPA 4M9XA 1IN6A 2DK5A 2O8XA 3ZMUA 3ZMSA 5E18F 1LVAA 3H92A 1J9IA 2KIUA 3V7CA 1FYLA 1HW2A 1WWXA 2HEOA 1Z6TA 2B0LA 4HDUA 5E20A 3L9FA 1RZ4A 3G3ZA 3EQLF 2BBYA 1I27A 3TKYA 5LLQA 5FLXK 1YG2A 4WX9A 1Z05A 4KMFA 2VE8A 4M71A 4OIQF 2KIMA 4OOIA 5HDNA 1YQAA 3ISPA 1FY7A 3TOAA 2O0YA 3K2ZA 1ZRFA 1WRJA 3E6CC 3SQNA 2ZO4A 4IHTA 3I53A 3V8JA 4HDVA 1KQ9A 1PP8F 5TRDA 4HF1A 1R1VA 4ESJA 1XN7A 1G3YA 1KU7A 2LF8A 2G9WA 1S3JA 3E5UA 1QNTA 5DCMA 3TDUC 2NYXA 3WGGA 5D4SA 1ZG5A 3MZHA 2D2WA 4L9VA 3K1PA 1XGNA 4GYGA 1SMYF 1IXRC 3EUHA 4KN4X 5JHUA 3FX3A 4F7ZA 4ENNA 2RVCA 3O3KA 1WSUA 1SAXA 4S04A 3M9AA 4RGSA 4M6XA 2ZMEB 4I98B 2HQNA 3HHGA 2FNPA 5CVJA 2F5DA 4HQEA 1B59A 1Z9CA 2VBWA 2FU4A 2L02A 5D4RA 5A2QK 1BI1A 3FM5A 4RS8A 3Q9VA 1FBQA 5CJ9A 3BJAA 1KYWA 2KJCA 2V1UA 3FHZA 1USSA 5EEHA 2VE9A 1YW8A 3FXRA 2EFNA 1I1GA 1SD4A 1MKMA 2ISZA 2HYGD 1G3WA 3D0SA 1B9NA 4WXCA 3E97A 2WWYA 2D45A 2NS0A 4AIHA 2FMYA 2EK5A 5LRSA 3R6SA 1P4XA 1MD0A 3M1EA 2QLZA 2RDPA 5LRRA 2VXZA 4RAZA 2G7HA 3V7SA 3ROUA 2QBYA 3BDDA 5IT9K 2EA2A 1QO0D 5LHHA 3R60A 3BZ6A 2Q0OA 2O6GE 3P7NA 4QLCU 1R58A 2FNAA 3E3VA 5ICGA 1J0RA 3LA3A 3WTSC 3IWFA 3RPUA 1HSJA 4Y15A 5LHGA 4MEXF 2CVIA 2VONA 4KIBA 3NRVA 1ZRCA 5HLGA 2JRTA 4ESBA 2JTVA 4DNCA 5D8LB 2PQ8A 3FMQA 2A07F 5F1RA 4UHTA 1FPQA 1P2FA 2QQAA 1G6NA 3M8EA 3FMRA 1IN7A 1FWZA 1XGSA 3WE3A 4LG0B 1W7PD 3QAHA 4L9JA 1ZG3A 5FB2A 1L0OC 1FBSA 5FFXA 4MTDA 3DPLC 4BYYA 1BC8C 5J8CA 3MFKA 1STZA 3BOQA 1ON1A 4IRGA 1MJBA 1X3UA 5ILSA 4I02A 3JAMZ 2XUBA 3K69A 1AWCA 4UUVA 4M72A 1FSEA 2EFPA 1Q1HA 1G3SA 5CVVA 1O57A 2IA2A 3CUQB 5D5UB 3CDHA 1BIAA 5HS7A 2JPBA 1GHCA 4OIOF 4HW0A 2FE3A 3JTGA 3BJ6A 2PLYA 4LJZF 1ONVA 2Q2EA 2MLGA 2VOPA 3VODA 4Z2YA 1YW9A 2FQ3A 4ETSA 1RIOH 2JPCA 4JBAA 4HF2A 5FFZA 2XRNA 2XAHA 2X0LA 2IA1A 2BGCA 5AIQA 3ERED 2Z9OA 4KN7X 2DQRA 4CDGA 4M9ZA 5JVTA 3HRTA 3HUGA 1P4WA 3E6BA 2IW5A 3R61A 2EV6A 2GXBA 4LB5A 2JSCA 1R22A 4R79A 3OV8A 4I01A 1FT9A 3CJNA 5J8FA 4AVPA 2V79A 4HBLA 2IA0A 1I6XA 2IP2A 3FF5A 4CGZA 4K2EA 2F5FA 3KP2A 3ZPLA 1SFXA 4XBFA 2E1CA 1FX7A 1HKQA 3V7RA 2VC0A 1EH7A 2UWMA 3IRRA 5JR3A 2STWA 1IRFA 2QQBA 4LB6B 3F8CA 4CXFA 3RKYA 2ADUA 2ZFWA 3HTSB 4ZZLA 1U78A 2HYFA 4RGUA 3I5UA 2PJPA 1RUOA 1JXSA 3I59A 3IL2A 3HSRA 1MDMA 2HFHA 1O7LA 1J5YA 4ZH4F 1A04A 1C0WA 2XAGA 3MQ0A 3K1NA 2CG4A 2PMUA 3RYRA 2XGXA 4M73A 5CYVA 4KIGA 3L7WA 1QZYA 2PMHA 3I0TA 3F23A 4L0ZB 4ENKA 3D5LA 4MQVA 2ETHA 1KU2A 2M5WA 2JZYA 2DAOA 4HZFA 1PP7U 2Z3YA 4XRFA 1YS7A 3JSOA 2XASA 2L01A 5KK1A 1HKTA 3EYYA 1O7FA 1W5TA 1ZREA 1TQIA 2OZUA 1TQPA 2R7FA 1FOKA 1LNWA 4BXUA 4A0YA 1LJ9A 4I2OA 4A5MA 5ICEA 1S29A 2JSXA 1YFHA 4GYIA 5E8IA 3AAFA 4HLYA 2ZBCA 4I7HA 2AXLA 1B4AA 5FLXZ 5J6XA 1Z1DA 2FRHA 1KQ8A 2G7UA 4R8HA 2VOOA 1SMTA 4Q48A 4G7OF 5LEJA 4G94A 3GZ6A 3T0YA 3QP6A 2CQKA 3RKWA 3J80K 3K1MA 4EJOA 3REOA 1R1UA 3DPTA 2F5EA 3HIFA 1WI9A 2BEOA 1DPUA 4E70A 1YLFA 2M30A 1D3YA 1LEAA 1S7AA 2WC2A 4UXNA 1MGTA 4HF0A 1E2XA 1EH8A 2RGVA 2WV0A 2E1NA 3F21A 4NHJA 2ACJA 5IT3A 2O03A 4UV8A 2H6CA 3KP4A 5H6QA 2MH2A 5E1XA 4AWXB 2GQQA 3WTTC 3ZN1A 2K4BA 1KU9A 1IZ1A 4MQ9F 3EYIA 4YFNF 4ZZDA 4BQAA 1ULYA 1OKRA 1HSTA 4A2UA 1XMKA 4BHBA 4OINF 4FT8A 1U5TB 3BPXA 4GCVA 1XD7A 5HLHA 1BJAA 2R7DA 1OMIA 3BP8A 4UVAA 4WWCA 1D5VA 5A2QZ 2H27A 2DLLA 1BC7C 4EJWA 4P5OA 5BQTA 1F1ZA 4KT5C 4ENMA 1DUXC 3VOEA 3P9IA 1U8RA 2ZNZA 1D8JA 1LDJA 4HV5A 1TBXA 4OMYA 4IRIA 3T1BA 4LD5A 4O3MA 2PEXA 2HKXA 2VBZA 2V1XA 5HVQC 2O61A 3WG9A 3LA7A 4LMYA 2A6EF 3M7GA 2YX4A 3FXQA 3VFZA 3LAPA 3KP7A 3JTHA 2DBBA 1KU3A 4A0XA 3J81Z 4CICA 3OOPA 4G7ZF 2HWVA 1EV7A 3B02A 1G4DA 1W4MA 5BPIA 4M74A 4YFKF 1OPCA 5ILVA 3FM3A 3V8LA 4JK1X 5IT9Z 5JI6A 1K78B 4LGWA 1TW2A 3GX4X 4HYEA 1OYIA 3K0LA 4MGRA 2PBIA 3C7JA 1XGMA 3IKTA 3BJOA 3BROA 3WODF 4I09A 3ECOA 2E7XA 1B1BA 5DUKA 2WTEA 1IN8A 5DCFA 2LKPA 4KNYA 2XV4S 1GXPA 2KKOA 3MWMA 1JHFA 3QU3A 1V4RA 4OIRF 2A68F 2V9VA 5HDGA 1K6OA 3ZN0A 3JSPA 1IAWA 1W7PB 5CVRA 3F8NA 2HOEA 2D1VA 5DYMA 3L09A 3WTZA 2FBIA 3WTVC 1FP1D 1G3TA 1T98A 4XLPF 2GAUA 2OAZA 3B73A 3T8RA 3U1DA 3J81K 1R23A 3E6DA 4EGZA 1ZLJA 3HOTA 1O3QA 4HLXA 5JFRA 3KP5A 1H0MA 2GZWA 1ZYRF 4XSXF 2P6SA 2X4HA 1P6RA 3HOSA 3F22A 3V4GA 4WF2A 1IW7F 2MD5A 2QVOA 4P9FA 1PUEE 5CLSA 5LEKA 3ECHA 1LB2A 3BWGA 4I0BA 2Z99A 4N0BA 4IHSA 1BI2A 2TDXA 1ON2A 1RI7A 4HX7A 2DI3A 4LLNA 1OR7A 4LK1F 4HX8A 5BMZA 3DQVC 4P9UA 3RKXA 4BAYA 1U5TC 2CW0F 4WXHA 1LEBA 1TW3A 4BHCA 3FMSA 1LDKB 1HW5A 3HTUA 3P9KA 1S6LA 2BE5F 3KFWX 4OU0A 1PDNC 2HR3A 2NNYA 5CVUA 4WK8F 2EV5A 3FXUA 4KA4A 3E5XA 4HX4A 1HKSA 4IVNA 4OIPF 5FGMA 1XDUA 2DFIA 3W6KB 5HDKA 3N97A 1FP2A 4LG0A 4UVBA 3CO7C 1ZLKA 2XIGA 3IWZA 2CSOA 3O2PE 2AS5F 1R5HA 2EFOA 2GA2A 2ZBKA 5FD5A 3RTRA
