2GQVA

High-resolution structure of a plasmid-encoded dihydrofolate reductase: pentagonal network of water molecules in the d2-symmetric active site
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
SNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrofolate reductase type 2
publication title High-resolution structure of a plasmid-encoded dihydrofolate reductase: pentagonal network of water molecules in the D(2)-symmetric active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 12
structure length 59
sequence length 59
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2006-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gqvA00
2RH2A 3SFMA 1VIEA 2RK1A 2VV5A 2OAUA 3T9NA 3UDCA 1VIFA 2GQVA 2P4TA 2RK2A
chains in the Genus database with same CATH superfamily
2JUFA 2RJFA 4C8QB 5I11A 3SDZA 3CCLQ 1U3OA 2KVQG 2CZ7B 5FRMA 1K9AA 2KYMA 1AWXA 4ELZC 2RNAA 2GNCA 5LJ5h 2L3RA 1AWWA 4PJOG 2F5KA 3CCQA 1Y96A 3LH0A 1KJWA 3CC4Q 4M7DA 4PFZA 1KIKA 2VGNA 2RI2A 4A54A 1K9MR 2D0QB 1WHLA 1IGUA 1YHQT 2K3BA 4CC7A 5A0DA 1XNIA 3BFMA 2LCCA 3CMET 4CC3A 5GANe 2KE9A 4XK8E 5C6SA 3MEVA 2P4RA 4NOYA 5GMKi 5GAOn 1NPRA 1UFFA 2NUTA 4EDUA 3L42A 1BI2A 1GFCA 3OW2S 1NM7A 2K2VA 4KGVB 2BZXA 1K8AR 3VYGA 3M4GA 3OYFA 2EYYA 4OP0A 2GBQA 4MDXA 2EJGA 2K6DA 2RJEA 1WPYA 2X4XA 2P0QA 2DL3A 1ABOA 3CC7T 5LJ5d 3CCET 4FT4A 2JS2A 3J80E 4GY5A 4CI0C 3OMCA 4C8QD 4BB7A 1W2BA 4WCIA 4XTYA 1WDXA 3S6WA 2DETA 5M9OA 4C0ZA 4A4EA 2JMAA 2ZZDA 4HVVA 2CP7A 1PWTA 2J6FA 1NLPC 2NUPB 3X24B 4M7DG 3CCMA 1E7OA 2L8DA 2VC8A 3BW1A 1Q86U 1PD0A 4PJOD 1AHJB 5FRNA 3HSBA 3JV3A 3CC2Q 1M27C 1ZBXA 1K1ZA 1WQ7A 3BDUA 1JU5C 4XTWA 2IVWA 2MIOA 2FYKA 2CH4A 2PVDB 2ZGWA 5IAYA 1UJ0A 2ZPFB 1ZUKA 2D6FA 4A4KA 1M8VA 1M3CA 3NTKA 1YBYA 3HFOA 1W4SA 2CS7A 3VS3A 4FL6A 3FC3A 3E9FA 2DE0X 1X01A 2EYWA 1PG5B 1VQ7T 5GANh 1M1FA 2C06A 4LNPA 3MCAB 1YHQA 4A63B 5GAMj 3P8BB 1QKXA 1TUGB 3CMEA 2VYTA 3REBB 1KSWA 3QIIA 4EPCA 4RTWA 3M57A 1M90U 4E7IA 1Q7YC 1LPLA 3CCLT 3S3NA 2DKGA 3CPWS 2AKLA 2RJDA 2CUDA 2W0ZA 2JM9A 1B3QA 2LJ3A 2LC4A 1QCOA 4KBMB 2K2MA 2H8HA 4AG2C 2RI3A 3R6NA 1KG1A 1I5OB 4M7DD 1B07A 1TUDA 1LNXA 3CC4T 1V1CA 3CC7A 3CCEA 2HSEB 5CQYA 2FZKB 2DJZA 2Y4YA 3M0PA 1QVGA 1KQSP 1EX4A 2QTVA 2OTLQ 2V26A 3OYBA 3FEOA 3OYEA 5IXFA 5GANd 1VQ8T 1KD1R 1VIEA 4N0AC 1MGQA 1SEMA 1IZ6A 3HKSA 1SPKA 1U5SA 3ME9A 3LW5E 4BE1A 1QP3A 5FLXE 3RR6A 1MMDA 1JO8A 4PLLA 2XIDA 2DILA 1AWOA 2RN8A 4MMKA 1B34A 2QEXA 3G71Q 3MKDA 1G83A 4IUPA 3LWHA 1QVFP 4M7AE 1UHCA 1X2QA 4JJCA 1EIFA 5GAMh 5GAN8 3X20B 4XU3A 4ZTFA 2RHYA 3A98A 2MPXC 5IXBA 4ZTJA 3OYMA 4FSSA 2J6OA 1X69A 2GQIA 2D0NA 3KXTA 2F2VA 2M9UA 4OF1A 1VQ7A 2ROLA 1OX8A 2CSQA 2COWA 4LDUA 2F1LA 3GLXA 2DERA 3N5BB 1I81A 3ULRB 4ELYC 2ESWA 2P84A 1KFZA 3MP1A 1K73U 3OYKA 2E64A 1OX9A 2P4TA 3L2UA 3QSUA 2XDPA 1IHVA 3X26B 3L1AA 1PKTA 2LMJA 2NLUA 3VS2A 4PK4A 2LTOA 3C12A 2X4YA 4M7AF 2JVVA 1F1BB 1MHNA 4OGCA 4A53A 5IHNA 3EGDB 4XAXB 4BI8B 2RB6A 2E4HA 4IUTA 4LDWA 2ENMA 5GAMd 1OU8A 1UECA 3PIPA 4ZN3A 1Q82U 2GFAA 5I21A 1JJ2S 2RMOA 4D6WA 3GBQA 5FW9A 1IHWA 5FROA 4AFUC 2VXFA 1CKBA 2EYQA 3QHSA 3GIBA 5KYYA 3CXCA 3AHUA 1VUBA 2ZPBB 5KYUA 1VQ8A 2RQWA 5KYXB 1GCQA 3MP6A 4E7ZA 1K8AC 2VXEA 3EGXB 2ZPIB 1TS9A 4B9XA 1ZSZA 2X3WD 2ABLA 1BU1A 2KI7A 3CCQQ 1Q81R 1CSKA 2NWMA 2CP2A 1ZUUA 1Y57A 3QPHA 3TSWA 1M1KU 2LP5A 2O4XB 2XK0A 3JAME 4F17A 2OTLT 3OW2P 2FPDA 4M7AC 2X3XD 5IN1A 1QKWA 4FT2A 1N6AA 3KBGA 2DBKA 2VV5A 2Y4XA 4EMGA 2KR3A 5CR2A 2A0FB 2DA9A 3RKWA 2IG0A 4DBHA 4E7SA 1PRLC 1X6BA 3CCJQ 1VQ6Q 4II1A 1WJSA 2R5AA 1N8RU 2DVEA 2LQNA 3JCMg 2JZ2A 3RKXA 4M7AB 3PGGA 2O9SA 3G71T 4FW2A 1SSHA 4DOVA 2F2WA 2IPOB 5FU7C 1I8FA 3FJPA 4YTLA 1D0XA 3CEYA 4HA8A 1HXDA 1WHGA 4CRIA 1RAEB 1UGQB 2FO0A 5KH6A 3BDLA 4CC2A 3R6OA 2LNHB 2X9HA 2RO0A 5LJ5f 1YCYA 1WHHA 5I2MA 1HD3A 4DQ2A 2GF7A 2V8JA 2X4JA 1NJIU 2DL5A 2PNIA 1JXOA 1QLYA 3SEMA 4DBFA 2PUOB 1E6HA 4HT9A 2QG9B 4X1VA 5FU7B 3JCMJ 1V29B 3OS1A 5KYWB 3OYNA 2QQSA 4E7KA 3H0IA 4LE9A 5GAN3 1YIJA 1UHFA 2YSQA 3MPUB 2PVGB 2QAZA 4HT8A 2JT4A 2DMOA 3QZ5B 3QUIA 4PJMA 1Q7YU 1KC8R 2QYZA 1UGPB 4RG2A 3CMEQ 4F7UA 2MAMA 2MYSA 4P5NA 4RCBA 1BKBA 4PFPA 3JCMc 3EG9B 3PFSA 2KXCA 1M4ZA 3E2UA 3V7RA 2L3SA 4JUVA 4KUDK 2HNIA 1NYFA 1QCNA 4FYVB 2COZA 3JCMW 3UPUA 1ZLMA 1S1NA 3GP8A 3QDFA 5LJ5e 1WGSA 3HRSA 2V8KA 1KHCA 2LX7A 1RAFB 1KQ1A 2FEIA 3UDCA 2RQRA 4C8QA 4TVRA 1BK2A 4HKEA 4J6YA 1TH7A 3RESA 3X28B 4PLIA 2IIMA 2CP5A 3MO8A 4JS5A 1U06A 2GQVA 4X9CA 1UEBA 1WYXA 2EIFA 3VS7A 2MWOA 2QTXA 2CP3A 4FU6A 1GBQA 4LD6A 3I55Q 2E5QA 1R8OB 3OBYA 3CCJT 1VQ6T 4J5YA 4F7UG 1NLOC 1CKAA 4XTUA 4OMOA 4HCKA 4JZ4A 2DTOA 2ECZA 2QEXQ 2KMTA 5GANf 3OBWA 5LJ3g 1PRMC 1R0BG 2HD0A 1HSQA 1K73C 1LVKA 5L8RE 3RKYA 4N4IA 3M0TA 1S72Q 1ARKA 3TQ7P 3M0SA 2DEQA 4KH1B 2EQUA 5GMKe 2DXCA 1I07A 4IURA 4UC4A 2F5TX 4C8QG 5GJWB 3MEWA 5CKDA 2YRDA 1PHTA 1H641 4X9DA 3VRZA 3MEUA 1K9MU 1Q82C 4V2SA 4JJBA 1AVZC 3GOXA 2RK1A 3V7SA 2WACA 2MF2A 1JJ2P 2KRSA 2NUPA 1V76A 2RA2A 3SHWA 2FB7A 2M0OA 4IUUA 1YITA 2BZ8A 4EIKA 4C92E 2DLPA 2M16A 2HQHA 1VQKA 1K8AU 2GTJA 3AT1B 3V8KA 1D0ZA 3I5SA 5KE3A 1VQ8Q 1YJWA 1NG2A 2CDTA 1M1KC 2K3YA 1QCFA 3G6EQ 4XU1A 5HK0A 2DTHA 3JCMP 1WXTA 4LUDA 1VQLQ 1SHGA 1AZGB 2G3RA 1N27A 1GBRA 2XI9A 2YDLA 1OPKA 2R57A 2DXTA 5GAMf 2ED0A 3DLMA 1YCSB 3CCJA 3M0UA 1VQ6A 1WZOA 4RTXA 3SFMA 4C92F 2EAYA 1TG0A 4KUIA 4JLIA 2JW4A 1JQQA 1NBEB 2YXYA 4OMFB 2DJQA 4BDZA 2A37A 4FCYA 3UF4A 2X35A 2XG8D 2DXUA 1X27A 3SB2A 5A0LA 1SSFA 5GMKh 1N8RC 4FSXA 3CBOA 2KAFA 4Y28E 3CXCS 2EKHA 2FPEA 4QQDA 4O6JA 1FYNA 3DB4A 4RTUA 1WXBA 2EKOA 3I55T 3QJYA 5A0GA 4Y91A 3T9NA 5FU6C 2LJ1A 3TU4K 5CKHA 1ZBJA 2QEXT 4HCZA 5GAOl 1YI2Q 2DVJA 1KQSA 2I0NA 2RM4A 4AMCA 5KE2A 1QWEA 5D6YA 2E3IA 1NJIC 4JRKA 1BIAA 5GAMe 1S72T 1LOJA 2HL5C 4C92C 3EFSA 4PFOA 4J9EA 2FZGB 1H8KA 3WVDB 5FU6B 5J26A 2RJCA 2KEAA 2YUQA 1TUCA 2RD1A 2RH2A 3QWXX 4FYYB 4J9FA 2OTJQ 1JEGA 1M2VB 4J9HA 1FXXA 3TVTA 3U23A 4HVWA 1G3SA 4N0AA 1FMVA 3RMQA 3UA6A 1RL2A 2FHDA 3M5AA 1BBZA 3L2WA 1YIJQ 4HCBA 3VU3C 2YRVA 1ZA1B 1C1AA 3PNWC 3IQLA 3WVEB 2MI6A 1OULA 1KD1U 4C92B 1AZEA 1QVFA 4XTZA 2M02A 2XMFA 1K4US 1VYTA 4D8DA 3RNJA 1UGRB 3O5ZA 4OMLA 4QT7A 4J6WA 4M4ZA 2HBWA 4B9WA 3HFNA 4C0GA 1IGQA 5J39A 2NYSA 3S3MA 3PIOA 3P8HA 4QKUA 1WQWA 3EG2A 2O01E 3RIRA 5L23A 