2GQVA

High-resolution structure of a plasmid-encoded dihydrofolate reductase: pentagonal network of water molecules in the d2-symmetric active site
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
SNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of a plasmid-encoded dihydrofolate reductase: pentagonal network of water molecules in the D(2)-symmetric active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Dihydrofolate reductase type 2
total genus 12
structure length 59
sequence length 59
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2006-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gqvA00
2RH2A 2OAUA 2RK2A 3T9NA 2RK1A 2P4TA 1VIEA 3UDCA 3SFMA 2VV5A 1VIFA 2GQVA
chains in the Genus database with same CATH superfamily
2HQEA 1D0YA 2K2VA 3X26B 1VYTA 4J9IA 1UJ0A 2CH4A 2ECZA 1FMVA 2DK3A 3V8KA 5IAYA 1UFFA 3FIFA 1M3AA 4M78E 3RKXA 1H3HA 1YFNA 1ZUUA 1J3TA 3C12A 4QKUA 2O2OA 4MMLA 1KSWA 4JPBW 2P0PA 3M4YA 1QKXA 3U23A 2RF0A 2MOXA 3VS0A 5I21A 1WXBA 3KFVA 4RUGA 2HKQB 2VXFA 4M77F 1RL2A 2YXYA 3CCMA 1Y07A 2VGNA 4J6WA 2IG0A 2CSQA 4K11A 3META 3VRZA 4KUDK 3CCST 1VQPA 3OYFA 3WXMB 4F14A 3MCAB 3CMET 1QVGA 3RERA 2JTMA 2DVEA 5LJ3j 3RNJA 1SG5A 2X4XA 3JCMh 3GIBA 4NOYA 4ZN3A 1SHGA 3OSVA 4A54A 1WHGA 3M59A 4CC7A 1KJWA 2EVRA 1KHIA 2L3PA 4VUBA 4F7UB 2DTHA 1VQ4T 1NJIU 2GFUA 4DOVA 1G83A 1YNZA 4Y91A 2MAMA 3SEMA 2HSEB 4BDZA 1OV3A 1QVGP 5DM7R 2O4XB 1TXQA 3JCMW 2IIMA 1UGSB 1UHCA 2KYMA 3VRYA 2VUBA 2RNAA 5KH6A 2YRVA 1C6VX 4J6XA 4FT2A 3CXCS 3OYHA 3GF5A 2GFAA 1QMCA 2L2PA 1MMGA 1NPRA 1B3QA 2PUKB 1Y57A 3QZ5B 3JCMV 5GAN2 1AWWA 3NGPA 2XIDA 7AT1B 3ASKA 4ZTJA 3PVLA 1GXIE 3M5AA 1VYUA 3OYCA 1DJ7B 2K6DA 4R55A 2WSCE 2EWNA 3LH5A 4IUUA 5CAIA 2ZPIB 1N5ZA 2C0TA 3OMCA 1NYGA 5CKBA 4CC3A 3EH1A 4R0KA 1BIAA 2QA4T 5GANg 3AT1B 2OTJT 1S72T 1BB9A 2LJ1A 2JOYA 4A4HA 4M77B 3E9GA 3V7RA 3G71A 2IVWA 3I35A 1MMAA 5KYYA 2V8JA 1RAAB 4ZGEB 1GCQC 5GAMe 3CCVT 2O9VA 1GRIA 4JZ3A 4B9WA 2VWFA 4AMCA 1WJSA 2OAWA 1QKWA 3G7ZA 3C94A 4M78D 4HCKA 2LTOA 2XMFA 3HL8A 3VS5A 2AZVA 2LT1A 3BDLA 2VKNA 5FRNA 1KD1U 2QAZA 2MIOA 1VQPT 2QDYB 1KQ2A 3A8LB 2EW3A 