chains in the Genus database with same CATH superfamily
1M1EB 1PYTA 4HHUA 1L3TA 2HAIA 4RGRA 4C0BA 4HH0A 3ESWB 1B72B 2V6CA 1GXUA 2B6AB 3JREA 5DJBA 3RKQA 2HBYB 2H09A 4CLZA 4EBEA 3M8SA 4DW6A 1T3NA 2XHWA 2IGNA 1T6SA 4A8WA 4UOHA 3LP1B 3J7Z5 1T38A 2B8PA 1SFUA 3FGVA 4G9YA 3RPUD 1DDNA 4ZJZA 4UQGA 1S48A 2V7FA 5F64A 5LXRA 2IPOB 1RWPB 3G73A 4CTAB 1VC5A 2XNRA 3KLFB 3D5SC 3CO6C 1XCVA 3QQAA 2ZOFA 2XB2D 5AXMA 2IS2A 4QWEA 2X6XA 1SUQA 3S93A 5LJ5Y 4NMXA 4M3EA 3QQCD 3RQIA 1WELA 1OCCH 2D1CA 4L3KA 5E1WA 4XLCA 1WOSA 3GF2A 3F73A 2M88A 2EPFA 4BDPA 1I50J 1Z91A 1MBGA 1ZYQA 2P8TA 5E7OB 3IA0A 2MKIA 1U6GA 3R27A 1VQ8I 4F0KA 3HK2A 2G0JA 3PCOB 1D1CA 3H9GA 1XIQA 4A6EA 1JNZB 1W7WA 2B9SA 2OPSB 1UJ4A 3PDNA 1U09A 2K27A 1JGGA 4YB1P 2IRXA 2K2PA 5KFKA 1KVKA 2J9DA 4CO4A 1YJUA 2M70A 2VPXB 4I99C 2RNJA 3OBIA 5C2CA 1YJTA 1LFBA 3TDZC 2JC0A 3RBZA 1R6YA 2B63J 3BR5A 1JKPC 4OZ1A 1N8RT 2OBPA 1C0TA 4YR3A 2A6OA 3HFKA 5LBQA 4IXAA 2PGCA 3NMAA 1PO6A 1EETA 3DWLE 4M5MA 1J09A 2HKOA 4O6JA 5D4OA 4NXNF 3IO1A 3M6WA 3PYGA 2NPFA 3RB0A 5A8RB 3Q0VA 1VQ4S 1NHUA 2Y30A 4OJGA 1RLDA 4RKUC 2GA7A 1GVDA 3S7RA 1U0HB 1X4DA 3PHEA 3H42A 1WDDA 2HWHA 2ZHBA 1UW4A 1KYZA 4LOCA 3M1VA 2HRYA 3ABUA 4DOZA 1VGYA 2RF2B 5IWAF 5L9XA 2E19A 3RYPA 1OWXA 4RU2A 1S76D 4KICA 4L9NA 1VYAA 2UUAF 3M7VA 1YW7A 3I56S 2RN7A 3H5SA 4X0GA 1U7LA 3I5CA 2NREA 1BBYA 4BH9A 4EJVA 5KFIA 1OQYA 3BN7A 4ILMA 2K1RB 4NLSA 3IRQA 5ETSA 1T94A 2ELHA 2CA9A 1RNLA 2GMJA 4MAKA 2B9XA 1FRHA 1IRGA 4PYAA 2AKWB 2CJXB 4D3HA 1MBEA 1Z7LA 1TL8A 5B1AH 4FDFA 4EU0A 3DGPB 2ALYB 2BANB 2XZWA 2ROPA 3EGZA 4HSRA 2YR2A 4JP0A 1IN4A 2IBDA 4YR0A 1KZHA 4UF4A 5H20A 3G86A 3AFHA 2HTSA 2VG5A 4ZVHA 2UUBF 4DUTA 4PXEA 2HTJA 2V8HA 3DM2B 3CMAS 3GR0A 2EINH 4P96A 1SQEA 2OJED 4AYBD 1TWGJ 3DHXA 2HS5A 5TGTA 2ZC3A 4ECYA 3DI6A 1FNMA 3VGTA 1SJ4P 4C2UA 1HI1A 4FYWB 4B9UA 3DYAB 1LQ9A 1BY9A 2BE9B 2VFSA 2F2EA 5CXTA 2HZAA 4PGHA 4FPRA 4G8XA 1IN5A 2M3DA 2W24A 2CQQA 1IBKF 4QWDA 5D8KB 4GFBA 2JWTA 2R93J 3KLOA 2K9SA 4UQTA 4ELVA 5KFWA 2HBZB 4X62J 3CZ6A 3EETA 5A0YB 2R3SA 2RE1A 2HHTA 1XNQJ 3ZMDA 1P27B 4GC7A 2FGCA 2RT3A 1X60A 1S9GA 4D1QA 5ERIA 3IXQA 4CHUA 2WB1N 5KFTA 1V54H 3S1MJ 3CCES 1T03B 2EV0A 1GTEA 1QRYA 2KXFA 2IS1A 3GQCA 3TAQA 3LP2B 3OR1B 4CM0A 4WTYA 3BPDA 2D1HA 3D66A 2Y69H 4JP8A 4P55A 1KRPA 2HSEB 1HXDA 8ATCB 4Q8EA 1UHMA 5L3EA 1HI0P 3KYCB 4AD9A 3CCMI 2UXDF 3P5JA 3W2WB 4DV1J 3P49B 1E17A 2YKNB 1AUSL 4J9VA 3HHLB 2IA6A 3V2UC 3FDYA 3LALA 4RUBA 5ITHA 1NHAA 1S7OA 5LGNA 4L18B 4WK1A 1YOVB 4NRTA 3CCSS 1IG7A 2GGPB 1XN9A 2MSTA 2E36A 3PL8A 1F0XA 3W1YC 3COAC 1SH3A 4KUMA 2FBHA 4KY3A 2B7BB 3NOGA 4TVAB 3QSYB 3MCSA 4KT0C 3LWLA 3JW4A 1H8AC 1JUPA 2FUG9 4F4XA 3CCLI 2C2RA 2L48A 3J81U 3KIOA 1ACIA 5DGBA 4A8SA 2HWIA 1ZELA 3HM5A 4UT4A 2GAGC 2IHR1 3BKUA 1X5OA 5K8NA 1YLXA 7FD1A 3I82A 1FVQA 2ZXWH 2V0NA 2AHOB 4WU3A 3MEXA 2DR9A 4X4NA 3K2AA 1VHIA 3KNGA 2OEKA 4JI0F 4S05A 4L76A 4ED0A 4F55A 3BG5A 3MAJA 3CVKA 1S99A 1O8BA 3F8MA 4D0PA 2JC1A 2GWRA 3OL6A 3W3CA 1D9DA 1PJ7A 5B0BA 4KYWA 3FKIJ 3WC2A 2IJLA 3ONQA 4OMZA 3FBNB 2JX2A 1E0EA 3AH6A 4ZOSA 1K78A 3WTUC 2JJ7A 4RWXA 2PFFB 2CS3A 3L7PA 3JXOA 1QE1B 3U27A 4B9NA 2Y75A 3KEQA 2OQGA 4XLNF 3MUVP 5L39A 3OWTA 3KHHA 1UWBB 4M9SA 1RT1B 3JSYA 2B7EA 3DEUA 4I64A 1YDLA 2LP4A 3KX2A 2BACA 3BV8A 1FT8A 1T0TV 1CS4B 3AB2B 2X6WA 4YFXF 1ETYA 4RJVA 1R0AA 1JXVA 4FF3A 2ELJA 3MMBB 4PPDA 4E98A 2OA4A 1RLCL 4DPWA 2AGPA 2L7KA 4BGDA 4ZKAA 1IM4A 2MGQA 2J7UA 3FEXB 1IBMJ 4JQFA 3VDXA 4NB5A 3ZGKA 2LLKA 4N8OA 1UW9A 2HZDA 2OTJI 3IG1A 2EWNA 4OJ1A 5IC6B 3J81j 1JJ4A 2GIRA 2P7CB 2XMAA 4V1Ak 1QVFR 7AT1B 4DV5F 1C1CA 3HHHA 1PC4A 3GLXA 4U0WA 3G4SS 2COBA 2CVEA 4USUA 1ZRDA 2XAFA 3N5BA 2E1MB 4RW7A 2K7LA 2GOXB 2FEZA 4JI7J 3BSCA 2CFXA 3A8EA 2QLFB 2P9GA 2QYGA 3F6VA 1ERDA 3ZXSA 4K0KJ 3FCVA 4EUVA 2DOFA 2FMLA 3LSRA 3Q83A 5DM7F 3Q0WA 5RUBA 2HBQB 3PFIA 2OD5A 4ED1A 3VYSB 3BH6B 4U7UK 3ZTQA 5LT5A 3MN2A 1UB9A 2N4CA 4DHVA 1APSA 4J90A 4FKYA 4HHJA 4ZDOA 1HBMB 3O5TB 5ILUA 2FJBB 4XAKA 4LFBJ 3OVAA 2E66A 4FISA 3EPIA 4AL6A 1UMQA 4NCGB 3MEEA 2DPJA 1YI2I 1RETA 2MJNA 2VJIA 4ZJLA 3VYRB 1W0TA 3QOEA 1UG0A 1WJDA 1BGXT 1VQ6S 2MLXA 5ETQA 1TUVA 3DGVA 2CNOB 1NK9A 3HPHA 3GTJJ 3TVZA 2GVDB 3GILA 3PSIA 3LSTA 2ZKZA 1QU3A 1NKEA 4DS4A 5KFQA 2DK8A 2PI0A 3GFJA 1S49A 1YJ9I 4C8LA 5K5QA 2BA9A 4GVBB 2LEPA 3RB4A 2FDNA 4YB5A 2FJVA 1DQAA 4AC0A 3WX4A 5I3PA 5AXKA 4IO9F 3CJSA 4PQUB 2ZM6J 1OYYA 5HOOA 3WTYC 5HL7Q 3TJAA 5GAHU 