4Q5WA 2R58A 3C94A 1IRXA 1E6GA 5CKFA 3VKIA 3G6ET 3QXEB 3A8OB 3EGDA 1T0HA 3META 3S3OA 4LDVA 2HZYA 5LL6S 1VQLT 1WI7A 2RI5A 4Z02A 3I55A 3OS2A 3JCMh 5A2QE 2HQXA 1M3AA 3M58A 3SWNC 2AZVA 1P92A 2P0KA 2FRYA 3TEEA 5J3BA 3THKA 2VB6A 3OS5A 5KYXA 2L5QA 1VA7A 2KGTA 3HPWA 4BE2A 2HQEA 4BY6C 4A4GA 3EGXA 2AZSA 4RTZA 1VQMQ 2ZPHB 3GF5A 2DEUA 2VVKA 1S72A 2O9VA 1YWOA 4CC4B 4KGXB 1QMCA 1M3BA 1TOVA 4FYXB 2XDBA 2VKNA 3UATA 3SWNB 2BE9B 2PQWA 2BZYA 2O4XA 5C0MA 1UDLA 2CZ0B 4N4GA 3FIFA 4A4HA 2EWNA 3QYGB 1JBMA 4BY6B 3RDVA 1YI2T 2L0AA 4KT0E 3I56Q 1ACMB 1YN8A 2ED1A 4BD3A 1OZ2A 3LGLA 3OW2A 2QI2A 5LJ3j 3QKJA 1X6OA 1K9MC 5GJVB 3RMSA 4JLGA 4M77E 4N4HA 4OMPA 1C6VX 2H3JA 3JB9J 2B8AA 2EQKA 3JCMQ 3GPLA 2YLBA 3EGUA 4X34A 1Q81U 4RTYA 4M7AA 2OTJT 2K3XA 1N9SA 1RADB 5I22A 1R0CB 5D7UA 1UB4A 3EH1A 2WSCE 2LQKA 4OMMA 1BI1A 4ME7A 1G2BA 1A0NB 2HSPA 4AFSC 1EZZB 1UJYA 3G6EA 1SKUB 4HVUA 2DZ9A 1RAIB 1QQJA 1GXIE 3ER0A 3VS1A 1JRIA 2GGRA 5GANg 1VQLA 2EYZA 1YIJT 3L2QA 1FX7A 3H8ZA 1YITQ 1PSEA 2NUZA 3TCJA 2CP6A 3NHNA 5ECAA 1VQKQ 3RBBB 2O31A 4M77F 1SHFA 2V1QA 1AOJA 4EMKC 2CZ6B 3CMAQ 5CVIA 2PZ1A 4C5HA 4IKFA 2KNBB 2XHCA 3LGFA 3M59A 1RACB 4M75E 1YJWQ 1D3BB 2ZCFB 3ZL7C 3J7AF 2DD4A 3L2RA 3QWYA 1MNDA 5KYWA 1H3ZA 2XD0A 2FVUA 4FM4B 2LDMA 2DF6A 2RHUA 4AFQC 2W10A 2DZCA 4MDWA 3G4ST 1Z9QA 3CCVQ 1M2OA 2J6KA 1YJ9T 2L3PA 4LDYA 4EMKB 1AD5A 4M7AG 3OYYA 5LJ3h 3VUBA 4BI4A 2V1RA 4VUBA 3M0QA 1KQ2A 4M75F 2M51A 2KRNA 1YI2A 4NS5A 2KXDA 3EG9A 3FB9A 3HL8A 3EFOB 4M78F 3OA6A 4JRIA 2LVMA 1VQMT 1WHKA 2EJ9A 4IUVA 3JB9I 2KBTA 4M77C 2KSSA 3RUXA 1Y07A 3JB9F 2K5IA 3PMTA 4PJNA 4QVZA 4PJLA 2EJFA 1X75C 2EW3A 2OTJA 4LXCA 8ATCB 2RHIA 3DLLA 1ZUYA 1HYOA 1KC8U 1I0CA 1VQNQ 1YJNA 2K79A 4MZTA 5GAOr 3I56T 2E6ZA 4BUGA 4JRQA 2JM8A 3URGA 2SEMA 2LQWA 3QO3A 2YRCA 1SF9A 3V8JA 2EPDA 3ZFJA 3OSSC 4M77B 1W2BS 4BE0A 5GAOm 1X43A 5IT9E 2LZ6B 1IXDA 4J9CA 4IIOA 3HRTA 4QQGA 1IO6A 1K0SA 5GAN5 3DKMA 2O88A 3ZEHA 1RUWA 3LX7A 5GAN7 4C5EA 3CPWP 2AKKA 4M75C 2J7IA 1KD1C 1KK7A 3C95A 4M7AD 2EGAA 5GAN6 2ATCB 4M78C 1RAGB 4J9GA 3G1JA 2YT6A 2LJ0A 1B7TA 4OB3B 4E7HA 4PJOE 1H92A 1FMWA 2KRMA 1K76A 2KT8A 1PCXA 1ZQ1A 2DIQA 3G4SA 1MUZA 2DK3A 2K9GA 2A28A 2OAUA 1YITT 3CBMA 5KCHA 5GMKl 1YJ9A 4PJJA 1OV3A 2FL7A 3BE3A 4ESRA 1VQKT 3H41A 4E47A 3NGPA 4M75B 4D8KA 3CCRQ 3CMAT 2EGEA 4NL3A 1TWBA 1G3WA 4K11A 3EHQA 4M78B 1O9SA 3A8MB 1YJWT 3EG1A 1VQ9Q 2VUBA 1U1TA 3HRUA 1T0JA 1M30A 1N5ZA 1VQMA 4PJOF 4XU2A 5IH2A 4WF2A 4J6XA 4IUQA 3CCVT 1UTIA 1XTDA 3LH5A 4EMHA 4R56A 2EQIA 2F2XA 4Z8AA 1JJ2A 2RHXA 4GLMA 5GAOq 4J9DA 3REAB 1W1FA 2CZ1B 2DRKA 3OQ5A 4ZNXA 1QVGS 3RERA 3M54A 3HP9A 4HXJA 3I56A 2ZPEB 2QQRA 4M7DE 1WHMA 1FWZA 2EVRA 3PMIA 4RKUE 4C8QC 4JZ3A 3QBYA 4L6V5 2DX1A 2CREA 4RMOA 4E2FB 5D6WA 3M56A 3J81E 1T3LA 3UT1A 2CKKA 3I9QA 4OB2B 2KT1A 2DXBA 2QDYB 2AHJB 3NFCA 1UGSB 1I5LA 2E10A 1VQNT 4PJOC 2QQ9A 2QDLA 1X2KA 4NL2A 1TTHB 1Q81C 3CCST 3A1PA 4M7DF 1VQPQ 4OGEA 2JN0A 2A08A 3FJ5A 2DD5A 2GCXA 4IIMA 1QVPA 2JMCA 3CD6Q 1TXQA 1WFWA 2ROTA 2JOYA 3TSZA 3CMAA 5CO7A 4JJDA 1M5Q1 1VYVA 3MJXA 1BI0A 3EFRA 5CKEA 4DBQA 2MCNA 4KRTA 4RTVA 2RF0A 2KROA 5CK9A 3KUFA 4Z89A 5IHIA 1DJ7B 3JCMf 3M4YA 3L2ZA 4PJOB 2LT4A 2DL8A 3H6ZA 2CH4W 2OX7A 3OYGA 2BKDN 3JCMb 3OS0A 3BY7A 1VQOA 2E6NA 1NYGA 3MP8A 4C0FA 1QP2A 3KFVA 1C0MA 1M1GA 1BI3A 3QG1A 3CCVA 2WSFE 1NEGA 3VYHB 2GFUA 1LCKA 1G8XA 1PD1A 2K7AA 3OSVA 5GANj 4QQ6A 4MZPA 2HKQB 2EGCA 3OMGA 3CCRT 1M2VA 2QGFB 2LNVA 3OYDA 3SD4A 3CQTA 3M53A 1WLPB 1VQ9T 4M7DC 1XQHA 5IHKA 1PSFA 2C0TA 1GRIA 1NEBA 2A7YA 1WIEA 4C92A 3X25B 1XJWB 3M9QA 5DLQE 3PE0A 4Y92A 2X51A 1GFDA 3OB9A 1T3SA 4PNOA 3ZBDA 2Y90A 4R0KA 1WX6A 4J7IA 3JCMe 4ANJA 2E65A 1Y96B 1VQNA 2ZPGB 1BYMA 1Y7XA 3CBPA 2CT4A 4M7DB 3EH2A 2EFIA 3CCSA 1HJDA 2C0IA 2JJ9A 9ATCB 5HK3A 5CKBA 2D8HA 1SRLA 2E3HA 1VQ4Q 3QZ9B 1RLPC 1KC8C 3JCMX 1G3YA 2MOXA 2HAXA 4ATOA 1RABB 2NUTB 1O75A 1D1CA 1Q86R 5I2SA 1Y0MA 4C0DC 2DYBA 1VIFA 2LT1A 1Z9ZA 4LN2A 3OY9A 2VGMA 1PC0A 4BI3A 1UE9A 5KYNA 1YJNQ 1W2BP 4E7JA 1PM3A 2J05A 2RK2A 2AIRB 3VS6A 4C92G 2QA4Q 4KULA 1TSFA 2LQ8A 1I4K1 3VS5A 1VQPT 4BACA 2HL3A 1LJOA 2MWPA 2D9TA 3OYCA 3SWNA 1M8MA 2DO3A 2QQBA 1ZSGA 2FG0A 3V8LA 4C0DB 3CD6T 1VYUA 2M1HA 5DLOA 1AWJA 2XICA 1U8RA 3CCRA 2F69A 1OQKA 3HTRA 3FRNA 3E1SA 1H3HA 4J9BA 5LJ5g 1VQ9A 5GAN2 2RQTA 1M90R 1HK9A 2PU9B 3OYIA 5LJ3f 1N9RA 3QDRB 3A8HB 4XTVA 5HY6A 2OI3A 2FZCB 1QW1A 2A3LA 3LWIA 3G4SQ 2HEQA 2GTOA 3VS4A 1YJ9Q 2YUOA 4DEXA 4QW2A 2K5FA 4OB0B 3JRZA 2DNUA 1VQ5Q 1M9SA 1OOTA 4ZGEB 2BE7D 2R5MA 5GMKm 2AT1B 3NMZC 3VUZA 3CPFA 3M55A 3UA7A 4PL6A 2PVOB 2MK5A 3C0CA 4OVAA 1G3TA 1PKSA 1I1JA 2COYA 3EHRA 2E1HA 3VRYA 1BCMA 1RAAB 2XU8A 4C92D 3EG3A 2BTTA 1AEYA 3GNGA 1WA7A 2G6FX 3Q1JA 1QVGP 3OYJA 2FRWA 5FWCA 2EQMA 5CCAA 2DFUA 4XQ3A 1MMAA 1D3BA 3JCMd 3QJ6A 3PVLA 4ZGJB 3NTHA 5LJ3e 3CCUQ 4KH0B 1J3TA 3ASKA 3CC2T 2RHZA 2Z0WA 4QVCA 4OMNA 2AK5A 2DL7A 5CAIA 1VQ4T 1VQPA 4DOWA 2JTEA 4AT1B 2LCSA 3CCLA 1EFNA 3CD6A 4EMKA 2DAQA 3JCMV 4KGZB 3PT9A 4XU0A 1NZ9A 2DRMA 4J7FA 5DM7R 3M0RA 1K73R 3E19A 1VOMA 2CP0A 2KY9A 3VS0A 4E6RA 2PTKA 2JTFA 1UG1A 3CC4A 2L3QA 1YJNT 2K57A 3EFOA 1MNEA 4J9IA 2QA4T 1B34B 1R77A 1YWPA 4C5GA 3FLGA 3O8VA 1QWFA 2JS0A 2HMAA 2O2OA 5EC7A 1Y71A 3HHTB 3I35A 1NPPA 3QYHB 3H0HA 4JS4A 4HCCA 1D1AA 4FW1A 5KCOA 2VWFA 2JNGA 1Q82R 4J83A 1Q95G 3DB3A 3P8DA 3V7CA 4RG8A 4FYWB 2QGGA 2DYIA 2QXFA 4M78E 4DA4A 2A36A 1IB8A 1WHJA 2K5LA 1YFNA 5CQXA 4XTXA 4LDXA 2QASA 2RPNA 2LX9A 1NE8A 4OMQA 2DM1A 1VQOQ 2BIVA 2DIGA 4GBQA 4M77A 2XKOC 1GCPA 2CT3A 1GCQC 3PVQA 3G7ZA 4ZN1A 3E9GA 2QK0A 1AT1B 4BDYA 1G5VA 1M1KR 4C5IA 2E70A 2X4WA 1ZSZC 1VQ5T 2L89A 4FIBA 3CXCP 1OI1A 5AT1B 2VASA 6AT1B 3LLRA 2BUDA 2YUNA 1RAHB 3CC2A 3OYHA 4Z88A 2EQJA 3CPWA 2E5KA 2K4YA 3VV0A 4JDSA 2RQVA 4JPBW 1VQ4A 1RI0A 7AT1B 5KYYB 5KYUB 1U1SA 1OPLA 1Q86C 1KHIA 4JJNK 3H0FA 5FWBA 4F7UE 1K0XA 3NTIA 4R55A 4DBRA 3FDRA 1ABQA 4WTOB 1TU0B 1D09B 2JTMA 4M75A 1D1BA 1OZ3A 2YHTA 1FMKA 1ZSZB 5EG2A 4F04B 5GAMg 1YNZA 1N8RR 4M78A 3VJPA 3PTAA 3CCMQ 2ZAEA 3NPFA 2EBPA 1OU9A 4F14A 3CCSQ 1OYXA 3CCUT 1WJQA 1MMNA 5LJ3d 1OEBA 3INZA 2DPPB 2KQWA 4M77G 2QA4A 2HCKA 5GAOp 2YLCA 2D8JA 1MV0B 2E12A 4F16A 1ZHIA 4C8QE 4F7UF 4E7LA 2YWWA 4ZGDB 4LUEA 1BCOA 4OB1B 4RCCA 4AFZC 5HKCA 1JXMA 2H3EB 1M90C 3UWNA 2E41A 8AT1B 3OYLA 2B86A 1NJIR 1GL5A 3EG0A 2OAWA 1YHQQ 2OTLA 1W70A 1MMGA 2DTIA 2PUKB 2DBMA 3A8GB 3MEAA 1KQSS 1UGVA 4M75G 4GLKA 2RQUA 4JRPA 1X6GA 4C8QF 3GNFB 1Q7YR 1UUEA 4M78G 4O5VA 1VQ5A 3H9NA 4MZMA 2LCLA 2CGHA 4A4FA 4PKCC 2WSEE 2C0OA 4RTTA 1XOVA 3CCQT 2YUPA 1D0YA 3JB9G 1ZA2B 3CC7Q 3CCEQ 3OYAA 2XDDA 4B6MA 4J8OA 5LJ5j 2KK4A 1VQOT 3G71A 2P0PA 4M77D 5DY9A 4AG1C 3JSCA 4QVDA 3WXMB 4RUGA 4L5GA 1JB0E 3MHXA 1WJRA 1WXUA 5CIUA 3F70A 2V8IA 2HDAA 3EAEA 1QVFS 2MMPA 1WNLA 1SG5A 4PJOA 2CSIA 1ZX6A 3CCUA 2I2LA 5HCKA 5D6XA 2JXBA 4MMLA 5AYFA 2DL4A 4F7UB 2D1XA 1YP5A 1SRMA 2L2PA 2FPFA 4LD9K 1W6XA 2SRCA 1RLQC 3TREA 1BIBA 2HKNA 4DEYA 2KDSA 2KYBA 2CYZB 2HBPA 2J06A 2QQAA 4L59A 3A5ZB 3C4SA 4M75D 1MV3A 2EYXA 1PNJA 4M78D 5GAN4 3JB9H 1VQ7Q 3D7SB 3CCMT 4ORZA 2OJ2A 2CUBA 2LRQA 2M0YA 3L2VA 1IREB 3I5RA 5GMKj 1RI9A 3LYIA 3JB9D 3A8LB 1BB9A