2A7YA 1U5SA 3CBOA 5GAOl 2OJ2A 1N9RA 2CP6A 3OQ5A 5IXBA 3WVEB 4OMFB 5CKFA 5GMKh 3JB9F 1XNIA 2ROTA 2EQIA 1BK2A 1LJOA 5GAMd 1S72A 4E7IA 4PJOG 1K73C 1OOTA 1RAIB 2BZYA 5CCAA 3CC2T 1WHMA 2FRYA 2OI3A 3M0PA 3JB9J 5AYFA 4BE2A 2GQIA 5KYWB 2ZPEB 2QEXA 2QTVA 1ZA1B 4DEXA 2KDSA 2DETA 1M4ZA 2E10A 2DEUA 3QPHA 4PL6A 3URGA 5KCHA 4RKUE 1JJ2S 1XTDA 1W2BP 3BFMA 1Q82R 2YRCA 1D1AA 4PJOD 1UGPB 2OTJA 2H3JA 2JMAA 1ZBJA 3EGUA 3OB9A 1W2BS 1PM3A 2XG8D 3CBMA 1Z9ZA 2L8DA 2HL5C 3JB9I 5FLXE 2V26A 4GBQA 4EPCA 1IGUA 2E12A 2HMAA 4EMKB 1TUGB 2JVVA 1C0MA 2ZPBB 4FYWB 1H92A 2RK1A 1TUDA 1VQ9Q 3JSCA 4MDWA 2BIVA 4RTZA 3L2RA 1HXDA 5LJ5e 1Y71A 1SKUB 3H0FA 1AWXA 2E3HA 2O31A 4E7HA 5GAN6 1ABOA 3M58A 4AFZC 1ZSGA 3GP8A 3CCEA 1G3TA 4OGEA 4XTVA 1VQLT 2KT8A 1YWPA 3A8GB 1FMWA 4C8QG 3VS4A 5LJ3g 4C0ZA 1YIJA 4OMLA 4ATOA 1D0XA 2PTKA 2DFUA 1PWTA 2FPDA 2KRNA 1TUCA 1M27C 4DEYA 4XU3A 2K5LA 1X01A 4XK8E 4IUQA 2PZ1A 1Q82U 4ANJA 4E7JA 5CO7A 2C0OA 4RMOA 5CK9A 1CSKA 2L5QA 3VS3A 3SD4A 3G71T 4XTZA 1WQ7A 1TG0A 4BDYA 2DXBA 3HFOA 2CP2A 2KVQG 5GJWB 1OI1A 4J7IA 2MYSA 2K3BA 1LVKA 3VKIA 2X51A 1AWJA 3A8HB 1H3ZA 3JCMc 2RI2A 1QVPA 4XTUA 2ZGWA 5LJ5g 5GAOr 3H0IA 1NJIC 5FU7C 2CUDA 4KH0B 3FLGA 4F7UF 1Q82C 4HA8A 1W1FA 3LYIA 4DBHA 4PJJA 4CC4B 1XOVA 1BBZA 2DO3A 3CMEQ 2BE9B 1YITT 1QP2A 2RQRA 1U8RA 4ELZC 3OYLA 1HSQA 1K0XA 2EGEA 2DLPA 1WHHA 5GAN5 1VQNA 1X69A 4X34A 2RN8A 1UEBA 2DL3A 1LOJA 2ENMA 3ZFJA 4ORZA 1VYVA 4QT7A 1NYFA 3G4SA 1V29B 2M16A 1SEMA 4F7UG 1GFDA 1S1NA 1IB8A 2YWWA 4AG1C 5GAN8 3NMZC 1WZOA 2NUPB 3QUIA 1ZBXA 1Q81U 4AFSC 1OQKA 4JZ4A 2HQXA 3NTIA 1VQ5Q 1VQ6A 2J6OA 3GNGA 3CD6A 3DLMA 4FIBA 2J06A 3HKSA 3INZA 3OYYA 1JRIA 2CP7A 3SDZA 5FWCA 4J5YA 3CQTA 1Y96A 5J3BA 3TCJA 4DBQA 1GBRA 2F2WA 5D6WA 3OYEA 4CI0C 4E7ZA 1ZX6A 2ZPHB 2COYA 5IHIA 3FC3A 4E2FB 1K4US 2KBTA 4ELYC 1WJQA 3ME9A 4J9EA 4M7DE 3G4SQ 4DQ2A 2KSSA 4M7DF 2DPPB 2CZ6B 2KROA 5IXFA 4KT0E 1M90C 3CC7T 2XDPA 2BKDN 4B9XA 1VA7A 4F16A 8AT1B 4M7AG 2EYXA 3J7AF 4NL2A 3G71Q 3M55A 4RG8A 3OYJA 4PJMA 2K57A 1D0ZA 3HSBA 2YRDA 2CZ7B 2QQRA 2K4YA 5CQXA 4V2SA 1IHWA 3QKJA 3EGDB 3CCUQ 1N8RC 1X6GA 3I5SA 4C5IA 2LC4A 4PNOA 1YN8A 3H0HA 3JAME 2KMTA 