4A3EJ 3O3LA 2IGOA 2M7AA 2E9RX 1J2XA 1BI0A 2QQ9A 3N9UC 2XGPA 1KONA 2YPRA 4DR3J 1LWEA 4AL7A 1AW0A 3SDGA 4UNOA 2KU7A 3KZYA 4ZVTB 2VFVA 5IOLA 3HUGB 1S1TB 3PEJA 3QNWB 3P4UB 2VV5A 5D6FA 3G8SA 1Z4UA 2TCTA 4AXIA 1FKPA 3WTXC 1JXEA 4DV6F 3MZ8A 5EEGA 1K47A 2A3SA 4GXOA 3EYZA 2RKIB 4OYMA 4NXMF 1DY3A 5EG0A 1ORKA 2RC4A 1XJWB 2YSRA 2VUMJ 4PJNA 3VQSA 4G1QB 1Z6RA 1HMVA 2XMKA 2OSQA 4JI3F 2DU9A 5KT3A 3QLHB 5HVHA 3OL9A 1ZBTA 3IP0A 5DDQC 5E3NA 3TYTA 4RB1A 4J19A 2QCOA 1PJ6A 1N36J 1IO2A 4QPOA 4ZDLA 3MM9A 1U2WA 5B7WA 4Q47A 4PYDA 1SD5A 3D1HA 1QGPA 3HPOA 3VEPA 1PGZA 3TP0A 4NBQA 3BR9A 2FC8A 5FLMJ 4LK0F 2ZCWA 2O3FA 3H9QA 3PX4A 3GVAA 3S32A 3NARA 1FHTA 2HVEA 4BWMA 5EZGA 1RT3A 4RLEA 1SKWA 3WGIA 3L3CA 1ACMB 3A3PB 1G59A 1IC8A 1VTNC 2AX1A 3GJTB 1NJIT 1KNZA 3S3OA 1R8CA 4DLGA 2JA7J 1H2TZ 2J6TA 3PUBA 1MDMB 5T41A 2R2UA 5HMXA 1OQ6A 1LW0B 2MZJA 4Q5SF 1TZ0A 4NX9A 4U7DA 4BE0A 2NOJB 1TAQA 1FXLA 4PJ0C 4ZIVA 2CWEA 1IKWA 2WVBA 4F3OA 3GFHA 3FQKA 1YIJS 3Q8PB 2KJBA 1XSVA 3IRWP 2JOQA 4CI0B 4W90B 5EGYA 3P8BB 1OQ3A 1Q81T 4IRDA 3MM5B 5GTIC 1FDNA 2HPUA 4ZYEA 1RPWA 1RT5B 3EUAA 1KQKA 4CYCA 1CF7B 4LF8F 1CJKB 3ZQQA 2AYMA 4AIKA 3CT9A 3KPHA 2VD3A 4XSZF 2PFBA 3W66A 3NEUA 1F9FA 4QPXA 2IRUA 2YWGA 1VQOI 4U88A 1J59A 4F4WA 3GIMA 2QENA 2YX7A 5DDGA 1DBDA 1S1XA 2SXLA 4I2QA 4URGA 2IM3A 2CNLB 3CD6S 2VT3A 1ZZFA 2L9VA 4M3DA 4X62F 1RT7B 2OQRA 2ZH4A 3NWGA 4NQWA 5E3OA 1H88C 1X8DA 1WWHA 1PUFA 2J76E 1NLKL 4MKAA 3SBMA 4IFVA 4KHRA 1OSDA 3H90A 3G2XA 2VJUA 2YVSA 1WI6A 3OTBA 3GYXB 2XPWA 2FZCB 5KFCA 1R00A 2YUSA 1O3TA 1MLAA 1JJ2R 2KB2A 2M5YA 1RWNB 4KSEB 4WU2A 3OUYA 3FBFA 5L3BA 2DDAA 1MN7A 9RUBA 5D77A 1S0OA 1GMWD 4XDDA 3PYEA 2YNFA 1K1QA 2HDWA 1PBAA 2Y2ZA 4L0YB 4XPEA 1S0MA 3FFIB 4DJBA 4I7FA 3MCOA 1AZSB 3CCUS 1EP4A 3DRSA 1F2GA 3TX0A 2Y1RI 4B9SA 1JLCB 1NZ8A 2AYEA 1RKIA 3BR2A 1S8NA 2QA4G 4ZYAA 4RB0A 3GU0A 1LWFB 4M3BA 4XR6A 3FVYA 3QPTA 3ZTPA 2NAZA 2WAQA 4V19K 3WX8A 2FVCA 2WHOA 4BNCA 3PO3J 1NUEA 4LBPA 1LUJB 2PIIA 4PXBA 4M9XA 2ZZMA 4M5LA 3QGPA 4USVA 2AD9A 3CO0P 4USMA 2O8XA 1ZM9A 4KISA 3H9JA 3ZMSA 3ILJA 3H92A 5E3MA 4W4MA 2AJQA 4UZCA 4DF4A 1FJCA 3B82A 4YB6A 3M2VA 3OYDA 1POGA 1GXLA 3KDNA 3SQGA 3CCJI 4M5NA 3EM1A 5D4NA 3H7HB 5IV4A 1KLMA 1YG2A 1I94J 3DMJA 1TKTA 2G1HA 3DOLA 5LM7E 4LF9F 4PZVA 3GJSB 1X4OA 3MPWA 3TOAA 4CCLA 4USKA 5EGOA 3SQNA 4IHTA 2G2ZA 1JX4A 2HVSA 1TV6B 1KQ9A 2DMQA 1R8AA 3VR1A 3AD9C 2W48A 4OX9F 3W64A 1T11A 1IKYA 4ESJA 3DHWC 3FCWA 1DTQA 2C1EB 3KJVA 2G9WA 2J6SA 3CC4I 2H51B 3E5UA 4BC9A 2CZVC 5DCMA 2MFZA 2EZHA 2AZ1A 1NPPA 1ZG5A 2TRTA 4NL5A 4EO8A 1S7IA 3PYDA 4L9VA 5KFEA 4TU8A 1K4TA 1XR5A 1IBMF 1XGNA 2XYHB 4CYUB 1SMYF 5KFUA 1N25A 4LVOP 3MMYB 2R5YA 4U8YA 2ZXIA 3A02A 3DLKA 2NUHA 3O6QA 4YQWA 2BYCA 5L46A 2JK3A 1CC8A 3O3KA 2J9DE 2DXIA 2C3PA 2CWKA 4FF2A 4RGSA 4LIRA 4K8RA 2PMWA 1VQLI 4A8FA 3PX0A 1JB0C 3HHGA 1FEEA 3BG9A 3FCHA 2ZH1A 3OLBA 5CVJA 4NYZA 4OZ3A 4BJ6C 2DNPA 3HVRA 2XS5A 1UJ6A 1WORA 4JI7F 2L02A 1BI1A 5KG2A 5JXSA 1VK8A 2UUTA 5F8HA 5IQQA 1CQTA 1KFSA 1FBQA 1Q79A 4M5IA 4B3MF 2KJCA 3IAM2 2R7QA 2IVFB 2J5AA 3PUFA 4BKXA 1Z2ZA 2G0EA 1USSA 1SKRA 2ZHOA 5CABA 5CYMA 1JI8A 3QFHA 3FXRA 4F52A 2KKHA 3W9HA 1R43A 4K5RA 1QSYA 3D0SA 1IV8A 1D09B 4DV4F 4X4OA 2WWYA 2D45A 4DV7J 3Q8SB 2B3TB 3GLJA 3M9NB 2U1AA 5B66C 4ZPBA 2DA5A 2FMYA 2BQ3A 4J9LA 2W9BA 4A3JJ 1TL1B 2EK5A 4LFBF 2XB0X 4Y2AA 1FMWA 3BR1A 4C2MA 2Q1ZB 2BQUA 2H9ZA 1LK7A 2RDPA 3G8TA 2JMWA 4RAZA 1S6QA 4NLPA 1H89C 2HMIA 4F3QA 4GC6A 2QBYA 1AA7A 2EA2A 5LHHA 3HJFA 2Q0OA 3IUOA 5IYDJ 1VQ8S 4LF6F 1V5FA 2R5ZB 1MWQA 1S12A 5F9LA 4PG4A 2XPUA 2XZDB 1I3OB 3W7BA 5FIIA 4OJHA 1J0RA 4WBFA 2F1FA 1SIWB 2GJFA 2NVUB 2HQ3A 4Y15A 2XSFA 3PG9A 3PRVA 2QKLB 1GV5A 1NJWA 2DKOB 4N4NB 4DBRA 2YWFA 2QRRA 5ETNA 3QAUA 2LG4A 5LSRA 1A5JA 3KK3B 2VJVA 4W97A 5HLGA 4LRFA 3S15J 2ZM6F 1DURA 2XGDA 3QPIA 2QV6A 3D28A 1RTZA 1ZM4A 2LFBA 2F8EX 1S9HA 2DGOA 4ETXA 3VHQA 2B0GA 2O5DA 2F6CA 2Y0BB 1RKTA 1T9WA 4NYOA 1VBXA 4FBUA 4DR3F 1SJ3P 3KWMA 2QE5A 2A18A 1NK5A 4ECUA 1IN7A 4CNYA 1FTRA 4L9JA 4UUSB 5AJ3J 1T7PA 3M6VA 2L41A 3BCBA 4NMLA 1BQMA 3AY0A 2ZOGA 3UD3P 4Y3CA 4IRGA 3MM6A 2F40A 4I2PB 2GX8A 2B9WA 3LSPA 2DNMA 1AWCA 5D0GA 4M72A 3J7ZI 1FSEA 3J7YU 5M2UA 3KK2B 2X1AA 2I2YA 5EF6A 4OZLA 3LUYA 1RXOB 5CVVA 4OZ5A 3BQZA 3HKZA 1HNZJ 3LAMA 1N36F 2CQBA 4CO5A 4IOCQ 4A48A 4IFYB 2EC0A 3KLGB 1W2IA 4BXFA 2D74B 4B4CA 4HW0A 2FE3A 3JTGA 2C2NA 1ZA2B 3BJ6A 1BWEA 3VF0B 1JLAA 4LJZF 3I31A 3WIVA 2RQMA 1ONVA 2J8SA 2Q2EA 4YUDA 2BMBA 2XCAA 2MLGA 4HDHA 2JWNA 2JHEA 5HANA 3VODA 3BO3A 1HNWF 4B3RF 4ETSA 