chains in the Genus database with same CATH topology
2JUFA 2RJFA 2H3JA 4C8QB 3JB9J 2B8AA 2EQKA 3JCMQ 3SDZA 2YLBA 5GAN3 3GPLA 1YIJA 4X34A 4E7JA 2KVQG 1Q81U 2PVGB 4HT8A 2CZ7B 2RK2A 5FRMA 4M7AA 2OTJT 3QZ5B 4C92G 2K3XA 1N9SA 3QUIA 4KULA 4ELZC 1Q7YU 1UB4A 2LQ8A 1I4K1 2WSCE 2LQKA 1UGPB 5LJ5h 1VQPT 4BACA 1BI1A 2L3RA 4ME7A 4PJOG 1LJOA 2MWPA 4RG2A 2F5KA 3G6EA 2D9TA 2DZ9A 3OYCA 1Y96A 3CCQA 1GXIE 3SWNA 4F7UA 2QQBA 2DO3A 3LH0A 3V8LA 4C0DB 3CD6T 3ER0A 1JRIA 2M1HA 4M7DA 2MAMA 2XICA 5DLOA 5GANg 1VQLA 4P5NA 1U8RA 1YIJT 3CCRA 3L2QA 2VGNA 1FX7A 2F69A 2RI2A 1BKBA 3H8ZA 2D0QB 4RCBA 4A54A 1PSEA 3JCMc 1YHQT 3TCJA 5A0DA 3PFSA 1XNIA 3FRNA 3BFMA 3E1SA 2LCCA 3CMET 1M4ZA 3V7RA 5LJ5g 4M77F 4JUVA 5GANe 1VQ9A 4KUDK 2HNIA 4XK8E 4EMKC 2CZ6B 3MEVA 5C6SA 5GAN2 5CVIA 4NOYA 5GMKi 4C5HA 5GAOn 1NPRA 1HK9A 3JCMW 2PU9B 4IKFA 2XHCA 3LGFA 3OYIA 5LJ3f 3M59A 3UPUA 1N9RA 4EDUA 3L42A 3A8HB 3QDRB 4M75E 4XTVA 1BI2A 5HY6A 3GP8A 3OW2S 1D3BB 1QW1A 2ZCFB 2A3LA 5LJ5e 1WGSA 3HRSA 3LWIA 2K2VA 3J7AF 2DD4A 2V8KA 1KHCA 3L2RA 3VYGA 1H3ZA 3M4GA 3OYFA 2XD0A 2FVUA 4OP0A 1KQ1A 4FM4B 4QW2A 2EJGA 4MDXA 2RJEA 2LDMA 3UDCA 4C8QA 2RHUA 1WPYA 2K5FA 2X4XA 4TVRA 4OB0B 3JRZA 2DZCA 2P0QA 4HKEA 4J6YA 1TH7A 3RESA 3X28B 4PLIA 4MDWA 3CC7T 3G4ST 5LJ5d 3CCET 1M9SA 3MO8A 4FT4A 4JS5A 3J80E 4GY5A 4ZGEB 2GQVA 2R5MA 5GMKm 4X9CA 4CI0C 1YJ9T 4LDYA 3OMCA 4EMKB 1UEBA 4M7AG 2EIFA 3OYYA 2MWOA 3VUZA 4C8QD 3CPFA 3M55A 5LJ3h 4BB7A 2QTXA 1W2BA 4PL6A 4XTYA 3VUBA 4BI4A 2PVOB 4VUBA 4OVAA 4FU6A 3S6WA 1G3TA 1KQ2A 4LD6A 5M9OA 4C0ZA 4A4EA 2E5QA 2E1HA 1R8OB 2ZZDA 4M75F 3OBYA 3CCJT 1VQ6T 2XU8A 4J5YA 4NS5A 4C92D 4F7UG 1YI2A 3FB9A 3HL8A 4XTUA 3X24B 4M7DG 4M78F 3OA6A 4JRIA 2DTOA 2VC8A 2L8DA 3CCMA 3GNGA 3BW1A 1Q86U 2KMTA 4PJOD 1AHJB 2LVMA 5FRNA 3HSBA 1VQMT 3Q1JA 2EJ9A 4IUVA 5GANf 1ZBXA 3JB9I 1WQ7A 3OBWA 5LJ3g 3OYJA 2EQMA 3BDUA 4M77C 2KSSA 5CCAA 2HD0A 4XQ3A 1K73C 3RUXA 1Y07A 3JB9F 1D3BA 3JCMd 3QJ6A 4XTWA 2IVWA 2K5IA 5L8RE 3RKYA 3PMTA 2FYKA 4QVZA 4ZGJB 2EJFA 3NTHA 2PVDB 1X75C 2ZGWA 4N4IA 5LJ3e 3ASKA 3CC2T 2RHZA 2OTJA 5IAYA 4QVCA 2DEQA 2ZPFB 2EQUA 2RHIA 5GMKe 2D6FA 2DXCA 3DLLA 4A4KA 5CAIA 4IURA 1KC8U 1VQ4T 1VQPA 1M8VA 4DOWA 3NTKA 1YBYA 3HFOA 4UC4A 1W4SA 1YJNA 2CS7A 2F5TX 4FL6A 3FC3A 3CCLA 3E9FA 4C8QG 4MZTA 5GAOr 3MEWA 3I56T 2E6ZA 4BUGA 5CKDA 1X01A 4JRQA 3CD6A 4EMKA 2DAQA 3URGA 3JCMV 1VQ7T 1H641 3QO3A 3PT9A 1M1FA 4XU0A 5GANh 4X9DA 3ZFJA 3V8JA 2C06A 3MEUA 3OSSC 3MCAB 1Q82C 1YHQA 1K9MU 4M77B 5GAMj 4V2SA 1W2BS 4BE0A 1NZ9A 4J7FA 5DM7R 5GAOm 3P8BB 3GOXA 5IT9E 3CMEA 3E19A 2RK1A 2KY9A 2VYTA 3V7SA 2WACA 3HRTA 2JTFA 2MF2A 4QQGA 5GAN5 3DKMA 3QIIA 4EPCA 3ZEHA 3CC4A 2RA2A 3LX7A 3M57A 5GAN7 4E7IA 1YJNT 4C5EA 1Q7YC 2K57A 1M90U 3CCLT 4M75C 2FB7A 3S3NA 1KD1C 2DKGA 2M0OA 4IUUA 1YITA 3C95A 4M7AD 3CPWS 2QA4T 1B34B 5GAN6 4C92E 2M16A 4M78C 4C5GA 3FLGA 3O8VA 1VQKA 1K8AU 2RJDA 4OB3B 4E7HA 4PJOE 1Y71A 3HHTB 1NPPA 2LC4A 3V8KA 3QYHB 4KBMB 4JS4A 5KE3A 2RI3A 4HCCA 1KG1A 1YJWA 4M7DD 1ZQ1A 5KCOA 3CC4T 1LNXA 2JNGA 2DIQA 3G4SA 4J83A 3P8DA 3DB3A 5CQYA 3V7CA 2DJZA 2Y4YA 3CCEA 1QVGA 1M1KC 2DK3A 4RG8A 2K3YA 2OAUA 1YITT 3CBMA 5KCHA 4XU1A 5GMKl 1YJ9A 5HK0A 2DTHA 3OYBA 3FEOA 3JCMP 3OYEA 2QXFA 2FL7A 4M78E 1VQKT 4E47A 4DA4A 2K5LA 5GAMe 4M75B 5GANd 1VQ8T 2G3RA 1N27A 5CQXA 4XTXA 3CMAT 4LDXA 2XI9A 4NL3A 1G3WA 1VIEA 1NE8A 2LX9A 2R57A 4N0AC 1MGQA 2DXTA 4M78B 5GAMf 1O9SA 3DLMA 3CCJA 1IZ6A 2BIVA 2DIGA 3A8MB 1YJWT 3HKSA 1VQ6A 3SFMA 4M77A 2XKOC 4C92F 2EAYA 2VUBA 1U1TA 3HRUA 4KUIA 3ME9A 3LW5E 4JLIA 4BE1A 3G7ZA 1QP3A 5FLXE 4ZN1A 4PJOF 1VQMA 4XU2A 3E9GA 4OMFB 4BDZA 4BDYA 1G5VA 4PLLA 2X35A 2XG8D 4C5IA 2E70A 2XIDA 2X4WA 4WF2A 4J6XA 1VQ5T 2DXUA 2L89A 3SB2A 5A0LA 4FIBA 1OI1A 1SSFA 4IUQA 4MMKA 1B34A 5GMKh 1N8RC 4FSXA 3CCVT 3CBOA 2KAFA 4Y28E 2QEXA 1XTDA 3CXCS 3LLRA 4EMHA 2BUDA 4R56A 4IUPA 3LWHA 3CC2A 4QQDA 4O6JA 4M7AE 1JJ2A 2RHXA 3DB4A 5GAOq 3OYHA 2EQJA 3CPWA 2K4YA 1EIFA 2EKOA 3VV0A 4JDSA 5GAMh 5GAN8 1VQ4A 1RI0A 4XU3A 3X20B 4ZTFA 2CZ1B 3I55T 2RHYA 3OQ5A 3QJYA 5A0GA 1U1SA 4ZTJA 4Y91A 1Q86C 1KHIA 3T9NA 3M54A 3OYMA 4JJNK 3HP9A 1QVGS 3I56A 3RERA 5FU6C 4F7UE 3TU4K 2ZPEB 3KXTA 2M9UA 2QQRA 3NTIA 5CKHA 4OF1A 4BI3A 1VQ7A 4M7DE 4R55A 1FWZA 2QEXT 4HCZA 4LDUA 3FDRA 3GLXA 3N5BB 2JTMA 1I81A 1OZ3A 2YHTA 4M75A 3CC7A 4ELYC 3PMIA 5EG2A 5GAOl 4RKUE 3MP1A 5GAMg 1K73U 3OYKA 1KQSA 4C8QC 2E64A 4M78A 3QBYA 2P4TA 3VJPA 3L2UA 3PTAA 3QSUA 2XDPA 4L6V5 3X26B 3L1AA 2RM4A 5KE2A 4RMOA 5D6YA 1NJIC 5D6WA 4JRKA 3M56A 1OYXA 3J81E 2NLUA 3UT1A 1BIAA 1WJQA 2CKKA 2LTOA 3C12A 1LOJA 2X4YA 3INZA 4OB2B 5LJ3d 2DPPB 2KQWA 4C92C 4M77G 2QA4A 2JVVA 4M7AF 2DXBA 3EFSA 5GAOp 1MHNA 2QDYB 4OGCA 2AHJB 3NFCA 1UGSB 1I5LA 4A53A 2YLCA 2E10A 1VQNT 3WVDB 4PJOC 4XAXB 5FU6B 5J26A 4BI8B 2QQ9A 2RB6A 2RJCA 2E12A 2RD1A 4NL2A 2RH2A 4IUTA 1ZHIA 4LDWA 1Q81C 3CCST 4C8QE 4F7UF 4E7LA 1FXXA 5GAMd 4M7DF 4ZGDB 4ZN3A 3PIPA 2GFAA 1Q82U 4OB1B 4RCCA 1G3SA 5I21A 4N0AA 3RMQA 1JJ2S 5HKCA 4OGEA 2JN0A 4D6WA 1RL2A 2FHDA 5FROA 2DD5A 2VXFA 3M5AA 1M90C 2EYQA 3QHSA 3GIBA 2GCXA 1S72T 3CXCA 1QVPA 3UWNA 3L2WA 1VUBA 3AHUA 2ZPBB 2E41A 3OYLA 2JOYA 1VQ8A 4HCBA 3VU3C 2YRVA 3CMAA 3PNWC 5CO7A 1M5Q1 3WVEB 2MI6A 3MP6A 1BI0A 3EFRA 4C92B 1KD1U 5CKEA 1QVFA 4XTZA 5CK9A 1K8AC 2VXEA 2OTLA 3KUFA 2ZPIB 2DTIA 1DJ7B 2PUKB 3M4YA 3JCMf 3L2ZA 4B9XA 4PJOB 1UGRB 3A8GB 2LT4A 3MEAA 3H6ZA 4J6WA 1KQSS 4B9WA 3HFNA 4M75G 3OYGA 4C0GA 2BKDN 4GLKA 5J39A 3JCMb 4JRPA 3S3MA 4C8QF 3P8HA 