3TREA 1MHNA 1RAFB 1NJIR 4M75E 3A8OB 4OB3B 2YUPA 5EG2A 3CD6T 2LZ6B 4LD9K 5C0MA 1BI1A 2A08A 3OMGA 2V1QA 5GAMg 5GAN7 1SPKA 1TS9A 3M0QA 4J9HA 3JCMd 1ZSZC 2YLCA 1W4SA 1UE9A 1QLYA 4XTYA 2JXBA 4LNPA 2P0KA 3OS0A 4DBFA 2DTOA 1WX6A 5KYXA 1NEGA 3QDFA 3CBPA 2VYTA 2NUTB 4ME7A 2QGFB 1VQ4Q 4RTYA 1AVZC 3HFNA 2ZPGB 4DBRA 5A0DA 5I2SA 2ED1A 5KYYB 3MEWA 3QWYA 2QQ9A 3CCUA 2JW4A 5ECAA 4EIKA 1WHJA 2L0AA 4L59A 1VQ5T 3JCMQ 1VQ9T 1SF9A 1OPKA 1WHKA 4J9BA 1QWEA 3EHQA 1G3WA 3RBBB 1YCSB 5DLOA 2YLBA 3RESA 5GANe 1QVFP 2EJFA 1YCYA 3C4SA 2E6ZA 3EGXB 1T0JA 1VQMQ 4FSXA 4KGZB 5LJ3f 3THKA 3GOXA 3JCMX 2KEAA 4C8QD 2R57A 3UWNA 2JTFA 2K79A 1VQ4A 2DZCA 5DLQE 3CC4A 3VS2A 1SSFA 1FYNA 1AWOA 1KK7A 3BE3A 4A53A 1U1SA 1U1TA 2QGGA 1OEBA 2LCCA 2CT3A 3HRSA 6AT1B 3UDCA 4WF2A 3I56Q 5IH2A 4M4ZA 1K8AC 5KCOA 2EQJA 3E1SA 2FG0A 4E7KA 1VQ8T 1UECA 3RKWA 1Q95G 3RMQA 2RQVA 3CMEA 3ER0A 3CCSA 2KXDA 1IRXA 2FZKB 2DERA 1EX4A 1UB4A 2LQ8A 2VGMA 2DRKA 2D8JA 4J9GA 4MZTA 1OULA 2R58A 2RMOA 2LQKA 4M77A 2RH2A 2RJFA 4AT1B 3OYNA 3HTRA 2J6FA 1ZSZA 1M2OA 2HKNA 4Z02A 1A0NB 1I07A 1YITQ 3CCRT 3RMSA 4XU1A 1K1ZA 4L5GA 2CT4A 2LP5A 2RO0A 1YJWQ 2QQBA 4M7DC 2SEMA 1R0CB 4PJOB 1WFWA 3PT9A 4M7DG 1BCOA 5CKEA 1VQMT 1T0HA 1G3SA 2FL7A 2H8HA 5GMKi 2M9UA 2C0IA 3MKDA 1TOVA 4CRIA 5FU6C 1TSFA 1RABB 1O75A 3PIOA 3FRNA 2QTXA 3PMTA 1C1AA 3OYIA 5GAN4 1JJ2P 4C92B 3CC4T 1TU0B 3D7SB 2HZYA 4C92D 2DBKA 4OMPA 1VQPQ 3EFSA 3N5BB 1KC8R 4JLGA 1Q7YU 4OB0B 3R6OA 4BI4A 3V8LA 2BE7D 2RJCA 3X24B 1RACB 2VV5A 4LUDA 4M78F 2F5TX 2DYBA 3L2UA 1RADB 4PJNA 1G3YA 1UGRB 1GFCA 2F2XA 1PNJA 1Q86U 2CUBA 1AD5A 2AK5A 3J81E 1VOMA 2ROLA 1VQ9A 3NFCA 1VQKT 2Z0WA 1MUZA 5IHKA 5FWBA 3JCMb 3MP6A 3CD6Q 2CYZB 1YHQQ 3QSUA 5LJ3e 1Q86R 4C92G 4LDXA 3S6WA 4X9CA 2CZ1B 2K3YA 4Z89A 1WQWA 1WXUA 3H41A 3JCMe 2JM9A 1M90U 4J6YA 4KGVB 4C92C 1Q7YR 3OW2S 3VS7A 3HP9A 4M77C 5LL6S 4OVAA 1Q7YC 3ZBDA 3PE0A 4HKEA 4QQ6A 1VQOT 1WYXA 3DB3A 1NPPA 2EYQA 4WCIA 2FO0A 4PLLA 2V8IA 3UA6A 5IT9E 1D3BA 4M75B 4A4FA 3REAB 3I9QA 4PKCC 3WVDB 3HPWA 4PJOF 2DIQA 2DYIA 1VIFA 2K5IA 4II1A 4KBMB 4A63B 2DL8A 4JUVA 4Y28E 2DMOA 3GPLA 1K9AA 3MHXA 2O4XA 4M77G 1BYMA 4EMKC 4OB1B 2PUOB 