4KRWA 2JPCA 1P9YA 2HOAA 1L5UA 3NGKA 1SUQB 2OFHX 2OPQA 5B0AA 2X1CA 3O44A 3R1LA 1R71A 3L95X 3T5HA 3SEQA 5EYRA 5IM0A 3OOUA 2WSEC 3CJ4A 2HNHA 2NS1B 1R31A 4X4UA 2DMNA 2IW5A 1OY6A 3U1NA 1APLC 1VJQA 1FXDA 2GXBA 3D1NI 4USJC 3FZ2A 1R22A 2O67A 5A76A 4IOAF 1FT9A 1BA5A 3LSGA 5J8FA 4BY1J 2JVRA 4AVPA 3GSIA 3OXGA 3HSDA 1D1BA 2N8GA 5EDNA 1WACA 4HBLA 1BUXA 3GCXP 4J9KA 2PI4A 5FDLA 2F8MA 4CGZA 2QFIA 3GTLJ 4FYXB 2F5FA 3KP2A 1G2EA 3K6GA 1GX6A 3K10A 2BZTA 1HKQA 2VC0A 1EH7A 1IDZA 4HTIA 1DTTA 1PCAA 4WF9Q 2UWMA 1YHQS 4J01A 3S01A 1TT5B 1ZA1B 2I10A 5JR3A 4LREA 2STWA 2LYCA 4HEA2 2YKMA 1LXJA 2QF7A 3RKYA 1L3KA 2ADUA 2UUZA 2E1MC 3TRGA 4XIUA 4ZCKA 1EETB 1KQGB 2ZFWA 1YBUA 4MO7A 1KOOA 1U78A 3ITHA 1I3QJ 2HVQA 3I5UA 3CCMS 1RUOA 4C9DA 1F3FA 1JXSA 1HW9A 2ZH3A 2HAFA 1RABB 2FJEB 3PFYA 2A2CA 1J5YA 4UY85 4XKVA 1OR7C 3MQ0A 1D8YA 1Z3XA 1I51B 2CG4A 3M1VB 3M32A 2XGXA 3GSDA 5CYVA 1G8XA 4WIQA 2IEKA 2UXCJ 1FNXH 3S1TA 3Q8VA 1LXNA 3HD1A 2XDVA 1UZHA 2N82B 4F2SA 2EK1A 3MPDA 3V81B 1BL0A 4IOBA 2DAOA 3CCLS 1K44A 4HZFA 5C42B 2KVQE 2HVHA 2PD1A 2XASA 2PA3A 2DH9A 3RRHA 2L01A 5CZVA 3TUZC 2Z2ZA 3WQPA 2LDIA 1KFDA 3V6KA 1WJEA 3OXLA 1TQPA 1R4NB 2PI5A 1XERA 1LNWA 2VLAA 1QPIA 1TMMA 4LQ3A 4F93B 4A5MA 1FOYA 4M3FA 3BDEA 1GT8A 1SC4B 1YFHA 4NI2A 4RX6A 4A8YA 5U47A 4DL5A 2VG5B 4F7VA 1S5LC 5HP1B 1WHXA 3RRGA 4B08A 1V3RA 3DRYA 4GKJJ 1OLTA 2CMPA 3RW7A 2VOOA 1SMTA 3BGLA 2VIHA 5EWEA 1JUMA 4G1PA 4PJJA 4B9VA 4PPZA 3QP6A 3OYNA 3RKWA 5DG8A 1I94F 4MK8A 1WNEA 3REOA 3V42A 2KLOA 1PG5B 1GMVA 1Z21A 1DPUA 2M30A 4USHA 1QY7A 5J1RA 2BZ2A 2HFZA 4HLBA 1XPXA 4Y4RA 1H0HB 1HWIA 3GIIA 2UUCF 3CMEI 4MMOA 5GP9A 1P9QC 3M2RA 3PJXA 1VQKI 1XK8A 4XN0A 2VPRA 4EWTA 3KP4A 2BOLA 4BDZA 1XR7A 2QGFB 3QJPA 3SYTA 1R49A 4JYKA 3R2DJ 3JYTA 1AHDP 2UV8A 2OTJS 2BVLA 3PNYA 1QVTA 1G4CA 1LK5A 4CLKA 1ULYA 1DJ0A 4ZCMA 3EXCX 3QAEA 4ZVUB 2NXEA 1R8BA 1EF4A 1XD7A 3V6DB 1LWCA 1BJAA 4CO0A 2X3DA 1M1GA 4U7UD 4DR5J 2WA0A 1FNOA 2ZH8A 4WWCA 2VG7A 2CV1A 3TQ1A 1D5VA 2PT0A 5A2QZ 2Z0GA 2DLLA 3KKFA 4P5OA 1CJTB 3CNQP 4GKKJ 4KT5C 3OJUA 1GH8A 3ZOBA 3G6YA 1U8RA 2MLYA 3R5GA 5KT7A 3UN3A 2Y9HA 4HV5A 2GV1A 4OMYA 5K7ZA 1W25A 1NMEB 2XF6A 3KG1A 2XCPA 3T1BA 2K9MA 2ZJPF 2I0XA 1TKZA 3PM9A 4W98A 4E7ZA 3C6TA 1Y0HA 3H5XA 5KOWA 3CLQA 2A6EF 1B7YB 1WC1A 2YX4A 3I55I 3BG6A 3LAPA 4A0XA 1SJ1A 5EZHA 2HWVA 1YI2S 3K0JA 3GFXA 1G4DA 2BJ1A 3NL0A 4DV7F 4M74A 1KLNA 4YFKF 1FEXA 4XONA 4RW8B 2DGWA 3EICA 5FKOA 1XNRF 5EN1A 4F50A 4B43A 1K78B 1X4PA 2C42A 3FKJA 2EWHA 1PKUA 3D54A 5E41A 5LMNJ 4P2XA 2E29A 2UVVA 3UQSA 3NMRA 3IKTA 3BJOA 1SJFA 2HYIB 3BROA 5J4VA 4I09A 3ECOA 1BE4A 2E7XA 1YJ9S 3L7OA 1IN8A 2YKPA 3D9BA 2G2YA 2ZDPA 2PA8D 2K5CA 2XV4S 2BVMA 2X1BA 3HHLD 4TQRA 3JTNA 3TEDA 2CUYA 3NGUA 2HDDA 3LF0A 1NJXA 1OY8A 4ZDNA 3QU3A 4DGWB 4OIRF 2RD5C 2V9VA 1D0XA 1K6OA 1IJEB 2IJFA 3GG0A 1IAWA 2NYHA 4ES1A 1HR0J 4JI4J 3EVOA 2FBIA 3IG1B 2LK2A 2BXZA 1RT4A 4BEHB 1YRXA 1Y3KA 3HOYJ 3E6DA 2RS2A 3HOTA 4TLRA 2M9HA 1C1CB 3HJVA 2LBFA 3KP5A 1U8WA 2DO0A 2GZWA 4XSXF 2V4RA 2MB0B 4NC6A 1FJEB 4AFFA 2B9EA 1P6RA 4GRSA 5AJ3F 3V4GA 2VDHA 4QTRA 4EMDA 3KUEA 1NBEB 4P9FA 1PUEE 1N32J 1SBRA 3SQOP 4DR4J 1WI8A 5LEKA 2W2PP 2ASDA 5KFHA 2JUGA 4X4QA 4D5FA 1T8EA 2Z99A 4N0BA 2FC9A 2R7OA 2AW0A 1WHUA 2QFJA 3FRZA 2XS7A 4K4UA 2NSCA 2TDXA 1ON2A 3BLYA 3NAIA 5GMDA 4HX7A 1SC7A 3D1QA 1HNZF 2YU9J 2MQLA 3G1LA 2VJ4A 4E7KA 3RZOJ 4HX8A 2ZVIA 2I8DA 5BMZA 3NNCA 4BAYA 1U5TC 4XL9A 2CV2A 1I6HJ 2LA6A 1H7WA 1LEBA 1TW3A 5IP6A 4ZITA 2V68A 1Z1ZA 2RQKA 4KR0B 1HW5A 3MEEB 2ZJQF 2QLWA 4JOMA 2GOMA 1TP4A 2JJ4D 4OYIA 1PDNC 3J81Y 2VQHA 3QPSA 5SUHA 2CADA 2OPTA 4C3JJ 1RWXB 3G96A 3FXUA 2Q3PA 4C30A 3U1LA 3OSPA 3JAMU 2VXDA 3TJ9A 1RHQB 2IDLA 3CO7C 2XIGA 3DDNA 5KFZA 2JLEA 1HCRA 3ISZA 3O2PE 4NEYA 3V5RA 4OI3A 3FBCA 3V4IA 2BY0A 1R5HA 3Q8RB 2ZBRA 2W82A 3QT8A 4QPTA 2ZBKA 3RTRA 2UU9F 5D3GA 1P1LA 2FYXA 3RTVA 5L1LA 4PFPA 4QIWN 4XRSA 5KFJA 1VQOS 3TVYA 4EBCA 1T0FA 3HKWA 5AONA 1JLGA 1LE8A 5DS9A 3A3OB 2F4FA 1YK9A 1CJVA 2XAUA 4CDIA 4ENJA 3PR5B 2K85A 4GMKA 4IJAA 4N7TA 2B4PA 3GFZA 1XR6A 2R8JA 3DXJF 1YGYA 3LOCA 4B9MA 3Q5FA 3G6XA 2FBKA 4N56A 2EVZA 1FKPB 1UTAA 3CUOA 5LFAA 1FSHA 5C7PA 3KYDB 2VJ5A 4EM2A 2YBVA 4M8LA 4KBIA 3N28A 3PJWA 2X51A 1RT2A 2CNKB 1FYKA 1U25A 2BXYA 3S1NJ 1HMVB 2RILA 4K4XA 2Y0SA 4X64J 1ZHFA 1HC8A 4A93J 2WW4A 5KAFC 3IMQJ 3BR6A 1CBKA 3ILIA 3C8YA 3HZJA 3ELHA 3W9IA 4NLGA 5HLIA 2DCEA 1IVZA 1FMVA 1F5CA 2OI2A 1E3PA 1ZAOA 2BY2A 2MKKA 1HQEA 2F5CA 2RQPA 2CRGA 1FTCA 4Q0BA 4QWQA 3VCDA 3NG8A 4HVZA 2R4GA 2AV5A 1IR2A 1IGNA 4LF4J 4LRCA 2RREA 