3QPHA 3PIOA 3GNFB 3OS0A 3BY7A 1M1KU 1VQOA 2E6NA 3MP8A 4M78G 1WQWA 4O5VA 4C0FA 1VQ5A 2O01E 2O4XB 1QP2A 2XK0A 2LCLA 4MZMA 2CGHA 1M1GA 4Q5WA 3RIRA 1BI3A 2R58A 4A4FA 3C94A 3QG1A 4PKCC 3CCVA 2WSEE 5CKFA 2OTLT 3VKIA 2WSFE 3G6ET 3VYHB 2GFUA 1XOVA 3OSVA 3QXEB 3CCQT 5GANj 4M7AC 4QQ6A 3A8OB 3META 3S3OA 4MZPA 4LDVA 5IN1A 5LL6S 3JB9G 1VQLT 3OMGA 4FT2A 3CCRT 3OYAA 2XDDA 1N6AA 2RI5A 4Z02A 3I55A 3OS2A 3KBGA 4J8OA 3JCMh 2LNVA 2VV5A 2Y4XA 4EMGA 5A2QE 5LJ5j 2HQXA 3M58A 3OYDA 2KK4A 3SD4A 1VQOT 3SWNC 5CR2A 3G71A 2P0PA 4M77D 5DY9A 3M53A 3JSCA 3RKWA 1VQ9T 4M7DC 1XQHA 4QVDA 2IG0A 1P92A 3WXMB 4L5GA 2P0KA 1PSFA 3TEEA 1JB0E 3MHXA 1WJRA 2A7YA 5CIUA 5J3BA 3F70A 2V8IA 3OS5A 3EAEA 2L5QA 4II1A 3HPWA 4C92A 4BE2A 2HQEA 4BY6C 1QVFS 1WJSA 2R5AA 1N8RU 2DVEA 4A4GA 3X25B 3JCMg 2MMPA 2JZ2A 3M9QA 5DLQE 1WNLA 4M7AB 3RKXA 3PGGA 4PJOA 3CCUT 3JAME 2ZPHB 3OB9A 3GF5A 3G71T 3CCUA 2I2LA 1S72A 4PNOA 4DOVA 3ZBDA 2Y90A 4J7IA 3JCMe 5FU7C 2XDBA 5D6XA 5AYFA 4MMLA 1I8FA 1Y96B 2E65A 3FJPA 3SWNB 4F7UB 2PQWA 2ZPGB 1VQNA 2O4XA 5C0MA 1Y7XA 4YTLA 1BYMA 4LD9K 3CBPA 3CEYA 4HA8A 4M7DB 2EFIA 3TREA 3CCSA 1BIBA 1HXDA 4CRIA 1UGQB 2CZ0B 4N4GA 2KDSA 2CYZB 2HBPA 3FIFA 5CKBA 5HK3A 5KH6A 3BDLA 4A4HA 2EWNA 3QZ9B 3QYGB 2QQAA 3R6OA 4L59A 3A5ZB 3C4SA 1JBMA 4M75D 4BY6B 1KC8C 2RO0A 3JCMX 5LJ5f 1G3YA 1YI2T 4KT0E 1YCYA 5I2MA 2HAXA 4DQ2A 2GF7A 4M78D 2V8JA 5GAN4 4ATOA 4BD3A 1OZ2A 3LGLA 3JB9H 3CCMT 2X4JA 1O75A 1NJIU 5I2SA 3OW2A 2QI2A 4C0DC 5LJ3j 2LRQA 3QKJA 3L2VA 1VIFA 1IREB 1X6OA 2PUOB 2LT1A 1K9MC 4HT9A 5FU7B 3JCMJ 3RMSA 4JLGA 1V29B 5GMKj 3OS1A 3OY9A 3LYIA 2VGMA 3OYNA 4M77E 3JB9D 2QQSA 3A8LB 4E7KA 4N4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RH2 A;  3SFM A;  1VIE A;  2RK1 A;  2VV5 A;  2OAU A;  3T9N A;  3UDC A;  1VIF A;  2GQV A;  2P4T A;  2RK2 A; 
#chains in the Genus database with same CATH topology
 2JUF A;  2RJF A;  4C8Q B;  5I11 A;  3SDZ A;  3CCL Q;  1U3O A;  2KVQ G;  2CZ7 B;  5FRM A;  1K9A A;  2KYM A;  1AWX A;  4ELZ C;  2RNA A;  2GNC A;  5LJ5 h;  2L3R A;  1AWW A;  4PJO G;  2F5K A;  3CCQ A;  1Y96 A;  3LH0 A;  1KJW A;  3CC4 Q;  4M7D A;  4PFZ A;  1KIK A;  2VGN A;  2RI2 A;  4A54 A;  1K9M R;  2D0Q B;  1WHL A;  1IGU A;  1YHQ T;  2K3B A;  4CC7 A;  5A0D A;  1XNI A;  3BFM A;  2LCC A;  3CME T;  4CC3 A;  5GAN e;  2KE9 A;  4XK8 E;  5C6S A;  3MEV A;  2P4R A;  4NOY A;  5GMK i;  5GAO n;  1NPR A;  1UFF A;  2NUT A;  4EDU A;  3L42 A;  1BI2 A;  1GFC A;  3OW2 S;  1NM7 A;  2K2V A;  4KGV B;  2BZX A;  1K8A R;  3VYG A;  3M4G A;  3OYF A;  2EYY A;  4OP0 A;  2GBQ A;  4MDX A;  2EJG A;  2K6D A;  2RJE A;  1WPY A;  2X4X A;  2P0Q A;  2DL3 A;  1ABO A;  3CC7 T;  5LJ5 d;  3CCE T;  4FT4 A;  2JS2 A;  3J80 E;  4GY5 A;  4CI0 C;  3OMC A;  4C8Q D;  4BB7 A;  1W2B A;  4WCI A;  4XTY A;  1WDX A;  3S6W A;  2DET A;  5M9O A;  4C0Z A;  4A4E A;  2JMA A;  2ZZD A;  4HVV A;  2CP7 A;  1PWT A;  2J6F A;  1NLP C;  2NUP B;  3X24 B;  4M7D G;  3CCM A;  1E7O A;  2L8D A;  2VC8 A;  3BW1 A;  1Q86 U;  1PD0 A;  4PJO D;  1AHJ B;  5FRN A;  3HSB A;  3JV3 A;  3CC2 Q;  1M27 C;  1ZBX A;  1K1Z A;  1WQ7 A;  3BDU A;  1JU5 C;  4XTW A;  2IVW A;  2MIO A;  2FYK A;  2CH4 A;  2PVD B;  2ZGW A;  5IAY A;  1UJ0 A;  2ZPF B;  1ZUK A;  2D6F A;  4A4K A;  1M8V A;  1M3C A;  3NTK A;  1YBY A;  3HFO A;  1W4S A;  2CS7 A;  3VS3 A;  4FL6 A;  3FC3 A;  3E9F A;  2DE0 X;  1X01 A;  2EYW A;  1PG5 B;  1VQ7 T;  5GAN h;  1M1F A;  2C06 A;  4LNP A;  3MCA B;  1YHQ A;  4A63 B;  5GAM j;  3P8B B;  1QKX A;  1TUG B;  3CME A;  2VYT A;  3REB B;  1KSW A;  3QII A;  4EPC A;  4RTW A;  3M57 A;  1M90 U;  4E7I A;  1Q7Y C;  1LPL A;  3CCL T;  3S3N A;  2DKG A;  3CPW S;  2AKL A;  2RJD A;  2CUD A;  2W0Z A;  2JM9 A;  1B3Q A;  2LJ3 A;  2LC4 A;  1QCO A;  4KBM B;  2K2M A;  2H8H A;  4AG2 C;  2RI3 A;  3R6N A;  1KG1 A;  1I5O B;  4M7D D;  1B07 A;  1TUD A;  1LNX A;  3CC4 T;  1V1C A;  3CC7 A;  3CCE A;  2HSE B;  5CQY A;  2FZK B;  2DJZ A;  2Y4Y A;  3M0P A;  1QVG A;  1KQS P;  1EX4 A;  2QTV A;  2OTL Q;  2V26 A;  3OYB A;  3FEO A;  3OYE A;  5IXF A;  5GAN d;  1VQ8 T;  1KD1 R;  1VIE A;  4N0A C;  1MGQ A;  1SEM A;  1IZ6 A;  3HKS A;  1SPK A;  1U5S A;  3ME9 A;  3LW5 E;  4BE1 A;  1QP3 A;  5FLX E;  3RR6 A;  1MMD A;  1JO8 A;  4PLL A;  2XID A;  2DIL A;  1AWO A;  2RN8 A;  4MMK A;  1B34 A;  2QEX A;  3G71 Q;  3MKD A;  1G83 A;  4IUP A;  3LWH A;  1QVF P;  4M7A E;  1UHC A;  1X2Q A;  4JJC A;  1EIF A;  5GAM h;  5GAN 8;  3X20 B;  4XU3 A;  4ZTF A;  2RHY A;  3A98 A;  2MPX C;  5IXB A;  4ZTJ A;  3OYM A;  4FSS A;  2J6O A;  1X69 A;  2GQI A;  2D0N A;  3KXT A;  2F2V A;  2M9U A;  4OF1 A;  1VQ7 A;  2ROL A;  1OX8 A;  2CSQ A;  2COW A;  4LDU A;  2F1L A;  3GLX A;  2DER A;  3N5B B;  1I81 A;  3ULR B;  4ELY C;  2ESW A;  2P84 A;  1KFZ A;  3MP1 A;  1K73 U;  3OYK A;  2E64 A;  1OX9 A;  2P4T A;  3L2U A;  3QSU A;  2XDP A;  1IHV A;  3X26 B;  3L1A A;  1PKT A;  2LMJ A;  2NLU A;  3VS2 A;  4PK4 A;  2LTO A;  3C12 A;  2X4Y A;  4M7A F;  2JVV A;  1F1B B;  1MHN A;  4OGC A;  4A53 A;  5IHN A;  3EGD B;  4XAX B;  4BI8 B;  2RB6 A;  2E4H A;  4IUT A;  4LDW A;  2ENM A;  5GAM d;  1OU8 A;  1UEC A;  3PIP A;  4ZN3 A;  1Q82 U;  2GFA A;  5I21 A;  1JJ2 S;  2RMO A;  4D6W A;  3GBQ A;  5FW9 A;  1IHW A;  5FRO A;  4AFU C;  2VXF A;  1CKB A;  2EYQ A;  3QHS A;  3GIB A;  5KYY A;  3CXC A;  3AHU A;  1VUB A;  2ZPB B;  5KYU A;  1VQ8 A;  2RQW A;  5KYX B;  1GCQ A;  3MP6 A;  4E7Z A;  1K8A C;  2VXE A;  3EGX B;  2ZPI B;  1TS9 A;  4B9X A;  1ZSZ A;  2X3W D;  2ABL A;  1BU1 A;  2KI7 A;  3CCQ Q;  1Q81 R;  1CSK A;  2NWM A;  2CP2 A;  1ZUU A;  1Y57 A;  3QPH A;  3TSW A;  1M1K U;  2LP5 A;  2O4X B;  2XK0 A;  3JAM E;  4F17 A;  2OTL T;  3OW2 P;  2FPD A;  4M7A C;  2X3X D;  5IN1 A;  1QKW A;  4FT2 A;  1N6A A;  3KBG A;  2DBK A;  2VV5 A;  2Y4X A;  4EMG A;  2KR3 A;  5CR2 A;  2A0F B;  2DA9 A;  3RKW A;  2IG0 A;  4DBH A;  4E7S A;  1PRL C;  1X6B A;  3CCJ Q;  1VQ6 Q;  4II1 A;  1WJS A;  2R5A A;  1N8R U;  2DVE A;  2LQN A;  3JCM g;  2JZ2 A;  3RKX A;  4M7A B;  3PGG A;  2O9S A;  3G71 T;  4FW2 A;  1SSH A;  4DOV A;  2F2W A;  2IPO B;  5FU7 C;  1I8F A;  3FJP A;  4YTL A;  1D0X A;  3CEY A;  4HA8 A;  1HXD A;  1WHG A;  4CRI A;  1RAE B;  1UGQ B;  2FO0 A;  5KH6 A;  3BDL A;  4CC2 A;  