1Z9QA 3P8HA 2JS0A 1OU9A 4JS5A 4GLKA 1HYOA 3RKYA 3EAEA 1G5VA 4WTOB 1Q81R 4PJOE 1ZLMA 4QQDA 1WDXA 3M56A 2P0QA 1WPYA 3DB4A 2CKKA 1Y7XA 3E19A 2PNIA 2JZ2A 4MZMA 1IO6A 2DBMA 2EGCA 1UDLA 3EG1A 1SSHA 3V7CA 1OZ2A 4QVDA 2COZA 4M78B 2FHDA 2YDLA 2L89A 4ZGJB 4C5HA 4C92A 1BI2A 2EPDA 4M7AF 4FCYA 3GBQA 2AHJB 4IUTA 4BI8B 4O6JA 1IZ6A 2KY9A 2X35A 1EIFA 1X27A 3CXCP 1OPLA 2GTJA 4BE0A 3QIIA 3M9QA 1UGVA 2G3RA 3OYGA 3OS1A 3BY7A 1QP3A 5KE3A 1QQJA 3C0CA 1QVGS 4PJOA 3CC7A 3A8MB 1WI7A 1JBMA 2PVDB 1B34B 1NBEB 2XU8A 1K9MR 1WLPB 2BTTA 4JRIA 2LDMA 3VS6A 2RD1A 3EG9A 5KYNA 2C06A 3PMIA 3VYHB 2OTJQ 2GQVA 3ZEHA 3CCMQ 1ZSZB 3OS2A 2KT1A 4A4KA 1VQ7A 3DLLA 1UHFA 4JJBA 4M77E 4M7AD 2RQUA 1KD1R 3QZ9B 2HQHA 2QG9B 3QYGB 4HVVA 2DL7A 3FDRA 5GANd 2X9HA 1MMNA 2XK0A 2XD0A 3MJXA 4EMGA 2L3RA 5FU7B 5KYXB 4M7DB 1WNLA 2MK5A 2J05A 1BI3A 2QQAA 4F04B 1K8AR 5CKHA 3SFMA 4C5GA 4IKFA 3JCMf 5GMKj 3JB9H 2HNIA 3VJPA 2E6NA 2QEXQ 4JRQA 2R5AA 2ATCB 3LWHA 2XDDA 1QCFA 2X4WA 2QXFA 2LCLA 1JXMA 3L2ZA 3OSSC 4AFQC 2BZXA 5HK0A 2HDAA 3LGLA 2MCNA 1X6OA 5GAMh 3SWNA 5L8RE 4N4GA 2AKKA 2EYZA 2KRMA 4PFOA 4TVRA 1HJDA 1PCXA 3X28B 2F5KA 4BACA 4L6V5 1N9SA 4M78C 2AKLA 1I5OB 2D6FA 3JB9G 1GCQA 1FX7A 2VXEA 2D0NA 1RI9A 1KFZA 1PSEA 2PU9B 3CCQT 1FWZA 3MP1A 4JRKA 1NE8A 1RI0A 2JTEA 4A4EA 5LJ3d 4MDXA 5A0LA 3PGGA 1VQMA 2EBPA 3CCVA 5IHNA 2J7IA 3CCJT 3A5ZB 2DILA 4KRTA 1W2BA 2J6KA 4QW2A 3TSZA 3CCLT 4PFZA 3JV3A 3G6EQ 4F7UE 1S72Q 4C5EA 1EZZB 5LJ5j 1YJNT 4LXCA 2QA4Q 3VU3C 1R0BG 4F17A 2HBWA 1PC0A 3SWNB 3CCLA 1LNXA 2RK2A 1H8KA 3UA7A 3CCJA 1AEYA 2QYZA 2QA4A 4C8QC 3X20B 3DKMA 2EJ9A 2MPXC 2QQSA 4D8DA 3EGXA 1X43A 4C8QE 2RPNA 4PLIA 1NG2A 3M0UA 2B8AA 2EAYA 1VQLA 3EHRA 3S3MA 2QDLA 3VUBA 5LJ5d 2V1RA 4B6MA 3SB2A 1PD1A 1HK9A 5GANh 3J80E 2DXUA 2LNVA 1MNEA 3M54A 4BY6C 4M7AC 1IREB 2HCKA 4C0FA 2YUQA 5GMKe 2NLUA 3CC2Q 1UJYA 3OW2P 1JJ2A 2ABLA 3OYKA 2P4TA 1RAEB 4LE9A 1AOJA 2CZ0B 4M75C 5KE2A 4NS5A 1MNDA 2GTOA 4FYVB 3PNWC 1UTIA 2CP3A 4M75G 2FB7A 2LQNA 1ABQA 3A1PA 2KGTA 4M75D 4OP0A 3P8BB 1VQ8Q 5FRMA 1I8FA 2VASA 2GNCA 2VVKA 3VS1A 2MF2A 1QCOA 2X3XD 3L2QA 5LJ5f 2XICA 3NPFA 4J9DA 3TQ7P 4IIMA 1YBYA 2DL5A 2XHCA 4HVWA 