5CQEA 4JI5J 2R0QC 1NG6A 3HRUA 3ZQ7A 4RB2C 5I3UB 2P6TA 5J40A 1J5EJ 3BQ1A 2VICA 1RT3B 2EEYA 3RZAA 1X3WB 4EFAC 4CH1A 2OMLA 3K4BA 2HVZA 5BXIA 5J1NA 3BPVA 4DV2F 2LXFA 2MC3A 2RDJA 1N52B 3S14J 2VA3A 5T7LB 3I4NJ 6FDRA 4Y2IA 1WVRA 3N4MA 3UCUP 3TW6A 4B09A 5C4JJ 1MROA 1WDTA 2QSFA 3GTOJ 2Z2YB 2L7ZA 5KT2A 4OZNA 2D3O1 3BTLA 4AYBA 1J7KA 4ZP6A 5ETRA 4J9OA 4V19J 1QTNB 1IKWB 3M07A 1A6IA 4ZYHA 2BV3A 1NU4A 4M6VA 5J2QA 2AXTC 3N6NA 1SKUB 5JVGF 5IOZA 4K4VA 3DP7A 3KCCA 4GKJF 3GWZA 2Q8KA 2CPHA 3F6OA 4CYCB 1HD1A 2MHEA 2V50A 2GA1A 1ZM2A 2DXFA 3NAUA 1EX8A 2QGUA 3H3ZA 5GPAA 4Q43A 4L5JA 1S1XB 1QDUB 3SCKE 4I2QB 3JRCA 2DCUB 2E5LJ 3TX8A 2XI3A 3G6EI 2KT0A 4B1RA 4I4BA 2W84A 3DKDA 4RU9A 4NQWB 2CQ1A 2HHHF 1SH0A 1IDYA 1ETXA 2LNBA 4M5DA 5F41A 4ZIWA 3FHNA 1RK8A 1PUFB 1MSFC 5ETVA 3UI3A 5CD4A 5FLXU 4ESFA 1Q5YA 3M4XA 3IR5B 2WBMA 4O4RA 3E01B 1B0PA 4UOCA 3W5ZA 4DX5A 3OFFA 2W1OA 4HI2A 4ER8A 1HW1A 1U1RA 4P2FA 2YNFB 3F0CA 1O0PA 1F5TA 1ZPVA 5ETLA 2X1DA 1QZEA 3GTGJ 4EJTA 4DL2A 2JFDA 1RAOA 3K5OA 3HSFA 1HBUA 2A10A 1VRTB 4MHGA 2IT0A 3FBBA 2MH9A 4ENOA 3DRXA 3ZTRA 2ILZA 4B3SJ 3I0SA 4DPYA 3FSYA 5JHFA 2J9CA 3OR2B 4AUKA 4FCYA 3FISA 2QT7A 2BRLA 1XG1A 5TJJA 4GKKF 3NP5A 2DA3A 2B51A 4MKBA 2CJYB 2HLTA 1J27A 5DLFA 5E3LA 1QBJA 1FIPA 5FRNA 4K4ZA 4TKTA 2LDYA 3K7RA 2XBPA 1EQ0A 2V8PA 4ETZA 2H94A 4MFBA 3DRRB 3OS1A 4ECQA 3CDBA 2Y0MA 3D3BJ 2JVGA 2GC8A 5KAKA 1TUWA 4USTA 1CLFA 2J5PA 2I9SA 1F1BB 3PJ9A 4G7HF 5K14A 1E6YB 5C24A 4FXDA 3SQGB 4PEOA 3MMCA 2W8KA 1O6XA 4OIXA 1LWXA 4IRHA 2J0QD 1LQ1A 3CSKA 1DLOA 4JYAJ 1FRMA 2BOPA 2XKPA 3SCLE 1TKTB 4ED6A 3DOLB 4J9UE 2P5KA 1LKZA 1IXKA 5HQLA 2C2EA 3PKMA 3RBXA 3CB4A 3CPWR 1TL3A 2H5JB 2FSWA 3FXJA 1SANA 1VQ4I 5LMNF 2LD5A 3IHUA 4RW4B 5EGOB 1TL4A 3DLEA 5KG7A 5CYQB 1M0SA 1JIHA 4G1IA 4C8OA 2BUNA 1RP5A 4AU7A 4YELA 2IBKA 3VZIA 4ITSA 2LH9A 4WFBQ 2IAJA 5HROA 3BN4A 2YWWA 1ZTTA 1VBZA 3T1AA 4IDKA 5HMWA 3KTQA 1JTYA 2WW8A 5DUIA 2DYSH 1RCOB 3QZ8A 3VAJA 5DCMB 3TEGA 3I56I 1YVFA 4Q45A 2P7VB 1XC9A 2WB1D 1JQGA 5HQ8A 5IC4B 3IC7A 3CMQA 2L5QA 2JH3A 1ZK8A 5CPRB 3C2PA 2JEFA 4XKWA 1YO5C 2VG6A 3CDEA 5E17F 1SFEA 1HR0F 2R5YB 4JI4F 4C8YA 4LSLA 3FXLA 3DLKB 2COLA 4A3LJ 4DMZA 4A8QA 5KFBA 2DTZA 2WV1A 4NUBA 1B9MA 2BV6A 5JJBA 3DV8A 1TKXA 3Q24A 5D0EA 1CGPA 1TTYA 1H98A 4ECWA 4RNNA 1NG7A 1C1BB 2M8EA 4L75A 4P73A 4EVIA 3FSXA 5F3TA 1KQSR 1FC3A 3QJLA 2XLKA 3RSNA 1FX2A 1CJUA 1N34J 4ZLPA 2PO4A 4QIFA 1C0UB 1AFIA 3CMAI 2DY9A 1UZDA 3GTMJ 4DR2F 1MBHA 4DR4F 2M9KA 2XGEA 1FKOB 1UZCA 4KKOB 2HRTA 2E9TA 2K86A 2QN6B 5K7FA 1M5SA 3NGSA 3F0NA 2XROA 2WCXA 1MH4A 3V4MA 2XMJA 3SXLA 1Y39A 4WCGA 2L9RA 2N4DA 2OFGX 3W5YA 1IJWC 3GZ5A 1TUGB 1X9WA 2GQ2A 2IMWP 3ABTA 3HSZA 3A0BC 5B5EC 1SVDA 3LAJA 1JGSA 4NCBA 1W7PA 5DV5A 2ASLA 2Z57B 1YTYA 3FXKA 3RDIA 4F4ZA 3VGUA 5DD4A 4FNHA 2MZRA 4OZJA 2KTQA 2GIZA 2UXNA 1S6QB 2M7SA 1K73T 2HMIB 2CJKA 4NE9C 3EZUA 3OYHA 1REPC 2N7YA 1ZGJA 2QG9B 2QBYB 1QAXA 2DA4A 3CCEI 4Z37A 1M5VC 1FTTA 3CDUA 1FFSB 5BPDA 1BWVA 2GAHC 1RBLA 1HDPA 2Y8WA 3UD5A 2XM3A 1CQNA 1VQ7S 3M8PA 3AD8C 2XSJA 5LMUJ 4PXCA 2MKSA 3KLIA 2LKSA 2M8DB 5F0UA 2XRLA 4Y13A 1FJGJ 1UETA 3CCSI 4RW6A 3AJDA 3OYCA 5D4PA 1H38A 2U2FA 2DT5A 3U21A 5BYRA 1HLWA 3IAS9 2QQ8A 2AZ3A 1A9NB 3DC2A 2HFUA 3NQOA 3KG0A 2CDRB 3SHFA 1MJ9A 3F8BA 2PG4A 2FJAB 4ABZA 1B70B 1HBNA 2L9WA 2DODA 4UVCA 1MU2A 4OAZA 1B8IA 4A3DJ 1B4SA 1GT0C 1RB0A 1WF0A 4KH1B 1BI3A 1YZ7A 3CDWA 4DUYJ 5HMZA 2DTJA 6AT1B 3KJFB 2I8EA 2AHQA 2B43A 4BWJA 2ESNA 4R0JA 3G9CA 3MM6B 3ZP5A 4V2GA 3AL0C 4XN3A 3VAHA 1U6FA 2MZTA 1RHRB 3OYFA 1I5OB 2KXHA 2DA2A 2H6BA 4X64F 3NEKA 4E4HA 4R0EA 2FF4A 1B99A 1VCTA 4JI8J 2CZ9A 3OS0A 2WSFC 3IBWA 4PWUA 5GADU 3VAKA 1D8KA 1MJAA 4F0HA 2DGUA 4C97A 3UN2A 5GAHJ 2QYOA 3KE2A 3ZZZA 4PG6A 3GZNB 3A01A 1JLAB 4TU9A 4PK4A 4YIIA 1FE0A 2Q2EB 4RM3A 4JX6A 2Z2SB 1WJBA 2E1PA 3DOKA 4LF4F 1KA8A 1HQUA 4JI5F 3CJRA 3W62A 1KEKA 4DL6A 1M1KT 3J7YI 2QMUB 1J5EF 1UVLA 2M87A 3ABMH 3I5AA 1BM9A 2LOOA 3PIPQ 4IPAA 4KFCA 1GMUA 4FHTA 2OPQB 5KCMA 2GXAA 3FK7A 2Q6CA 4ED4A 4W1UA 4HA8A 3R7BB 1S9EA 2QLJB 3I71A 3BREA 4Y34A 3B6BA 3E7LA 5CZXA 4KO0A 1H7XA 2E5GA 2WB4A 4LLGF 5H9EJ 4MEYF 3C1DA 4IEJA 3BS9A 3KG4A 5IY5H 2Z33A 5MAOA 1VRQC 5B0CA 3PIOQ 4RAYA 3LWFA 1UVNA 1SAUA 5E8GA 4HPQA 2O01C 4C8NA 5KG3A 1HYSA 3V6JA 4YY3J 3TUIC 4B17A 3FWEA 1N5YA 2CQ3A 1N77A 1I1SA 1XQIA 5FDLB 1QHGA 5JLXA 2V1NA 3G4SI 2JVOA 3IWLA 2YNGB 3VYTB 1WJFA 1X5PA 4LRBA 4EM0B 3ABLH 3JAMK 3HM9A 3CC2S 3KLHA 2DOAA 2DTRA 3CMES 1HLVA 3MD1A 4CLTA 2K3PA 1VQKS 3HOVJ 3W2AA 1YX5A 1SFKA 3K70C 2YKMB 3SFGA 2E5LF 2HI3A 