3R6O A;  2LNH B;  2X9H A;  2RO0 A;  5LJ5 f;  1YCY A;  1WHH A;  5I2M A;  1HD3 A;  4DQ2 A;  2GF7 A;  2V8J A;  2X4J A;  1NJI U;  2DL5 A;  2PNI A;  1JXO A;  1QLY A;  3SEM A;  4DBF A;  2PUO B;  1E6H A;  4HT9 A;  2QG9 B;  4X1V A;  5FU7 B;  3JCM J;  1V29 B;  3OS1 A;  5KYW B;  3OYN A;  2QQS A;  4E7K A;  3H0I A;  4LE9 A;  5GAN 3;  1YIJ A;  1UHF A;  2YSQ A;  3MPU B;  2PVG B;  2QAZ A;  4HT8 A;  2JT4 A;  2DMO A;  3QZ5 B;  3QUI A;  4PJM A;  1Q7Y U;  1KC8 R;  2QYZ A;  1UGP B;  4RG2 A;  3CME Q;  4F7U A;  2MAM A;  2MYS A;  4P5N A;  4RCB A;  1BKB A;  4PFP A;  3JCM c;  3EG9 B;  3PFS A;  2KXC A;  1M4Z A;  3E2U A;  3V7R A;  2L3S A;  4JUV A;  4KUD K;  2HNI A;  1NYF A;  1QCN A;  4FYV B;  2COZ A;  3JCM W;  3UPU A;  1ZLM A;  1S1N A;  3GP8 A;  3QDF A;  5LJ5 e;  1WGS A;  3HRS A;  2V8K A;  1KHC A;  2LX7 A;  1RAF B;  1KQ1 A;  2FEI A;  3UDC A;  2RQR A;  4C8Q A;  4TVR A;  1BK2 A;  4HKE A;  4J6Y A;  1TH7 A;  3RES A;  3X28 B;  4PLI A;  2IIM A;  2CP5 A;  3MO8 A;  4JS5 A;  1U06 A;  2GQV A;  4X9C A;  1UEB A;  1WYX A;  2EIF A;  3VS7 A;  2MWO A;  2QTX A;  2CP3 A;  4FU6 A;  1GBQ A;  4LD6 A;  3I55 Q;  2E5Q A;  1R8O B;  3OBY A;  3CCJ T;  1VQ6 T;  4J5Y A;  4F7U G;  1NLO C;  1CKA A;  4XTU A;  4OMO A;  4HCK A;  4JZ4 A;  2DTO A;  2ECZ A;  2QEX Q;  2KMT A;  5GAN f;  3OBW A;  5LJ3 g;  1PRM C;  1R0B G;  2HD0 A;  1HSQ A;  1K73 C;  1LVK A;  5L8R E;  3RKY A;  4N4I A;  3M0T A;  1S72 Q;  1ARK A;  3TQ7 P;  3M0S A;  2DEQ A;  4KH1 B;  2EQU A;  5GMK e;  2DXC A;  1I07 A;  4IUR A;  4UC4 A;  2F5T X;  4C8Q G;  5GJW B;  3MEW A;  5CKD A;  2YRD A;  1PHT A;  1H64 1;  4X9D A;  3VRZ A;  3MEU A;  1K9M U;  1Q82 C;  4V2S A;  4JJB A;  1AVZ C;  3GOX A;  2RK1 A;  3V7S A;  2WAC A;  2MF2 A;  1JJ2 P;  2KRS A;  2NUP A;  1V76 A;  2RA2 A;  3SHW A;  2FB7 A;  2M0O A;  4IUU A;  1YIT A;  2BZ8 A;  4EIK A;  4C92 E;  2DLP A;  2M16 A;  2HQH A;  1VQK A;  1K8A U;  2GTJ A;  3AT1 B;  3V8K A;  1D0Z A;  3I5S A;  5KE3 A;  1VQ8 Q;  1YJW A;  1NG2 A;  2CDT A;  1M1K C;  2K3Y A;  1QCF A;  3G6E Q;  4XU1 A;  5HK0 A;  2DTH A;  3JCM P;  1WXT A;  4LUD A;  1VQL Q;  1SHG A;  1AZG B;  2G3R A;  1N27 A;  1GBR A;  2XI9 A;  2YDL A;  1OPK A;  2R57 A;  2DXT A;  5GAM f;  2ED0 A;  3DLM A;  1YCS B;  3CCJ A;  3M0U A;  1VQ6 A;  1WZO A;  4RTX A;  3SFM A;  4C92 F;  2EAY A;  1TG0 A;  4KUI A;  4JLI A;  2JW4 A;  1JQQ A;  1NBE B;  2YXY A;  4OMF B;  2DJQ A;  4BDZ A;  2A37 A;  4FCY A;  3UF4 A;  2X35 A;  2XG8 D;  2DXU A;  1X27 A;  3SB2 A;  5A0L A;  1SSF A;  5GMK h;  1N8R C;  4FSX A;  3CBO A;  2KAF A;  4Y28 E;  3CXC S;  2EKH A;  2FPE A;  4QQD A;  4O6J A;  1FYN A;  3DB4 A;  4RTU A;  1WXB A;  2EKO A;  3I55 T;  3QJY A;  5A0G A;  4Y91 A;  3T9N A;  5FU6 C;  2LJ1 A;  3TU4 K;  5CKH A;  1ZBJ A;  2QEX T;  4HCZ A;  5GAO l;  1YI2 Q;  2DVJ A;  1KQS A;  2I0N A;  2RM4 A;  4AMC A;  5KE2 A;  1QWE A;  5D6Y A;  2E3I A;  1NJI C;  4JRK A;  1BIA A;  5GAM e;  1S72 T;  1LOJ A;  2HL5 C;  4C92 C;  3EFS A;  4PFO A;  4J9E A;  2FZG B;  1H8K A;  3WVD B;  5FU6 B;  5J26 A;  2RJC A;  2KEA A;  2YUQ A;  1TUC A;  2RD1 A;  2RH2 A;  3QWX X;  4FYY B;  4J9F A;  2OTJ Q;  1JEG A;  1M2V B;  4J9H A;  1FXX A;  3TVT A;  3U23 A;  4HVW A;  1G3S A;  4N0A A;  1FMV A;  3RMQ A;  3UA6 A;  1RL2 A;  2FHD A;  3M5A A;  1BBZ A;  3L2W A;  1YIJ Q;  4HCB A;  3VU3 C;  2YRV A;  1ZA1 B;  1C1A A;  3PNW C;  3IQL A;  3WVE B;  2MI6 A;  1OUL A;  1KD1 U;  4C92 B;  1AZE A;  1QVF A;  4XTZ A;  2M02 A;  2XMF A;  1K4U S;  1VYT A;  4D8D A;  3RNJ A;  1UGR B;  3O5Z A;  4OML A;  4QT7 A;  4J6W A;  4M4Z A;  2HBW A;  4B9W A;  3HFN A;  4C0G A;  1IGQ A;  5J39 A;  2NYS A;  3S3M A;  3PIO A;  3P8H A;  4QKU A;  1WQW A;  3EG2 A;  2O01 E;  3RIR A;  5L23 A;  4Q5W A;  2R58 A;  3C94 A;  1IRX A;  1E6G A;  5CKF A;  3VKI A;  3G6E T;  3QXE B;  3A8O B;  3EGD A;  1T0H A;  3MET A;  3S3O A;  4LDV A;  2HZY A;  5LL6 S;  1VQL T;  1WI7 A;  2RI5 A;  4Z02 A;  3I55 A;  3OS2 A;  3JCM h;  5A2Q E;  2HQX A;  1M3A A;  3M58 A;  3SWN C;  2AZV A;  1P92 A;  2P0K A;  2FRY A;  3TEE A;  5J3B A;  3THK A;  2VB6 A;  3OS5 A;  5KYX A;  2L5Q A;  1VA7 A;  2KGT A;  3HPW A;  4BE2 A;  2HQE A;  4BY6 C;  4A4G A;  3EGX A;  2AZS A;  4RTZ A;  1VQM Q;  2ZPH B;  3GF5 A;  2DEU A;  2VVK A;  1S72 A;  2O9V A;  1YWO A;  4CC4 B;  4KGX B;  1QMC A;  1M3B A;  1TOV A;  4FYX B;  2XDB A;  2VKN A;  3UAT A;  3SWN B;  2BE9 B;  2PQW A;  2BZY A;  2O4X A;  5C0M A;  1UDL A;  2CZ0 B;  4N4G A;  3FIF A;  4A4H A;  2EWN A;  3QYG B;  1JBM A;  4BY6 B;  3RDV A;  1YI2 T;  2L0A A;  4KT0 E;  3I56 Q;  1ACM B;  1YN8 A;  2ED1 A;  4BD3 A;  1OZ2 A;  3LGL A;  3OW2 A;  2QI2 A;  5LJ3 j;  3QKJ A;  1X6O A;  1K9M C;  5GJV B;  3RMS A;  4JLG A;  4M77 E;  4N4H A;  4OMP A;  1C6V X;  2H3J A;  3JB9 J;  2B8A A;  2EQK A;  3JCM Q;  3GPL A;  2YLB A;  3EGU A;  4X34 A;  1Q81 U;  4RTY A;  4M7A A;  2OTJ T;  2K3X A;  1N9S A;  1RAD B;  5I22 A;  1R0C B;  5D7U A;  1UB4 A;  3EH1 A;  2WSC E;  2LQK A;  4OMM A;  1BI1 A;  4ME7 A;  1G2B A;  1A0N B;  2HSP A;  4AFS C;  1EZZ B;  1UJY A;  3G6E A;  1SKU B;  4HVU A;  2DZ9 A;  1RAI B;  1QQJ A;  1GXI E;  3ER0 A;  3VS1 A;  1JRI A;  2GGR A;  5GAN g;  1VQL A;  2EYZ A;  1YIJ T;  3L2Q A;  1FX7 A;  3H8Z A;  1YIT Q;  1PSE A;  2NUZ A;  3TCJ A;  2CP6 A;  3NHN A;  5ECA A;  1VQK Q;  3RBB B;  2O31 A;  4M77 F;  1SHF A;  2V1Q A;  1AOJ A;  4EMK C;  2CZ6 B;  3CMA Q;  5CVI A;  2PZ1 A;  4C5H A;  4IKF A;  2KNB B;  2XHC A;  3LGF A;  3M59 A;  1RAC B;  4M75 E;  1YJW Q;  1D3B B;  2ZCF B;  3ZL7 C;  3J7A F;  2DD4 A;  3L2R A;  3QWY A;  1MND A;  5KYW A;  1H3Z A;  2XD0 A;  2FVU A;  4FM4 B;  2LDM A;  2DF6 A;  2RHU A;  4AFQ C;  2W10 A;  2DZC A;  4MDW A;  3G4S T;  1Z9Q A;  3CCV Q;  1M2O A;  2J6K A;  1YJ9 T;  2L3P A;  4LDY A;  4EMK B;  1AD5 A;  4M7A G;  3OYY A;  5LJ3 h;  3VUB A;  4BI4 A;  2V1R A;  4VUB A;  3M0Q A;  1KQ2 A;  4M75 F;  2M51 A;  2KRN A;  1YI2 A;  4NS5 A;  2KXD A;  3EG9 A;  3FB9 A;  3HL8 A;  3EFO B;  4M78 F;  3OA6 A;  4JRI A;  2LVM A;  1VQM T;  1WHK A;  2EJ9 A;  4IUV A;  3JB9 I;  2KBT A;  4M77 C;  2KSS A;  3RUX A;  1Y07 A;  3JB9 F;  2K5I A;  3PMT A;  4PJN A;  4QVZ A;  4PJL A;  2EJF A;  1X75 C;  2EW3 A;  2OTJ A;  4LXC A;  8ATC B;  2RHI A;  3DLL A;  