1ARKA 2HAXA 2YHTA 2E70A 1E6HA 1YJNA 2D8HA 2RI5A 2LJ3A 2E1HA 2LNHB 2EIFA 3P8DA 4ZTFA 3FB9A 3QJ6A 3QYHB 5HCKA 1W70A 3HRUA 3BDUA 2JS2A 3VV0A 2A3LA 4LUEA 2FZCB 3L42A 1T3SA 2QI2A 3C95A 1Y0MA 1KHCA 5J26A 4PK4A 1HD3A 1VQLQ 2KXCA 2FPEA 2CS7A 4BE1A 4KULA 1K73U 2YUNA 1Y96B 1V76A 1KG1A 3CCMT 5KYUA 2HD0A 2DRMA 2WSFE 3M0SA 3PFSA 2A0FB 1QW1A 4OB2B 4OMQA 5LJ3h 1JEGA 2JN0A 3PVQA 1M2VA 2CP5A 1M30A 4LN2A 3PIPA 5FROA 1RAGB 1M9SA 4N0AA 4FW1A 2DEQA 3VYGA 1LPLA 4KGXB 2E64A 1PG5B 2E4HA 4X1VA 2ED0A 2H3EB 3LW5E 4FU6A 1RUWA 2F1LA 1QWFA 3JRZA 4OGCA 3CXCA 2CH4W 3EG3A 3JB9D 2PQWA 5GMKm 1QCNA 1BIBA 3MEVA 1YJ9Q 3CPWA 3UPUA 4E47A 2DM1A 1M1FA 5FW9A 3UATA 1VUBA 2E65A 3NTKA 4IUVA 2M51A 1GCPA 2M02A 1M2VB 1VQ7T 3L1AA 2DVJA 1YI2Q 4O5VA 3KUFA 4J9FA 3CMAT 4RTVA 5KYWA 1PKSA 4C8QB 3H9NA 1CKBA 3CCJQ 5GAN3 1VQ6Q 1SHFA 2EFIA 1NLPC 4IUPA 4PJLA 1D1BA 1BKBA 4OMOA 4C0GA 1F1BB 3FEOA 3KBGA 2X4JA 4PFPA 3EG2A 4XAXB 4XU0A 4Z88A 2MMPA 1M3CA 2EJGA 1K0SA 1M1KU 3LLRA 1K9MU 5GAOm 3CPWP 2CGHA 3LH0A 2MWPA 2OTLT 1X75C 5CIUA 2LT4A 2ZCFB 4OMNA 2JUFA 1R8OB 3UT1A 1KQSS 4JLIA 3CCRA 3REBB 1VQOQ 4C0DB 2RHZA 2LX7A 2KYBA 5GANf 3OS5A 3I55T 2MWOA 2O01E 4LD6A 1AZEA 2EGAA 1UG1A 5GAOq 2NUPA 4BI3A 5GANj 1YHQT 2O9SA 3L2WA 2X4YA 1SRMA 4FW2A 2LX9A 4E7SA 3EFOA 3JCMP 1MMDA 2RHYA 1M5Q1 5IN1A 3V7SA 3OY9A 4EMHA 1G8XA 2E5KA 4QVZA 2CREA 1N6AA 2RJDA 2YUOA 1VQ8A 3CCVQ 5D6XA 4CC2A 4R56A 4JJNK 3CC7Q 1X2QA 3E2UA 3JCMJ 1TWBA 5D7UA 3MPUB 4A4GA 4M78A 3OBYA 3ULRB 3Q1JA 3M0TA 2LCSA 3CCSQ 3RDVA 4FYXB 2FVUA 5GAOn 4JRPA 3QO3A 1VQOA 4ZGDB 1BI0A 2LMJA 1YIJT 1Q86C 1KD1C 2DJQA 1PD0A 4LDUA 4JS4A 1ZHIA 2OTLQ 2A28A 1M1KC 1WJRA 1KIKA 2JJ9A 3M53A 2DXTA 5M9OA 3CCET 3HRTA 4C8QF 3QDRB 1M1KR 3I56A 3E9FA 3FJ5A 2NUZA 2ESWA 3CCQQ 2P4RA 4HT9A 1H641 1OYXA 3QHSA 1FXXA 1CKAA 4N0AC 2DD5A 2DNUA 3S3OA 2CP0A 3LWIA 1KC8C 2RHXA 2DZ9A 3QWXX 2Y90A 1QVFA 5EC7A 3T9NA 3FJPA 1WIEA 1YJWT 1M90R 4M7AA 5FU6B 3CCEQ 3RIRA 3GNFB 4M7AE 2FRWA 1PRLC 1W6XA 1B07A 3CPFA 2HSPA 4HVUA 2GBQA 3QBYA 1TTHB 1MGQA 1KQSA 2EQUA 1YI2T 1NEBA 1BU1A 3TEEA 3UF4A 2O88A 3G6EA 2NWMA 4LDWA 5CVIA 2HBPA 2E5QA 1PKTA 4FYYB 1U3OA 3JCMg 2OX7A 1YJ9T 1E7OA 