4FYYB 5HBMB 5LHIA 1EB0A 4TY8A 2V2VA 3DFGA 5IFMA 3D68A 4UY8I 2COMA 4BQQA 1XSXA 3N79A 3ITHB 1VC0A 2XLIA 2DO7A 4OL8A 2LTPA 2QLBB 4ATNA 3HXMA 1VI7A 3WC0A 4HNTA 1GMWA 2PJRA 3DOMA 1J75A 2V63A 3B4DA 3WTWC 2AYGA 1MNMC 2H4YB 3M32B 3JB9k 2H5EA 1NPKA 1F3VA 3PX6A 3HFVA 1DP7P 1Q5VA 1QSSA 4UOGA 3D7SB 1ZGWA 1YRNA 5KFFA 1VQ6I 1T05A 5C25A 2RS8A 1FESA 4KC5A 1S6PA 4CYDA 1WEZA 5EWGA 3CP2A 5K20B 1JKOC 1R36A 1S1UA 1SEUA 1SD6A 1R5ID 4OI4A 1NK6A 3LA2A 2UXXA 2NVYJ 4B3SF 4B3TF 3GV8B 3KLEA 5ETKA 4DUZJ 3CCQI 4OI1A 5L3CA 1XTZA 3HULA 5FROA 1NHVA 3ZZYA 2QJ3A 3I55S 4AQYJ 2D9OA 3OFHA 2LEBA 3H25A 3E1SA 2JA6J 3BH7B 2R4FA 4ASNA 2FLOA 2QSWA 3IS9A 2JDJA 4NI2B 1UVKA 3K4MA 5IQ6A 1VS3A 4ECTA 2KIFA 3HHKA 2ME0A 2AGQA 3M1CA 1UFLA 2AJ4A 2HHPA 2GIFA 4PUOA 1WKMA 3GE9A 1S1VA 3CDAA 3CDIA 1KQFB 3L2VA 1KS2A 4PXDA 1TWFJ 1JWWA 1TNTA 5ETOA 4JYAF 3EXYA 1A6QA 3AD7C 4GVLA 2VN2A 2VDIA 4FXWA 4DZPA 1HW8A 3LANA 3DPUA 1F36A 4KDPA 4WP9A 1GVJA 1O3RA 2DGVA 3CD7A 2HYJA 2LLZA 2MKYA 2RJZA 4X4TA 1ZARA 2VQFJ 1URRA 3CMMA 1SD7A 4EYIB 1YS6A 3M2RB 4KTQA 5KVRA 2W9CA 3SDEA 2BRKA 1XTAA 1W5CC 3GXOA 3VGVA 4RGXA 2DO4A 3LGMA 3VAIA 1LDDA 4L5IA 3JYTB 2X1FA 2HOSA 3BGUA 3N5FA 4II3A 2RSQA 1IN6A 2DK5A 2CUEA 2BBEA 3EGVA 2CXEA 3QO9A 2ZE2A 3Q2TC 2BW3B 2EXUA 4IG3A 1DZ5A 1WEYA 3ZZPA 1R3NA 2HZVA 1J9IA 3FKBA 2KIUA 3HHEA 1FYLA 4BE1A 5LD2C 1TWCJ 1X5TA 1LWCB 2EW9A 4Y7NJ 3DTIA 3DRPA 2R2RA 3K89A 1Z6TA 1YG0A 2ZD1B 3LSMA 3L9FA 3G3ZA 3JRIA 3EQLF 1I27A 2ATCB 4K2XA 3PNVA 2W2OP 2DNOA 5LLQA 5FLXK 4WX9A 1U1NA 2MQNA 4J37A 4BE2A 4UTGA 1T02A 1SC3B 1OO0B 2V67A 2KIMA 1UELB 1NDPA 3RRKA 5DQHA 1MBFA 1Y9OA 1MG7A 3ISPA 5HJYA 1N34F 4C8MA 1KR4A 1TKZB 2EZKA 4IQ4A 3ADAC 1WRJA 3C6TB 2XULA 1VZ0A 2D41A 2AP6A 1FWPA 2M3AA 1REGX 5HVGA 4ZVRB 1N54B 2H3EB 5TRDA 2DNGA 4FZVA 1T9VA 2XHCA 2DIVA 2CQ2A 2APOA 2VH7A 1NK2P 1UVJA 3B54A 3F56A 3KHRA 2XPVA 3O2IA 2ZBQA 1Y5LB 4DF8A 3TDUC 3C16A 3WGGA 4DQQA 2J0WA 3ASOH 3CD6I 2D2WA 3HOWJ 1JLFB 5LOQA 1UVIA 1IXRC 3NS7B 3A8KA 5G0RA 2LEAA 3QYBA 3R5CA 4BU2A 1UEKA 1WSUA 1SAXA 3BZCA 3HVWA 4Z2XA 4QOTA 2ZMEB 3DBLB 2DDBA 4U9RA 1X1DA 2F48A 3QATA 4O0IA 3HI9A 3TVKA 4HQEA 2CG8A 2XEXA 2ECBA 4TYBA 1NJZA 5D4RA 1SV5A 4YIRX 2KRHA 5LMUF 2N3LA 3MR2A 3ETOA 4RS8A 3R3TA 1RAIB 1HBOB 2YKQA 3MMJA 3CCUI 1GV2A 1QHHD 5CJ9A 3UE2A 3GTQJ 3DXSX 1KYWA 4YR2A 1FERA 4F0MA 1FJGF 2A0FB 2J8AA 3FHZA 2DHXA 2NS8A 1YW8A 2DXEA 1D8ZA 3CJKA 2PFDA 1MN9A 1MKMA 1CVJA 2NUUG 9ANTA 4EZ6A 4RUHA 4Y2KA 3DLJA 1ULRA 1VBKA 3K2YA 3W2VB 1O4XA 4A8OA 5IV3A 1JLQA 3PW2A 5KT4A 3OR2C 2EC2A 4AUXA 3D6MB 1XMQJ 4ID8A 4EGLA 4DUYF 2ILYA 1RBAA 1K4SA 1T08B 4IKFA 2A6TA 3HD2A 3OL8A 3K7AJ 4TNOA 3LO3A 2A5WA 1QAIA 2A6MA 3BDDA 3QGGA 4CCJA 1IWGA 1G1XA 3CF5F 3EDQB 1NK0A 2KFDA 2M0CA 2VKDA 3FSIA 1JKHA 3R60A 2QTWA 3BZ6A 4DV0J 4D7NA 3P7NA 3GJRB 5J1YA 3HSGA 2NXJA 1PYSB 2FNAA 3MKZA 4JI8F 3D5RC 1JT0A 3LSHA 2RHSB 1SQGA 3WTSC 1QVGR 4O44A 2OPPA 1BOBA 3IWFA 1TK0A 3ZTSA 4JI6J 3EPZA 2O8KA 4Z7CA 1E6VA 4I6WA 4K7QA 5HJXA 2L9DA 3THPA 3LSIA 4MIBA 2HQGA 2IJRA 3S8PA 2AJ1A 2G0CA 3NRVA 4LITA 4ANJA 3Q0AA 2ZJRF 4DNCA 5D8LB 2KI2A 2Q1LA 2W7OA 4ERDA 3P6YC 2M0MA 1IM6A 1MWZA 2RQ4A 1X2NA 2OTLI 3AG4H 2QQAA 3M8EA 2RU9A 2PDAA 2M2EA 3CE8A 2FLLA 1NRKA 3SSQA 5A8KA 3BF4A 1ETQA 1C4CA 1YRUA 1ZG3A 1L0OC 4MTDA 1WZ2A 3K5NA 2MD0A 4PG7A 4BYYA 2WONA 3J7YJ 2IJNA 2VF3A 2CQ7A 1ON1A 3B4MA 1MJBA 3JQJA 2Q66A 3TANA 5D3GB 2EZIA 2DPIA 3A12A 3IV5A 2XUBA 3K70D 3K69A 3OLAA 2EFPA 2K9QA 2EI5A 1WOPA 3IRXA 1G3SA 3NY0A 2XMTA 4JOUA 1O57A 1JLGB 2IA2A 1LE8B 4NCAA 3G6ES 1FKAF 1S10A 5F8IA 3CDHA 4JX4A 1CJVB 3C2BA 2RUSA 2DD8S 3D4JA 4ID5B 1IV6A 5CCLA 2L3MA 3HBLA 2AEFA 5EEAA 4ANCA 4KJZA 2PLYA 3R9LA 2H1YA 4RNFA 3IH4A 4EBDA 2VOPA 4F25A 3FC9A 2DOEA 4U87A 4DLEA 1YW9A 4MFEA 2G2OA 5F1JA 1R6RA 5K5MA 4HF2A 2XAHA 1RT2B 2BW7A 4R8UB 2IXSA 1G7CB 2X0LA 2CQ0A 4FVMA 4RL1A 3KLFA 2IA1A 3M2UA 5AIQA 1ELOA 4O4GA 1N6QB 3UDEA 3ZC4A 2ZEJA 3MEGA 4MFDA 2Y3YA 4M9ZA 5LL6d 5JVTA 4NLRA 3ILOA 4KGVB 3E6BA 4BCAA 4S0HB 2CJBA 4RW9B 3LGNA 1QAYA 4LB5A 2JSCA 4DU8A 3OV8A 4I01A 1IKXB 2MHNA 2VZ9A 1OIAA 3CJNA 4Q0BB 2V79A 1VQNS 3CCWA 1U6BA 4D5CA 1FRKA 3Q22A 5KFMA 2H5IB 1I6XA 2IP2A 1UKUA 4K2EA 1U8SA 1H2UX 4IKAA 2CUZA 5K9FA 2QA2A 4X66J 1RQ0A 2HHSA 2WY7Q 3GPAA 3MD2A 4CLLA 1HPZB 4FP9A 4DUZF 3H35A 1S72I 2XF5A 1FO1A 2VIXA 2HQ5A 4U67Q 3MCNA 1W2BR 1IRFA 2QQBA 4AQYF 2WVFA 1MROB 3F8CA 4FQGA 4CXFA 4BUPA 2E2HJ 2CQ4A 1RKWA 3JRFA 2XB5A 1Q1KA 5IT0A 2Z2MA 2NVQJ 1RAGB 5H9FK 4X1EA 1KWMA 1XMOF 1EQMA 3GFYA 4J9PA 4G6VB 2R7XA 1SL2A 3SEOA 5DM6Q 2HYFA 4NC7A 2EK6A 