1ZUY A;  1HYO A;  1KC8 U;  1I0C A;  1VQN Q;  1YJN A;  2K79 A;  4MZT A;  5GAO r;  3I56 T;  2E6Z A;  4BUG A;  4JRQ A;  2JM8 A;  3URG A;  2SEM A;  2LQW A;  3QO3 A;  2YRC A;  1SF9 A;  3V8J A;  2EPD A;  3ZFJ A;  3OSS C;  4M77 B;  1W2B S;  4BE0 A;  5GAO m;  1X43 A;  5IT9 E;  2LZ6 B;  1IXD A;  4J9C A;  4IIO A;  3HRT A;  4QQG A;  1IO6 A;  1K0S A;  5GAN 5;  3DKM A;  2O88 A;  3ZEH A;  1RUW A;  3LX7 A;  5GAN 7;  4C5E A;  3CPW P;  2AKK A;  4M75 C;  2J7I A;  1KD1 C;  1KK7 A;  3C95 A;  4M7A D;  2EGA A;  5GAN 6;  2ATC B;  4M78 C;  1RAG B;  4J9G A;  3G1J A;  2YT6 A;  2LJ0 A;  1B7T A;  4OB3 B;  4E7H A;  4PJO E;  1H92 A;  1FMW A;  2KRM A;  1K76 A;  2KT8 A;  1PCX A;  1ZQ1 A;  2DIQ A;  3G4S A;  1MUZ A;  2DK3 A;  2K9G A;  2A28 A;  2OAU A;  1YIT T;  3CBM A;  5KCH A;  5GMK l;  1YJ9 A;  4PJJ A;  1OV3 A;  2FL7 A;  3BE3 A;  4ESR A;  1VQK T;  3H41 A;  4E47 A;  3NGP A;  4M75 B;  4D8K A;  3CCR Q;  3CMA T;  2EGE A;  4NL3 A;  1TWB A;  1G3W A;  4K11 A;  3EHQ A;  4M78 B;  1O9S A;  3A8M B;  1YJW T;  3EG1 A;  1VQ9 Q;  2VUB A;  1U1T A;  3HRU A;  1T0J A;  1M30 A;  1N5Z A;  1VQM A;  4PJO F;  4XU2 A;  5IH2 A;  4WF2 A;  4J6X A;  4IUQ A;  3CCV T;  1UTI A;  1XTD A;  3LH5 A;  4EMH A;  4R56 A;  2EQI A;  2F2X A;  4Z8A A;  1JJ2 A;  2RHX A;  4GLM A;  5GAO q;  4J9D A;  3REA B;  1W1F A;  2CZ1 B;  2DRK A;  3OQ5 A;  4ZNX A;  1QVG S;  3RER A;  3M54 A;  3HP9 A;  4HXJ A;  3I56 A;  2ZPE B;  2QQR A;  4M7D E;  1WHM A;  1FWZ A;  2EVR A;  3PMI A;  4RKU E;  4C8Q C;  4JZ3 A;  3QBY A;  4L6V 5;  2DX1 A;  2CRE A;  4RMO A;  4E2F B;  5D6W A;  3M56 A;  3J81 E;  1T3L A;  3UT1 A;  2CKK A;  3I9Q A;  4OB2 B;  2KT1 A;  2DXB A;  2QDY B;  2AHJ B;  3NFC A;  1UGS B;  1I5L A;  2E10 A;  1VQN T;  4PJO C;  2QQ9 A;  2QDL A;  1X2K A;  4NL2 A;  1TTH B;  1Q81 C;  3CCS T;  3A1P A;  4M7D F;  1VQP Q;  4OGE A;  2JN0 A;  2A08 A;  3FJ5 A;  2DD5 A;  2GCX A;  4IIM A;  1QVP A;  2JMC A;  3CD6 Q;  1TXQ A;  1WFW A;  2ROT A;  2JOY A;  3TSZ A;  3CMA A;  5CO7 A;  4JJD A;  1M5Q 1;  1VYV A;  3MJX A;  1BI0 A;  3EFR A;  5CKE A;  4DBQ A;  2MCN A;  4KRT A;  4RTV A;  2RF0 A;  2KRO A;  5CK9 A;  3KUF A;  4Z89 A;  5IHI A;  1DJ7 B;  3JCM f;  3M4Y A;  3L2Z A;  4PJO B;  2LT4 A;  2DL8 A;  3H6Z A;  2CH4 W;  2OX7 A;  3OYG A;  2BKD N;  3JCM b;  3OS0 A;  3BY7 A;  1VQO A;  2E6N A;  1NYG A;  3MP8 A;  4C0F A;  1QP2 A;  3KFV A;  1C0M A;  1M1G A;  1BI3 A;  3QG1 A;  3CCV A;  2WSF E;  1NEG A;  3VYH B;  2GFU A;  1LCK A;  1G8X A;  1PD1 A;  2K7A A;  3OSV A;  5GAN j;  4QQ6 A;  4MZP A;  2HKQ B;  2EGC A;  3OMG A;  3CCR T;  1M2V A;  2QGF B;  2LNV A;  3OYD A;  3SD4 A;  3CQT A;  3M53 A;  1WLP B;  1VQ9 T;  4M7D C;  1XQH A;  5IHK A;  1PSF A;  2C0T A;  1GRI A;  1NEB A;  2A7Y A;  1WIE A;  4C92 A;  3X25 B;  1XJW B;  3M9Q A;  5DLQ E;  3PE0 A;  4Y92 A;  2X51 A;  1GFD A;  3OB9 A;  1T3S A;  4PNO A;  3ZBD A;  2Y90 A;  4R0K A;  1WX6 A;  4J7I A;  3JCM e;  4ANJ A;  2E65 A;  1Y96 B;  1VQN A;  2ZPG B;  1BYM A;  1Y7X A;  3CBP A;  2CT4 A;  4M7D B;  3EH2 A;  2EFI A;  3CCS A;  1HJD A;  2C0I A;  2JJ9 A;  9ATC B;  5HK3 A;  5CKB A;  2D8H A;  1SRL A;  2E3H A;  1VQ4 Q;  3QZ9 B;  1RLP C;  1KC8 C;  3JCM X;  1G3Y A;  2MOX A;  2HAX A;  4ATO A;  1RAB B;  2NUT B;  1O75 A;  1D1C A;  1Q86 R;  5I2S A;  1Y0M A;  4C0D C;  2DYB A;  1VIF A;  2LT1 A;  1Z9Z A;  4LN2 A;  3OY9 A;  2VGM A;  1PC0 A;  4BI3 A;  1UE9 A;  5KYN A;  1YJN Q;  1W2B P;  4E7J A;  1PM3 A;  2J05 A;  2RK2 A;  2AIR B;  3VS6 A;  4C92 G;  2QA4 Q;  4KUL A;  1TSF A;  2LQ8 A;  1I4K 1;  3VS5 A;  1VQP T;  4BAC A;  2HL3 A;  1LJO A;  2MWP A;  2D9T A;  3OYC A;  3SWN A;  1M8M A;  2DO3 A;  2QQB A;  1ZSG A;  2FG0 A;  3V8L A;  4C0D B;  3CD6 T;  1VYU A;  2M1H A;  5DLO A;  1AWJ A;  2XIC A;  1U8R A;  3CCR A;  2F69 A;  1OQK A;  3HTR A;  3FRN A;  3E1S A;  1H3H A;  4J9B A;  5LJ5 g;  1VQ9 A;  5GAN 2;  2RQT A;  1M90 R;  1HK9 A;  2PU9 B;  3OYI A;  5LJ3 f;  1N9R A;  3QDR B;  3A8H B;  4XTV A;  5HY6 A;  2OI3 A;  2FZC B;  1QW1 A;  2A3L A;  3LWI A;  3G4S Q;  2HEQ A;  2GTO A;  3VS4 A;  1YJ9 Q;  2YUO A;  4DEX A;  4QW2 A;  2K5F A;  4OB0 B;  3JRZ A;  2DNU A;  1VQ5 Q;  1M9S A;  1OOT A;  4ZGE B;  2BE7 D;  2R5M A;  5GMK m;  2AT1 B;  3NMZ C;  3VUZ A;  3CPF A;  3M55 A;  3UA7 A;  4PL6 A;  2PVO B;  2MK5 A;  3C0C A;  4OVA A;  1G3T A;  1PKS A;  1I1J A;  2COY A;  3EHR A;  2E1H A;  3VRY A;  1BCM A;  1RAA B;  2XU8 A;  4C92 D;  3EG3 A;  2BTT A;  1AEY A;  3GNG A;  1WA7 A;  2G6F X;  3Q1J A;  1QVG P;  3OYJ A;  2FRW A;  5FWC A;  2EQM A;  5CCA A;  2DFU A;  4XQ3 A;  1MMA A;  1D3B A;  3JCM d;  3QJ6 A;  3PVL A;  4ZGJ B;  3NTH A;  5LJ3 e;  3CCU Q;  4KH0 B;  1J3T A;  3ASK A;  3CC2 T;  2RHZ A;  2Z0W A;  4QVC A;  4OMN A;  2AK5 A;  2DL7 A;  5CAI A;  1VQ4 T;  1VQP A;  4DOW A;  2JTE A;  4AT1 B;  2LCS A;  3CCL A;  1EFN A;  3CD6 A;  4EMK A;  2DAQ A;  3JCM V;  4KGZ B;  3PT9 A;  4XU0 A;  1NZ9 A;  2DRM A;  4J7F A;  5DM7 R;  3M0R A;  1K73 R;  3E19 A;  1VOM A;  2CP0 A;  2KY9 A;  3VS0 A;  4E6R A;  2PTK A;  2JTF A;  1UG1 A;  3CC4 A;  2L3Q A;  1YJN T;  2K57 A;  3EFO A;  1MNE A;  4J9I A;  2QA4 T;  1B34 B;  1R77 A;  1YWP A;  4C5G A;  3FLG A;  3O8V A;  1QWF A;  2JS0 A;  2HMA A;  2O2O A;  5EC7 A;  1Y71 A;  3HHT B;  3I35 A;  1NPP A;  3QYH B;  3H0H A;  4JS4 A;  4HCC A;  1D1A A;  4FW1 A;  5KCO A;  2VWF A;  2JNG A;  1Q82 R;  4J83 A;  1Q95 G;  3DB3 A;  3P8D A;  3V7C A;  4RG8 A;  4FYW B;  2QGG A;  2DYI A;  2QXF A;  4M78 E;  4DA4 A;  2A36 A;  1IB8 A;  1WHJ A;  2K5L A;  1YFN A;  5CQX A;  4XTX A;  4LDX A;  2QAS A;  2RPN A;  2LX9 A;  1NE8 A;  4OMQ A;  2DM1 A;  1VQO Q;  2BIV A;  2DIG A;  4GBQ A;  4M77 A;  2XKO C;  1GCP A;  2CT3 A;  1GCQ C;  3PVQ A;  3G7Z A;  4ZN1 A;  3E9G A;  2QK0 A;  1AT1 B;  4BDY A;  1G5V A;  1M1K R;  4C5I A;  2E70 A;  2X4W A;  1ZSZ C;  1VQ5 T;  2L89 A;  4FIB A;  3CXC P;  1OI1 A;  5AT1 B;  2VAS A;  6AT1 B;  3LLR A;  2BUD A;  2YUN A;  1RAH B;  3CC2 A;  3OYH A;  4Z88 A;  2EQJ A;  3CPW A;  2E5K A;  2K4Y A;  3VV0 A;  4JDS A;  2RQV A;  4JPB W;  1VQ4 A;  1RI0 A;  7AT1 B;  5KYY B;  5KYU B;  1U1S A;  1OPL A;  1Q86 C;  1KHI A;  4JJN K;  3H0F A;  5FWB A;  4F7U E;  1K0X A;  3NTI A;  4R55 A;  4DBR A;  3FDR A;  1ABQ A;  4WTO B;  