1PRMC 5HK3A 4OF1A 2L3QA 2ZPFB 4J7FA 3LX7A 3OYDA 4HCCA 1WGSA 4X9DA 3QJYA 2DL4A 3EG0A 4F7UA 5I11A 3OYAA 2HL3A 1KQSP 1JU5C 3I56T 1GBQA 5GAMj 8ATCB 3EFOB 3EFRA 3G1JA 4RCBA 1ZUYA 2ZZDA 3CPWS 4QQGA 1K8AU 4IIOA 3QG1A 3QXEB 2OAUA 1ZQ1A 1NLOC 1ACMB 1UUEA 2D1XA 4EMKA 4J9CA 1KQ1A 1E6GA 1YJNQ 1M8VA 2RA2A 2LQWA 4Z8AA 2GCXA 2XI9A 3BW1A 1WA7A 2BZ8A 2EYYA 3TU4K 2ZAEA 1K73R 4N4HA 5A0GA 1VQKQ 4AG2C 3RUXA 1JO8A 1PHTA 4RTTA 4Q5WA 3OYMA 1X6BA 4J8OA 2K5FA 3M0RA 3AHUA 1SRLA 5L23A 1N8RR 1OU8A 3EG9B 2RHUA 1VQ6T 2DKGA 4P5NA 2JMCA 3X25B 2DE0X 1IGQA 2K3XA 3GLXA 3CMAQ 5C6SA 1M3BA 3HHTB 2Y4XA 5J39A 4UC4A 1AHJB 2KQWA 1VQNQ 1D09B 4DOWA 1EFNA 2GGRA 4LDYA 3CMAA 1V1CA 2DF6A 2LVMA 4HXJA 2X3WD 3CC4Q 5GJVB 4BB7A 1I1JA 2EKOA 2KAFA 2QK0A 3M4GA 2M1HA 4ZN1A 5GMKl 3A98A 1RAHB 2LJ0A 4Y92A 4BUGA 5I22A 4C8QA 2G6FX 4QVCA 1TH7A 2KRSA 1PSFA 3RR6A 2VB6A 2DIGA 2DX1A 2JNGA 1M1GA 1ZUKA 3LGFA 3CCUT 2CDTA 1YJ9A 2P84A 1O9SA 1RLPC 2KE9A 1Q81C 2FEIA 2XKOC 2DXCA 2FZGB 4XTWA 2NUTA 2RM4A 1IHVA 1K76A 3TSWA 1I4K1 2RHIA 1YI2A 1I5LA 4LDVA 1B7TA 1LCKA 2A37A 3NHNA 2D9TA 2A36A 4XQ3A 4RTWA 2KI7A 3CEYA 1YJWA 2W0ZA 3O8VA 4C92E 1VQ7Q 4N4IA 2B86A 1XJWB 3I5RA 1VQ5A 4RG2A 3EH2A 2E3IA 2JM8A 4XU2A 9ATCB 2YSQA 4HT8A 1AZGB 3H6ZA 2M0YA 2SRCA 4HCBA 2DJZA 2V8KA 4C92F 1NZ9A 2L3SA 5DY9A 4MZPA 1B34A 2XDBA 3I55Q 1OX9A 1M8MA 4C0DC 3R6NA 1GL5A 3I55A 2BUDA 2IPOB 1UGQB 2QASA 1OZ3A 3OBWA 2KK4A 2Y4YA 4RTUA 3CCRQ 4PJOC 3CCLQ 2DAQA 3H8ZA 2GF7A 3KXTA 5CKDA 4D6WA 4XTXA 3IQLA 1MV3A 4ZNXA 2R5MA 4KUIA 3MP8A 3SHWA 1JXOA 3VUZA 1KC8U 1P92A 4RTXA 4IURA 2DD4A 4EDUA 4OMMA 3CCQA 1I0CA 2VC8A 3MO8A 2K9GA 2PVOB 3ZL7C 3OYBA 2JT4A 3MEUA 4HCZA 2DA9A 3L2VA 1YHQA 2M0OA 5I2MA 1IXDA 4FT4A 2AIRB 2CSIA 2K2MA 3G6ET 4JJCA 2LRQA 1R77A 2W10A 1JB0E 5GAOp 3V8JA 5A2QE 3S3NA 4E7LA 2RJEA 1X2KA 5HKCA 1G2BA 5D6YA 2OTLA 4AFUC 1QVFS 2EQMA 2WSEE 1OX8A 2RB6A 4M75F 3NTHA 1T3LA 2DTIA 4DA4A 2AT1B 2COWA 3OW2A 2AZSA 2E41A 3EGDA 4FL6A 3O5ZA 1VQNT 4JDSA 3MEAA 1WHLA 4J83A 4M75A 1D3BB 2F2VA 1VQKA 3F70A 4M78G 2YT6A 1YWOA 2PVGB 4FSSA 2MI6A 1XQHA 1JQQA 1VIEA 1AT1B 1WXTA 1I81A 4KH1B 3PTAA 3TVTA 4BD3A 2RQTA 2RI3A 2QEXT 2D0QB 4NL3A 