3OTOJ 4BDYA 1U48A 1U24A 2E1RA 3OT9A 5A8RA 2NOGA 4ZH4F 3DKYA 3RYRA 4M73A 1KHVA 3UR3C 2FHJA 3TAMB 3L7WA 1S0NA 1DHMA 3I0TA 3S16J 3F23A 3US5A 3IAS2 2DGSA 2LQ5A 4MQVA 4NLUA 4FF1A 2M5WA 5IS2A 3EZ5A 5E3RA 1PP7U 3MPYA 3JAMY 2KL4A 4PR6A 5FKMA 3S2HJ 4DQRA 3OD2A 2KHMA 4JI2J 2FVPA 3CDLA 2RMLA 1PYVA 3ENVA 2JZ5A 1NH7A 3MTKA 4C7QA 1TWAJ 1O7FA 1TQIA 1S7HA 1OYDA 1RWVB 2R7FA 2LCWA 1TR0A 4ED5A 1D9FA 2HZCA 2IAIA 1LJ9A 4Y52J 4I2OA 3DLLQ 2K8GA 3WHCA 1D3WA 3ZNUA 4BBYA 4UUWA 2JSXA 3UN5A 3E51A 2EILH 3RGIA 2AXLA 1B4AA 3TARA 4QU6A 3H0DA 2BANA 1BW6A 3QIPA 2NXNA 3IAM9 3O8GA 1OPIA 1HBUB 3EX7B 1PVEA 2ECCA 1M5HA 2ZSHB 3RBEA 5E3QA 3GZ6A 3I0SB 3DM2A 3IR7B 4M5HA 3EGWB 3J80K 4F4YA 4DSIA 2VB6A 4MIMA 2F5EA 2W7PA 2BEOA 4JV2A 1JLEA 5B0DA 1S7AA 2WC2A 4XOTA 1GXTA 1MGTA 4HF0A 1E2XA 1EH8A 1U1LA 3F21A 2GM4A 4MFBB 1V3ZA 2DHHA 3OS2A 2DEIA 3IGVA 4MYTA 4DI6A 3VZHA 1HARA 5GVQA 4UV8A 2GHWA 2H6CA 5H6QA 1I3AA 5LSOA 1H72C 4DFKA 5E1XA 4AWXB 4HRIA 4JV5J 2F4MB 4IH5A 1X0FA 5C24B 3JSRA 1V5EA 1R0CB 1YHQI 3MMCB 1KU9A 2JEIA 4BXXJ 2QA4S 1FRLA 4YFNF 4ZZDA 1YJ7A 3ET6B 2FZKB 5KHDA 4LQ9A 2NZ4A 3H40A 2V4JC 4BHBA 1N33J 3K59A 2EQRA 4I6ZA 4FT8A 2EZLA 2GW8A 3G87A 2HIQA 2ZSIB 4XRMA 4LFCF 1TL3B 1IQTA 5HLHA 4OI2A 4WYLA 4WFZA 1E3HA 1OMIA 1I39A 5GAEJ 1Y7PA 3DLEB 4C3KA 2LQBA 3OL4A 2H27A 2XQCA 1S77D 3HPGA 3QODA 3POTB 4EJWA 1OCRH 4ENMA 3P9IA 2FJ1A 2ZNZA 2GGPA 4K50A 1D8JA 5HROB 1LDJA 4DQIA 4IDKB 5KG0A 1RTHB 2XSDC 2PEXA 2ALZA 1WTBA 3EZOA 5HVQC 3AAWB 4DV3J 3LA7A 3Q23A 1CC7A 2VQCA 4MLOA 2VG6B 3FXQA 4LR7A 2BXJA 3T9NA 5BYQA 3VFZA 3M6XA 3KP7A 2P0WA 3JTHA 1VC6A 3W8GA 1S9FA 1KU3A 2QL7B 1JK9B 2KN4A 5B0FA 3ZTOA 5BYSA 3J81Z 2F5GA 4CICA 1HA8A 4XO0A 2G13A 3H0GJ 2KDZA 1TKXB 4FYDA 2E34A 3PSFA 3E2EA 3NS6A 2IBOA 3S17J 2DB1A 4HR2A 3DU6A 1OPCA 3RB3A 3FXMA 2Z30B 5F04A 3FM3A 4IQMA 4JK1X 3J7AN 5JI6A 1MBJA 2DFEA 4IO1A 3GX4X 1XMQF 1CJUB 4EEYA 4C3MA 2ZH9A 1NCLA 1X1CA 4USWA 2PBIA 4HHHA 1JKRC 2BQRA 3FEZA 3C7JA 1SXLA 3AT1B 1V9OA 2JRSA 2K3IA 3R5JB 1XEZA 2BE7D 2OUMA 4PSWA 2JEGA 3L9ZA 1QE1A 5DCFA 2LKPA 3MUMP 1RKJA 5E3PA 1ITYA 4KNYA 2DMPA 2VFTA 1RTDA 2VKHA 2I38A 4F02A 4C98A 3VALA 3HJEA 1X1AA 1JHFA 2C2ZB 3GIRA 2BE2B 2A68F 5HDGA 4JI6F 3ZN0A 1CULA 2YNHA 1W7PB 5CVRA 2HOEA 4BBSJ 2D1VA 3MMBA 3L09A 3WTZA 2DT6A 1MIJA 4LRAA 4DSJA 2GVZA 1G3TA 1T98A 2RAQA 1KVIA 2FIUA 2WSCC 5C4XJ 4H4OB 4YHHJ 2BKOA 2MGZA 3B6AA 3KLVA 4U8VA 1O3QA 4HLXA 1H0MA 2DIUA 4WTOB 1ZYRF 4XKBA 2P6SA 1Y1WJ 2HGLA 2DT7B 1TC3C 3MEDA 2DNQA 3D1OA 4HEA9 2W2NP 2ZITA 2JUCA 3F22A 4HSTA 2ADBA 2XSJB 4WF2A 1IW7F 2MD5A 3JTOA 2QVOA 4LUBA 3KLIB 4MH8A 2BHYA 5CLSA 4CCMA 1EA3A 3NWRA 1NH3A 4R5PA 3PW4A 4RW6B 2IS4A 4H4KC 2VKRA 3M4OJ 1HNXJ 3A2KA 1BI2A 5E3AA 1ICEB 4TN2A 3B8HA 2E5IA 4NRUA 3VV2B 1HHTP 1OR7A 5DM6F 5HN0A 5FJ4A 2X9DA 2HFNA 3BPSP 1HBNB 1VQ9S 5E79C 3C66A 3DQVC 3HVTA 3OYEA 3RKXA 1MU2B 1YBAA 1B8IB 2Y1IA 4NYPA 1HBMA 3FMSA 2KG1A 3MPUB 3GCMA 4RUAA 1RUSA 2MQPA 4QCLA 3ZQFA 1S6LA 1FDAA 2DH8A 4JI1J 3KFWX 4RPFA 1ZQ3P 2ZH6A 3VSLA 2HURA 4LJMA 2FB0A 5H2FC 2CWXA 4WK8F 2EV5A 4KA4A 3RW6A 3C2GA 3NNHA 2CPJA 4AVZA 3HMJG 3GBGA 4YFUA 1S1WA 2DFIA 3N97A 1FP2A 1HKAA 3HZEA 4AT1B 1VIXA 4UVBA 2N7CA 2KP6A 2P8IA 5GTHC 4CP5A 2OUGA 2AS5F 2YPYA 2DY1A 3HL2A 2EFOA 1CG2A 1PAEX 5EJCA 2GA2A 3A01B 5FD5A 3CCQS 1MSEC 3OYKA 3X2QH 3DLLF 1HQUB 4KYZA 4E7JA 3QWPA 2RU3A 3RJMB 4QPQA 2LREA 1SVMA 3OTCA 3K17A 3CUQA 1WKJA 3R6LB 1XCBA 1F9HA 4PQUA 4EGYA 2CO5A 3TQEA 4DZ6A 4DL3A 3DBRB 1RE1B 5GADI 2LDUA 1KC8T 5A8WB 2BJ3A 4HQMA 1S9EB 5F6FA 3NLCA 3SSSA 5IXUA 2E60A 4CH7A 1WCMJ 2HPMA 2MPUA 2ZMEC 2ZKUA 4DDFA 1Q8LA 2QMXA 4C2TA 4NZ7A 2QUFA 3DKXA 3I0RB 3C46A 2L08A 4A3IJ 4C2MJ 2F4IA 4WYWA 1HYSB 3JSMB 1N5YB 1RWWB 3M3YJ 1FCAA 2MY8A 3H2VE 2E2JJ 3WU2C 1EIYB 2EB7A 2FJWA 3OTOF 4MTEA 3TA2A 1NZAA 4I69A 4M3GA 4G1QA 4QIWD 2L54A 3ENQA 4N5SA 3QLHA 3H5RA 3KLHB 4BQOA 1KHWA 2OU2A 4TV7A 3OYIA 3RZDJ 4P6QA 4BACA 1XDSA 4OX8A 1U49A 3HO1A 3ZQCA 3PV8A 4M94A 1DQUA 1QLNA 3R2CJ 2XI2A 3TAPA 3JRAA 2ZNYA 4TY8B 3RAMA 3HRSA 1SJQA 4B47A 1FK9A 4JI2F 2P81A 1FDBA 1FTZA 4L72B 2XYPB 5IT4A 1UFMA 1FLIA 4B3OA 3LSKA 2ATLA 1AT1B 4RBUA 2YWHA 1TZLA 1MZBA 1LW2A 2PJRB 3DOMB 1F60B 4URSA 3CESA 4KGXB 3HRMA 3LQVA 4XORA 4R1HA 1KGSA 4PGGA 1JHHA 3Q8YA 4F67A 4GO5X 4X84A 4DQ2A 3W63A 3H36A 2LKXA 4CLPA 4HOBA 3U2RA 1SB6A 3BZQA 3ZMZA 5M5YJ 1EJ9A 4OI6A 1YQHA 5C25B 1S6PB 1RJJA 3GP9A 2AX0A 1TAUA 4A0ZA 5FD1A 1RAAB 1S1UB 4X4VA 4PZJA 1Y5IB 1GQEA 4A46A 2HNZA 4DX8H 3KLEB 2RB7A 3EJMA 1QQIA 2DMUA 3IBFB 3GB0A 1U26A 5J2NB 3GMEA 1CF7A 4BHPA 1EKEA 1CJKA 4OYBA 