1TU0 B;  1D09 B;  2JTM A;  4M75 A;  1D1B A;  1OZ3 A;  2YHT A;  1FMK A;  1ZSZ B;  5EG2 A;  4F04 B;  5GAM g;  1YNZ A;  1N8R R;  4M78 A;  3VJP A;  3PTA A;  3CCM Q;  2ZAE A;  3NPF A;  2EBP A;  1OU9 A;  4F14 A;  3CCS Q;  1OYX A;  3CCU T;  1WJQ A;  1MMN A;  5LJ3 d;  1OEB A;  3INZ A;  2DPP B;  2KQW A;  4M77 G;  2QA4 A;  2HCK A;  5GAO p;  2YLC A;  2D8J A;  1MV0 B;  2E12 A;  4F16 A;  1ZHI A;  4C8Q E;  4F7U F;  4E7L A;  2YWW A;  4ZGD B;  4LUE A;  1BCO A;  4OB1 B;  4RCC A;  4AFZ C;  5HKC A;  1JXM A;  2H3E B;  1M90 C;  3UWN A;  2E41 A;  8AT1 B;  3OYL A;  2B86 A;  1NJI R;  1GL5 A;  3EG0 A;  2OAW A;  1YHQ Q;  2OTL A;  1W70 A;  1MMG A;  2DTI A;  2PUK B;  2DBM A;  3A8G B;  3MEA A;  1KQS S;  1UGV A;  4M75 G;  4GLK A;  2RQU A;  4JRP A;  1X6G A;  4C8Q F;  3GNF B;  1Q7Y R;  1UUE A;  4M78 G;  4O5V A;  1VQ5 A;  3H9N A;  4MZM A;  2LCL A;  2CGH A;  4A4F A;  4PKC C;  2WSE E;  2C0O A;  4RTT A;  1XOV A;  3CCQ T;  2YUP A;  1D0Y A;  3JB9 G;  1ZA2 B;  3CC7 Q;  3CCE Q;  3OYA A;  2XDD A;  4B6M A;  4J8O A;  5LJ5 j;  2KK4 A;  1VQO T;  3G71 A;  2P0P A;  4M77 D;  5DY9 A;  4AG1 C;  3JSC A;  4QVD A;  3WXM B;  4RUG A;  4L5G A;  1JB0 E;  3MHX A;  1WJR A;  1WXU A;  5CIU A;  3F70 A;  2V8I A;  2HDA A;  3EAE A;  1QVF S;  2MMP A;  1WNL A;  1SG5 A;  4PJO A;  2CSI A;  1ZX6 A;  3CCU A;  2I2L A;  5HCK A;  5D6X A;  2JXB A;  4MML A;  5AYF A;  2DL4 A;  4F7U B;  2D1X A;  1YP5 A;  1SRM A;  2L2P A;  2FPF A;  4LD9 K;  1W6X A;  2SRC A;  1RLQ C;  3TRE A;  1BIB A;  2HKN A;  4DEY A;  2KDS A;  2KYB A;  2CYZ B;  2HBP A;  2J06 A;  2QQA A;  4L59 A;  3A5Z B;  3C4S A;  4M75 D;  1MV3 A;  2EYX A;  1PNJ A;  4M78 D;  5GAN 4;  3JB9 H;  1VQ7 Q;  3D7S B;  3CCM T;  4ORZ A;  2OJ2 A;  2CUB A;  2LRQ A;  2M0Y A;  3L2V A;  1IRE B;  3I5R A;  5GMK j;  1RI9 A;  3LYI A;  3JB9 D;  3A8L B;  1BB9 A; 
#chains in the Genus database with same CATH homology
 2JUF A;  2RJF A;  2H3J A;  4C8Q B;  3JB9 J;  2B8A A;  2EQK A;  3JCM Q;  3SDZ A;  2YLB A;  5GAN 3;  3GPL A;  1YIJ A;  4X34 A;  4E7J A;  2KVQ G;  1Q81 U;  2PVG B;  4HT8 A;  2CZ7 B;  2RK2 A;  5FRM A;  4M7A A;  2OTJ T;  3QZ5 B;  4C92 G;  2K3X A;  1N9S A;  3QUI A;  4KUL A;  4ELZ C;  1Q7Y U;  1UB4 A;  2LQ8 A;  1I4K 1;  2WSC E;  2LQK A;  1UGP B;  5LJ5 h;  1VQP T;  4BAC A;  1BI1 A;  2L3R A;  4ME7 A;  4PJO G;  1LJO A;  2MWP A;  4RG2 A;  2F5K A;  3G6E A;  2D9T A;  2DZ9 A;  3OYC A;  1Y96 A;  3CCQ A;  1GXI E;  3SWN A;  4F7U A;  2QQB A;  2DO3 A;  3LH0 A;  3V8L A;  4C0D B;  3CD6 T;  3ER0 A;  1JRI A;  2M1H A;  4M7D A;  2MAM A;  2XIC A;  5DLO A;  5GAN g;  1VQL A;  4P5N A;  1U8R A;  1YIJ T;  3CCR A;  3L2Q A;  2VGN A;  1FX7 A;  2F69 A;  2RI2 A;  1BKB A;  3H8Z A;  2D0Q B;  4RCB A;  4A54 A;  1PSE A;  3JCM c;  1YHQ T;  3TCJ A;  5A0D A;  3PFS A;  1XNI A;  3FRN A;  3BFM A;  3E1S A;  2LCC A;  3CME T;  1M4Z A;  3V7R A;  5LJ5 g;  4M77 F;  4JUV A;  5GAN e;  1VQ9 A;  4KUD K;  2HNI A;  4XK8 E;  4EMK C;  2CZ6 B;  3MEV A;  5C6S A;  5GAN 2;  5CVI A;  4NOY A;  5GMK i;  4C5H A;  5GAO n;  1NPR A;  1HK9 A;  3JCM W;  2PU9 B;  4IKF A;  2XHC A;  3LGF A;  3OYI A;  5LJ3 f;  3M59 A;  3UPU A;  1N9R A;  4EDU A;  3L42 A;  3A8H B;  3QDR B;  4M75 E;  4XTV A;  1BI2 A;  5HY6 A;  3GP8 A;  3OW2 S;  1D3B B;  1QW1 A;  2ZCF B;  2A3L A;  5LJ5 e;  1WGS A;  3HRS A;  3LWI A;  2K2V A;  3J7A F;  2DD4 A;  2V8K A;  1KHC A;  3L2R A;  3VYG A;  1H3Z A;  3M4G A;  3OYF A;  2XD0 A;  2FVU A;  4OP0 A;  1KQ1 A;  4FM4 B;  4QW2 A;  2EJG A;  4MDX A;  2RJE A;  2LDM A;  3UDC A;  4C8Q A;  2RHU A;  1WPY A;  2K5F A;  2X4X A;  4TVR A;  4OB0 B;  3JRZ A;  2DZC A;  2P0Q A;  4HKE A;  4J6Y A;  1TH7 A;  3RES A;  3X28 B;  4PLI A;  4MDW A;  3CC7 T;  3G4S T;  5LJ5 d;  3CCE T;  1M9S A;  3MO8 A;  4FT4 A;  4JS5 A;  3J80 E;  4GY5 A;  4ZGE B;  2GQV A;  2R5M A;  5GMK m;  4X9C A;  4CI0 C;  1YJ9 T;  4LDY A;  3OMC A;  4EMK B;  1UEB A;  4M7A G;  2EIF A;  3OYY A;  2MWO A;  3VUZ A;  4C8Q D;  3CPF A;  3M55 A;  5LJ3 h;  4BB7 A;  2QTX A;  1W2B A;  4PL6 A;  4XTY A;  3VUB A;  4BI4 A;  2PVO B;  4VUB A;  4OVA A;  4FU6 A;  3S6W A;  1G3T A;  1KQ2 A;  4LD6 A;  5M9O A;  4C0Z A;  4A4E A;  2E5Q A;  2E1H A;  1R8O B;  2ZZD A;  4M75 F;  3OBY A;  3CCJ T;  1VQ6 T;  2XU8 A;  4J5Y A;  4NS5 A;  4C92 D;  4F7U G;  1YI2 A;  3FB9 A;  3HL8 A;  4XTU A;  3X24 B;  4M7D G;  4M78 F;  3OA6 A;  4JRI A;  2DTO A;  2VC8 A;  2L8D A;  3CCM A;  3GNG A;  3BW1 A;  1Q86 U;  2KMT A;  4PJO D;  1AHJ B;  2LVM A;  5FRN A;  3HSB A;  1VQM T;  3Q1J A;  2EJ9 A;  4IUV A;  5GAN f;  1ZBX A;  3JB9 I;  1WQ7 A;  3OBW A;  5LJ3 g;  3OYJ A;  2EQM A;  3BDU A;  4M77 C;  2KSS A;  5CCA A;  2HD0 A;  4XQ3 A;  1K73 C;  3RUX A;  1Y07 A;  3JB9 F;  1D3B A;  3JCM d;  3QJ6 A;  4XTW A;  2IVW A;  2K5I A;  5L8R E;  3RKY A;  3PMT A;  2FYK A;  4QVZ A;  4ZGJ B;  2EJF A;  3NTH A;  2PVD B;  1X75 C;  2ZGW A;  4N4I A;  5LJ3 e;  3ASK A;  3CC2 T;  2RHZ A;  2OTJ A;  5IAY A;  4QVC A;  2DEQ A;  2ZPF B;  2EQU A;  2RHI A;  5GMK e;  2D6F A;  2DXC A;  3DLL A;  4A4K A;  5CAI A;  4IUR A;  1KC8 U;  1VQ4 T;  1VQP A;  1M8V A;  4DOW A;  3NTK A;  1YBY A;  3HFO A;  4UC4 A;  1W4S A;  1YJN A;  2CS7 A;  2F5T X;  4FL6 A;  3FC3 A;  3CCL A;  3E9F A;  4C8Q G;  4MZT A;  5GAO r;  3MEW A;  3I56 T;  2E6Z A;  4BUG A;  5CKD A;  1X01 A;  4JRQ A;  3CD6 A;  4EMK A;  2DAQ A;  3URG A;  3JCM V;  1VQ7 T;  1H64 1;  3QO3 A;  3PT9 A;  1M1F A;  4XU0 A;  5GAN h;  4X9D A;  3ZFJ A;  3V8J A;  2C06 A;  3MEU A;  3OSS C;  3MCA B;  1Q82 C;  1YHQ A;  1K9M U;  4M77 B;  5GAM j;  4V2S A;  1W2B S;  4BE0 A;  1NZ9 A;  4J7F A;  5DM7 R;  5GAO m;  3P8B B;  3GOX A;  5IT9 E;  3CME A;  3E19 A;  2RK1 A;  2KY9 A;  2VYT A;  3V7S A;  2WAC A;  3HRT A;  2JTF A;  2MF2 A;  4QQG A;  5GAN 5;  3DKM A;  3QII A;  4EPC A;  3ZEH A;  3CC4 A;  2RA2 A;  3LX7 A;  3M57 A;  5GAN 7;  4E7I A;  1YJN T;  4C5E A;  1Q7Y C;  2K57 A;  1M90 U;  3CCL T;  4M75 C;  2FB7 A;  3S3N A;  1KD1 C;  2DKG A;  2M0O A;  4IUU A;  1YIT A;  3C95 A;  4M7A D;  3CPW S;  2QA4 T;  1B34 B;  5GAN 6;  4C92 E;  2M16 A;  4M78 C;  4C5G A;  3FLG A;  3O8V A;  1VQK A;  1K8A U;  2RJD A;  4OB3 B;  4E7H A;  4PJO E;  1Y71 A;  3HHT B;  1NPP A;  2LC4 A;  3V8K A;  3QYH B;  4KBM B;  4JS4 A;  5KE3 