2NYSA 1NM7A 1BCMA 5HY6A 4MMKA 4M77D 2WACA 4E6RA 2I0NA 3G4ST 2FYKA 4RCCA 4ESRA 2F69A 2KNBB 2KR3A 2FPFA 5CQYA 1U06A 1ZA2B 4YTLA 3CC2A 2HEQA 4M7DA 4FM4B 5AT1B 2EKHA 1YIJQ 1MV0B 4GLMA 4D8KA 4M7AB 1RLQC 4BY6B 3SWNC 3OA6A 1YP5A 1FMKA 2RQWA 5LJ5h 5KYUB 2K7AA 5CR2A 1K9MC 1D1CA 2EYWA 5GAMf 3M57A 1YITA 2I2LA 4M7DD 1N8RU 1N27A 2EQKA 4GY5A 4JJDA
chains in the Genus database with same CATH topology
4R56A 2HQEA 2LDMA 3JCMJ 2RD1A 2K2VA 3X26B 2C06A 5GAN8 3PMIA 3VYHB 2GQVA 4A4GA 4M78A 3ZEHA 3OBYA 3QUIA 1ZBXA 3Q1JA 3OS2A 1Q81U 4A4KA 1VQ7A 3DLLA 4M77E 2DK3A 2HQXA 4M7AD 3V8KA 2FVUA 3NTIA 5GAOn 4JRPA 1VQ6A 5IAYA 3GNGA 3CD6A 3FIFA 3QO3A 3QZ9B 3DLMA 4FIBA 4M78E 4ZGDB 1VQOA 1BI0A 3RKXA 1YIJT 1Q86C 1KD1C 3HKSA 4LDUA 3QYGB 3C12A 3INZA 4JS4A 1ZHIA 3OYYA 1JRIA 4MMLA 3FDRA 5GANd 2P0PA 3M4YA 3SDZA 2XK0A 4J5YA 4EMGA 2XD0A 2L3RA 1Y96A 5FU7B 5J3BA 3TCJA 1M1KC 1WJRA 5D6WA 5I21A 3M53A 4M7DB 2DXTA 5M9OA 3CCET 3OYEA 2VXFA 1WNLA 3HRTA 4M77F 4C8QF 4CI0C 1RL2A 3QDRB 2ZPHB 3I56A 3E9FA 1BI3A 1Y07A 2QQAA 3CCMA 5CKHA 3SFMA 3FC3A 2VGNA 4J6WA 4C5GA 4IKFA 2IG0A 3JCMf 5GMKj 3JB9H 2HNIA 3META 3VJPA 2E6NA 4KUDK 3CCST 4HT9A 1VQPA 3OYFA 2R5AA 1H641 1OYXA 1WJQA 3ME9A 3QHSA 3WXMB 1FXXA 4ELYC 4N0AC 3MCAB 2DD5A 3LWHA 3CMET 3LWIA 4DQ2A 2XDDA 2KSSA 3S3OA 1QVGA 1KC8C 3RERA 2DPPB 4M7DF 2X4WA 2CZ6B 2DVEA 2JTMA 2RHXA 2DZ9A 5LJ3j 2QXFA 4KT0E 2LCLA 1M90C 3L2ZA 3OSSC 2Y90A 3CC7T 1QVFA 2XDPA 2BKDN 4B9XA 3T9NA 2X4XA 5HK0A 4M7AG 3FJPA 3LGLA 3JCMh 1X6OA 5GAMh 3GIBA 4NOYA 1YJWT 3J7AF 4NL2A 4M7AA 5FU6B 3SWNA 4ZN3A 3RIRA 3GNFB 3M55A 3OSVA 4RG8A 4N4GA 5L8RE 4A54A 3M59A 3OYJA 4M7AE 2K57A 3HSBA 1KHIA 4TVRA 3CPFA 2CZ7B 2QQRA 2K4YA 5CQXA 4V2SA 3X28B 2F5KA 3QBYA 3QKJA 4BACA 1MGQA 4JRIA 4L6V5 1KQSA 2EQUA 1N9SA 4VUBA 4F7UB 2DTHA 1N8RC 1VQ4T 1YI2T 1NJIU 2GFUA 4C5IA 4DOVA 2LC4A 4PNOA 4Y91A 2MAMA 3JAME 2KMTA 3TEEA 4BDZA 4M78C 3TREA 3G6EA 1MHNA 5CVIA 4LDWA 2D6FA 3JB9G 5DM7R 4M75E 2O4XB 3A8OB 3JCMW 2HBPA 1UGSB 4OB3B 1FX7A 2VXEA 2E5QA 5EG2A 3CD6T 4LD9K 2VUBA 5C0MA 1BI1A 5KH6A 2YRVA 3OMGA 3JCMg 1PSEA 2PU9B 5GAMg 1FWZA 4J6XA 3CCQT 1YJ9T 3MP1A 5GAN7 4FT2A 4JRKA 5HK3A 3CXCS 