2DVIA 3DEEA 4P2MA 2BABA 3RR7A 3OQ2A 4RBOA 4Y0FA 2RKHA 1MBKA 2HOTA 2DHSA 3TWZA 1PILA 3JR9A 1YJRA 5AE2A 4DCJB 2HZTA 3DU5A 3QWUA 3KMQA 1Y6IA 4NLXA 2XHKA 3QT5A 4FN5A 3LQRA 3PNIA 1RT7A 2DRDA 1H2VZ 4PUOB 3Q0UA 4Z7YA 3MPVA 1JE8A 4NXNJ 5LGTA 1RTIA 1XNQF 1VQ5S 3I4MJ 1WOOA 1U3EM 1DQ9A 3EGNA 3TO8A 1B6AA 1HHSA 1T0FC 2IRFG 2AJFE 1WKLA 2V8GA 5K5OA 2R7RA 1X58A 2XY5A 1YE9A 4DIQA 1N33F 4CCNA 4BC7A 4XMYA 4RZRA 1HF0A 1U8BA 5E2QA 4XM3A 1IF1A 3R0JA 2HNDB 5IWAJ 3N05A 4N9IA 3CO9A 4BS2A 4ILRA 2JFKA 4G3IA 2EG2A 4X4SA 2AWZA 4DV1F 1T3OA 1RISA 5D5VB 3DLGA 3FFIA 2R8IA 2CUJA 1IWAA 3QRFF 5D0RA 2WB1A 4NZ6A 2W9CB 4F92B 5EDWA 3DCFA 1FFGB 3H3UA 3DFEA 4G65A 1J5OB 1UA1A 1WF2A 4I0AA 4F4KA 1ZOTA 2I5UA 2BKNA 1ZKGA 5E1ZB 3M9OB 2C6YA 2ZZTA 3ZZUA 3QO9B 4UV9A 5KFRA 4DV3F 4IG3B 2RUGA 2XC9A 1VIOA 3RPQA 2Z58B 1LPQA 3U02A 3WE2A 4AM3A 5J1EB 5F9NA 4K5SA 1RTJB 1ENHA 3M9MB 1OSCA 5ICFA 2UUBJ 4IHWA 3CTAA 3L2UA 2VL1A 3Q2SC 3E3XA 5HLFB 2O9LA 1RYSA 4ED3A 2R7ZJ 2YQ0A 4C11A 3W8PA 1R7JA 1IUYA 3RI4A 4NLVA 3WGHA 3G82A 3K8VA 4N8NA 1U5TA 4IF4A 4PFOA 1AUDA 1AKHA 1UEUA 3I9V2 1XWLA 6FD1A 3R1HA 2QWWA 1RA6A 3D0GE 2VODA 3GIKA 5E33A 3N6LA 1CPZA 5H6RA 4L74A 1YITS 2DA7A 2R8HA 1TL7A 5E0OA 2VBYA 3GW2A 1WHVA 2DYAA 4CRJA 4LR8A 2Y1JA 4HAMA 2M34A 3MKWB 4KQZA 2X48A 3HOZJ 1X4HA 2FZGB 1XC5A 2VPZB 2OJ3A 3Q8QB 3C2HA 4CO1A 1ETVA 1FZPB 3QPHA 1KDNA 2HIYA 2EFGA 4ICLA 3C16B 4KMUX 1QUVA 2BJ9A 2DNHA 2GQCA 1BR2A 4FX0A 2ASJA 1OY9A 1TMJA 1J2VA 4LLLA 1V5VA 1KBRA 1B0VA 2OTLS 4MK9A 2RV8A 5IT9U 4U7CA 2YH1A 1H74A 4JB8B 1SJRA 2DJNA 3IM9A 1YIOA 3ISNC 4CYUA 4YMEA 2VC1A 4X4PA 2KJWA 1NDCA 2HS4A 1AB8A 2BYVE 1JNRB 4OLOA 2PEBA 3T19A 2CPIA 2WVDA 5BOXA 4EQQA 3T3FA 2M7BA 5T14A 3PQJA 1YX3A 3BSNA 3V6HA 2EIMH 3THTA 4DJAA 3H4BA 1VR6A 3M8YA 2ZZNA 4CZZA 4II2A 5I42B 2EA4A 2OELA 3I5BA 3P9CA 3KP3A 1FOXA 2HNYA 2V2QA 5AE1A 2R42A 3CCRS 3Q8UA 1XB4A 3MEKA 5KT6A 4DFJA 1XSDA 2AF6A 4L3NA 1FA0A 1IKVA 2PMZA 4HACB 3R97A 2XAQA 4WP3A 1TK8A 1IR0A 2GBYA 2QM3A 1R7IA 4QU7A 3J7ZT 4K0KF 1DARA 3CJKB 2IM1A 3BTCA 2D3UA 3ZCOA 3CF2A 1T95A 5GMEA 3LOUA 5D6EA 2QL9B 4Y65A 1MW7A 4AD6A 1R9TJ 4A3KJ 4NLDA 5FKKA 3ETMA 4C0OC 5I3QA 2HHVA 2FVSA 2A5YB 3T5XA 1RCXB 5HNFA 2QLXA 1SPBP 1OYEA 3K4NA 5HS8A 1Q8KA 4EJUA 4JI1F 3H4DA 1HNIA 2CQHA 1NSPA 4V2FA 1Y0UA 1HOMA 4LF2A 3MCZA 3AG3H 2BJDA 3MI7X 1U2RA 3M30A 4ILLA 8RUCA 4WXDA 4CCHA 3GFLA 2E9ZA 1R89A 1OS5A 1GUUA 4B3AA 4O44B 2ACYA 2FOWA 4M63A 3EPGA 2R5ZA 4LIVA 1FWLA 5L8RC 1RU2A 1S72S 4CLYA 4DSLA 2OH2A 1F4KA 2MYSA 3HF5A 3E5QA 3RR8A 5LGUA 1ZTWA 2XY6A 3GJQB 4P71A 3OR1C 1QM9A 2HS3A 1GTHA 4XKCA 3ZMTA 4U96A 4C8KA 1OPZA 1K0TA 4UW2A 4ZLJA 5F8LA 4HTJA 2FX0A 1DU0A 3MUTP 5M3FJ 5K8PA 1VOMA 3PTWA 3E6MA 4RUCA 2JVHA 3HHLC 4YB7A 4O3SA 1FYMA 3GFMA 1WF1A 3HZGA 1D9AA 3HFZB 2HPIA 3ICLA 2RAEA 3DCAA 4JUZA 4LR9A 2K3FA 2Y9YA 1BN5A 2ZH5A 2GMLA 2JLFA 4UUSA 1AA1B 5CQGA 1X7VA 3GEZA 2WADA 2GZOA 1R8PA 2V9WA 4EI2A 3GYNA 1Y0NA 4KB7A 2ZOMA 3IRXB 4F26A 1WQ2A 4RLFA 2V8DA 5M2RA 2IYGA 4I2PA 3L2CA 3GONA 2LFVA 1FNNA 3TGNA 3A1YA 5DG9A 3KK2A 3MURP 4A3FJ 3SSRA 5DD8A 3ZZ0A 2NYIA 5IPAA 1IXCA 3KDOA 2QO3A 2QEXS 1D1AA 4DQSA 4IFYA 3EUHC 4G6QA 3KLGA 4X2BA 3CJQA 2C3UA 3R7NB 3HLUA 3I64A 1UJ8A 1NM2A 3BG7A 4LFUA 3GR1A 3PW5A 3FEYB 1I6JA 3RCOA 1IBCB 2KRBA 3SXYA 1VJWA 4DWIA 2EBGA 5ICCA 2LMDA 1JXLA 4F36A 3MVPA 3AA8A 4LVNP 3M2UB 3MOZA 4O4GB 4XK8C 3MEGB 5CHCB 2DR6A 5KFSA 4UB8C 2PN6A 2MBFA 4K4WA 3VB2A 3ZZTA 1YJWS 1VLYA 1X1BA 1N5QA 1QUPA 4DPUA 2L3DA 2BKPA 1L3VA 2MA3A 3TQNA 2Z56B 2KZVA 3T6JA 4E6KG 2A3JA 3CIZA 2LSOA 2QIFA 5D4LA 3JTPA 1ZM3A 1WD6A 2XGQA 4V19X 4X6AJ 4A6DA 4Q7AA 1P92A 1YKWA 2X1GA 4ZCIA 4ZTFA 1KTQA 3F72A 3DTKA 2DH7A 4YOEA 5H1SV 1UG2A 2HGMA 1ZN2A 3S1QJ 1RWOB 3WU0A 1U1QA 4C8ZA 3RIRA 2H4WB 1VQ7I 1BW5A 2L9NA 3PQKA 1ZH5A 2FGOA 3A03A 4F8RA 2CGPA 2KRFA 4DSEA 1X0PA 4Q5VA 1U0JA 4MIWA 1JUSA 5DM7Q 3M05A 3LGHA 1UCRA 4DV6J 4CWBA 3T5KA 2V26A 2XSJC 1RT6A 3FNNA 1C0TB 5HK4A 5K1YA 4NXMJ 4WKRA 3KUGA 1VQYA 4OHXA 4FBTA 2XMUA 4OHVA 2UUWA 4JI3J 1BIBA 2YQ1A 2W9AA 4FE7A 3R5AA 5KFPA 3BBCA 4L73A 3AA9A 4C4WA 2PX9A 1GXQA 1GEHA 4AIJA 3CD0A 2LF7A 1F2HA 1TFYA 3JRBA 4L6V3 4HV6A 2Y0SD 2D7SA 3G6VA 1VISA 1O51A 3I3LA 4GGGA 2NVXJ 3HDDA 1OYWA 3KEOA 4N9HA 3SYZA 3V81A 1U9OA 4MTPA 1W36C 2L7MP 5C42A 4YEJA 3M8FA 2MKJA 3TP2A 3KK1A 2V4QA 4A3GJ 5J2MA 3U9GA 4DYRA 1XS9A 2F9JA 4LIUA 2V8VA 3ELKA 4KIFA 3UNGC 2DW4A 4EYHB 3C18A 1FJLA 3GV5B 3M8ZA 4G6DA 1T2KA 3P5BP 3BKFA 1RAEB 4ZPDA 3UDVA 4IO9Q 3TO9A 2V69A 3O6BB 2ZXHA 3QIPB 2V1DA 2NXNB 4O3QA 5BS6A 4DZJA 3M8RA 2AQ4A 2ACMA 1D1UA