A;  2RI3 A;  4HCC A;  1KG1 A;  1YJW A;  4M7D D;  1ZQ1 A;  5KCO A;  3CC4 T;  1LNX A;  2JNG A;  2DIQ A;  3G4S A;  4J83 A;  3P8D A;  3DB3 A;  5CQY A;  3V7C A;  2DJZ A;  2Y4Y A;  3CCE A;  1QVG A;  1M1K C;  2DK3 A;  4RG8 A;  2K3Y A;  2OAU A;  1YIT T;  3CBM A;  5KCH A;  4XU1 A;  5GMK l;  1YJ9 A;  5HK0 A;  2DTH A;  3OYB A;  3FEO A;  3JCM P;  3OYE A;  2QXF A;  2FL7 A;  4M78 E;  1VQK T;  4E47 A;  4DA4 A;  2K5L A;  5GAM e;  4M75 B;  5GAN d;  1VQ8 T;  2G3R A;  1N27 A;  5CQX A;  4XTX A;  3CMA T;  4LDX A;  2XI9 A;  4NL3 A;  1G3W A;  1VIE A;  1NE8 A;  2LX9 A;  2R57 A;  4N0A C;  1MGQ A;  2DXT A;  4M78 B;  5GAM f;  1O9S A;  3DLM A;  3CCJ A;  1IZ6 A;  2BIV A;  2DIG A;  3A8M B;  1YJW T;  3HKS A;  1VQ6 A;  3SFM A;  4M77 A;  2XKO C;  4C92 F;  2EAY A;  2VUB A;  1U1T A;  3HRU A;  4KUI A;  3ME9 A;  3LW5 E;  4JLI A;  4BE1 A;  3G7Z A;  1QP3 A;  5FLX E;  4ZN1 A;  4PJO F;  1VQM A;  4XU2 A;  3E9G A;  4OMF B;  4BDZ A;  4BDY A;  1G5V A;  4PLL A;  2X35 A;  2XG8 D;  4C5I A;  2E70 A;  2XID A;  2X4W A;  4WF2 A;  4J6X A;  1VQ5 T;  2DXU A;  2L89 A;  3SB2 A;  5A0L A;  4FIB A;  1OI1 A;  1SSF A;  4IUQ A;  4MMK A;  1B34 A;  5GMK h;  1N8R C;  4FSX A;  3CCV T;  3CBO A;  2KAF A;  4Y28 E;  2QEX A;  1XTD A;  3CXC S;  3LLR A;  4EMH A;  2BUD A;  4R56 A;  4IUP A;  3LWH A;  3CC2 A;  4QQD A;  4O6J A;  4M7A E;  1JJ2 A;  2RHX A;  3DB4 A;  5GAO q;  3OYH A;  2EQJ A;  3CPW A;  2K4Y A;  1EIF A;  2EKO A;  3VV0 A;  4JDS A;  5GAM h;  5GAN 8;  1VQ4 A;  1RI0 A;  4XU3 A;  3X20 B;  4ZTF A;  2CZ1 B;  3I55 T;  2RHY A;  3OQ5 A;  3QJY A;  5A0G A;  1U1S A;  4ZTJ A;  4Y91 A;  1Q86 C;  1KHI A;  3T9N A;  3M54 A;  3OYM A;  4JJN K;  3HP9 A;  1QVG S;  3I56 A;  3RER A;  5FU6 C;  4F7U E;  3TU4 K;  2ZPE B;  3KXT A;  2M9U A;  2QQR A;  3NTI A;  5CKH A;  4OF1 A;  4BI3 A;  1VQ7 A;  4M7D E;  4R55 A;  1FWZ A;  2QEX T;  4HCZ A;  4LDU A;  3FDR A;  3GLX A;  3N5B B;  2JTM A;  1I81 A;  1OZ3 A;  2YHT A;  4M75 A;  3CC7 A;  4ELY C;  3PMI A;  5EG2 A;  5GAO l;  4RKU E;  3MP1 A;  5GAM g;  1K73 U;  3OYK A;  1KQS A;  4C8Q C;  2E64 A;  4M78 A;  3QBY A;  2P4T A;  3VJP A;  3L2U A;  3PTA A;  3QSU A;  2XDP A;  4L6V 5;  3X26 B;  3L1A A;  2RM4 A;  5KE2 A;  4RMO A;  5D6Y A;  1NJI C;  5D6W A;  4JRK A;  3M56 A;  1OYX A;  3J81 E;  2NLU A;  3UT1 A;  1BIA A;  1WJQ A;  2CKK A;  2LTO A;  3C12 A;  1LOJ A;  2X4Y A;  3INZ A;  4OB2 B;  5LJ3 d;  2DPP B;  2KQW A;  4C92 C;  4M77 G;  2QA4 A;  2JVV A;  4M7A F;  2DXB A;  3EFS A;  5GAO p;  1MHN A;  2QDY B;  4OGC A;  2AHJ B;  3NFC A;  1UGS B;  1I5L A;  4A53 A;  2YLC A;  2E10 A;  1VQN T;  3WVD B;  4PJO C;  4XAX B;  5FU6 B;  5J26 A;  4BI8 B;  2QQ9 A;  2RB6 A;  2RJC A;  2E12 A;  2RD1 A;  4NL2 A;  2RH2 A;  4IUT A;  1ZHI A;  4LDW A;  1Q81 C;  3CCS T;  4C8Q E;  4F7U F;  4E7L A;  1FXX A;  5GAM d;  4M7D F;  4ZGD B;  4ZN3 A;  3PIP A;  2GFA A;  1Q82 U;  4OB1 B;  4RCC A;  1G3S A;  5I21 A;  4N0A A;  3RMQ A;  1JJ2 S;  5HKC A;  4OGE A;  2JN0 A;  4D6W A;  1RL2 A;  2FHD A;  5FRO A;  2DD5 A;  2VXF A;  3M5A A;  1M90 C;  2EYQ A;  3QHS A;  3GIB A;  2GCX A;  1S72 T;  3CXC A;  1QVP A;  3UWN A;  3L2W A;  1VUB A;  3AHU A;  2ZPB B;  2E41 A;  3OYL A;  2JOY A;  1VQ8 A;  4HCB A;  3VU3 C;  2YRV A;  3CMA A;  3PNW C;  5CO7 A;  1M5Q 1;  3WVE B;  2MI6 A;  3MP6 A;  1BI0 A;  3EFR A;  4C92 B;  1KD1 U;  5CKE A;  1QVF A;  4XTZ A;  5CK9 A;  1K8A C;  2VXE A;  2OTL A;  3KUF A;  2ZPI B;  2DTI A;  1DJ7 B;  2PUK B;  3M4Y A;  3JCM f;  3L2Z A;  4B9X A;  4PJO B;  1UGR B;  3A8G B;  2LT4 A;  3MEA A;  3H6Z A;  4J6W A;  1KQS S;  4B9W A;  3HFN A;  4M75 G;  3OYG A;  4C0G A;  2BKD N;  4GLK A;  5J39 A;  3JCM b;  4JRP A;  3S3M A;  4C8Q F;  3P8H A;  3QPH A;  3PIO A;  3GNF B;  3OS0 A;  3BY7 A;  1M1K U;  1VQO A;  2E6N A;  3MP8 A;  4M78 G;  1WQW A;  4O5V A;  4C0F A;  1VQ5 A;  2O01 E;  2O4X B;  1QP2 A;  2XK0 A;  2LCL A;  4MZM A;  2CGH A;  1M1G A;  4Q5W A;  3RIR A;  1BI3 A;  2R58 A;  4A4F A;  3C94 A;  3QG1 A;  4PKC C;  3CCV A;  2WSE E;  5CKF A;  2OTL T;  3VKI A;  2WSF E;  3G6E T;  3VYH B;  2GFU A;  1XOV A;  3OSV A;  3QXE B;  3CCQ T;  5GAN j;  4M7A C;  4QQ6 A;  3A8O B;  3MET A;  3S3O A;  4MZP A;  4LDV A;  5IN1 A;  5LL6 S;  3JB9 G;  1VQL T;  3OMG A;  4FT2 A;  3CCR T;  3OYA A;  2XDD A;  1N6A A;  2RI5 A;  4Z02 A;  3I55 A;  3OS2 A;  3KBG A;  4J8O A;  3JCM h;  2LNV A;  2VV5 A;  2Y4X A;  4EMG A;  5A2Q E;  5LJ5 j;  2HQX A;  3M58 A;  3OYD A;  2KK4 A;  3SD4 A;  1VQO T;  3SWN C;  5CR2 A;  3G71 A;  2P0P A;  4M77 D;  5DY9 A;  3M53 A;  3JSC A;  3RKW A;  1VQ9 T;  4M7D C;  1XQH A;  4QVD A;  2IG0 A;  1P92 A;  3WXM B;  4L5G A;  2P0K A;  1PSF A;  3TEE A;  1JB0 E;  3MHX A;  1WJR A;  2A7Y A;  5CIU A;  5J3B A;  3F70 A;  2V8I A;  3OS5 A;  3EAE A;  2L5Q A;  4II1 A;  3HPW A;  4C92 A;  4BE2 A;  2HQE A;  4BY6 C;  1QVF S;  1WJS A;  2R5A A;  1N8R U;  2DVE A;  4A4G A;  3X25 B;  3JCM g;  2MMP A;  2JZ2 A;  3M9Q A;  5DLQ E;  1WNL A;  4M7A B;  3RKX A;  3PGG A;  4PJO A;  3CCU T;  3JAM E;  2ZPH B;  3OB9 A;  3GF5 A;  3G71 T;  3CCU A;  2I2L A;  1S72 A;  4PNO A;  4DOV A;  3ZBD A;  2Y90 A;  4J7I A;  3JCM e;  5FU7 C;  2XDB A;  5D6X A;  5AYF A;  4MML A;  1I8F A;  1Y96 B;  2E65 A;  3FJP A;  3SWN B;  4F7U B;  2PQW A;  2ZPG B;  1VQN A;  2O4X A;  5C0M A;  1Y7X A;  4YTL A;  1BYM A;  4LD9 K;  3CBP A;  3CEY A;  4HA8 A;  4M7D B;  2EFI A;  3TRE A;  3CCS A;  1BIB A;  1HXD A;  4CRI A;  1UGQ B;  2CZ0 B;  4N4G A;  2KDS A;  2CYZ B;  2HBP A;  3FIF A;  5CKB A;  5HK3 A;  5KH6 A;  3BDL A;  4A4H A;  2EWN A;  3QZ9 B;  3QYG B;  2QQA A;  3R6O A;  4L59 A;  3A5Z B;  3C4S A;  1JBM A;  4M75 D;  4BY6 B;  1KC8 C;  2RO0 A;  3JCM X;  5LJ5 f;  1G3Y A;  1YI2 T;  4KT0 E;  1YCY A;  5I2M A;  2HAX A;  4DQ2 A;  2GF7 A;  4M78 D;  2V8J A;  5GAN 4;  4ATO A;  4BD3 A;  1OZ2 A;  3LGL A;  3JB9 H;  3CCM T;  2X4J A;  1O75 A;  1NJI U;  5I2S A;  3OW2 A;  2QI2 A;  4C0D C;  5LJ3 j;  2LRQ A;  3QKJ A;  3L2V A;  1VIF A;  1IRE B;  1X6O A;  2PUO B;  2LT1 A;  1K9M C;  4HT9 A;  5FU7 B;  3JCM J;  3RMS A;  4JLG A;  1V29 B;  5GMK j;  3OS1 A;  3OY9 A;  3LYI A;  2VGM A;  3OYN A;  4M77 E;  3JB9 D;  2QQS A;  3A8L B;  4E7K A;  4N4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...