4OF1A 2ZPFB 1NE8A 3JCMd 2YLCA 1RI0A 3GF5A 4J7FA 1W4SA 3LX7A 5LJ3d 4A4EA 2GFAA 4XTYA 5A0LA 3PGGA 4MDXA 1VQMA 3OYDA 4HCCA 1WGSA 3CCVA 1NPRA 2P0KA 4X9DA 2PUKB 3OS0A 3QZ5B 3JCMV 3QJYA 3CCJT 5GAN2 2DTOA 3A5ZB 4F7UA 3OYAA 2XIDA 4QW2A 1W2BA 3CBPA 2VYTA 3CCLT 3ASKA 4ME7A 4F7UE 4ZTJA 1GXIE 4C5EA 3HFNA 3I56T 2ZPGB 5LJ5j 1YJNT 5GAMj 3VU3C 3M5AA 3EFRA 5A0DA 3SWNB 4RCBA 5I2SA 2ZZDA 3CCLA 1LNXA 3CPWS 2RK2A 4QQGA 1K8AU 3OYCA 1DJ7B 3MEWA 2QQ9A 3CCUA 4R55A 2WSCE 2EWNA 3CCJA 4IUUA 5CAIA 3QG1A 3QXEB 2ZPIB 2OAUA 2QA4A 1ZQ1A 3OMCA 4L59A 1VQ5T 5CKBA 3JCMQ 4C8QC 1VQ9T 3X20B 4EMKA 1BIAA 1KQ1A 3OA6A 2QA4T 5GANg 1M8VA 2RA2A 3DKMA 2GCXA 2EJ9A 2XI9A 2OTJT 3BW1A 1S72T 2QQSA 1G3WA 3TU4K 5DLOA 2JOYA 2YLBA 4A4HA 3RESA 4M77B 5GANe 4N4HA 5A0GA 3E9GA 4C8QE 2EJFA 3RUXA 1YCYA 3C4SA 2E6ZA 4PLIA 3V7RA 3G71A 2IVWA 4FSXA 4Q5WA 5LJ3f 3OYMA 2B8AA 3GOXA 3JCMX 2V8JA 4J8OA 2EAYA 4C8QD 2K5FA 2R57A 3UWNA 4ZGEB 1VQLA 3AHUA 5GAMe 3S3MA 2JTFA 3VUBA 3CCVT 1VQ4A 2DZCA 5DLQE 5LJ5d 3CC4A 2RHUA 4B9WA 3SB2A 1HK9A 5GANh 1SSFA 1WJSA 3J80E 1VQ6T 2DXUA 2DKGA 2LNVA 4P5NA 3M54A 3X25B 1U1SA 4A53A 3G7ZA 3C94A 1U1TA 4BY6C 4M78D 1IREB 4C0FA 3JCMP 4M7AC 2LCCA 3HRSA 2LTOA 2K3XA 3UDCA 3GLXA 4WF2A 5C6SA 5GMKe 2NLUA 5KCOA 1K8AC 3HL8A 3HHTB 2Y4XA 1JJ2A 2EQJA 3E1SA 5J39A 3OYKA 2LT1A 3BDLA 2P4TA 1AHJB 4UC4A 4E7KA 1VQ8T 3RKWA 2KQWA 5FRNA 1KD1U 3RMQA 2CZ0B 4M75C 1VQPT 4DOWA 5KE2A 2QDYB 1KQ2A 3A8LB 4LDYA 3CMEA 3CMAA 2A7YA 4NS5A 3CBOA 5GAOl 2LVMA 3ER0A 3PNWC 3CCSA 4BB7A 1N9RA 2EKOA 2KAFA 3OQ5A 4M75G 1UB4A 2FB7A 3M4GA 2M1HA 3WVEB 2LQ8A 4ZN1A 2VGMA 4OMFB 5CKFA 5GMKh 4M75D 4OP0A 5GMKl 3JB9F 1XNIA 3P8BB 4MZTA 1LJOA 5GAMd 4BUGA 1S72A 5FRMA 2R58A 1I8FA 2LQKA 4E7IA 4PJOG 4C8QA 4QVCA 1K73C 4M77A 1TH7A 5CCAA 2RH2A 2MF2A 2RJFA 1PSFA 3OYNA 3CC2T 3OYHA 4Z02A 2DIGA 3L2QA 5LJ5f 3JB9J 2JNGA 1M1GA 5AYFA 3RMSA 2XICA 4XU1A 3CCRT 4BE2A 3LGFA 3CCUT 1YJ9A 4L5GA 1O9SA 2RO0A 1YBYA 2XHCA 1Q81C 2QQBA 2ZPEB 4M7DC 2HAXA 2QEXA 2YHTA 2E70A 1YJNA 2XKOC 2DXCA 4PJOB 2KDSA 2RI5A 4XTWA 2RM4A 3PT9A 1M4ZA 2E10A 1I4K1 2RHIA 4M7DG 2E1HA 3QPHA 4PL6A 1YI2A 1I5LA 3URGA 4LDVA 2EIFA 3P8DA 5CKEA 4ZTFA 1VQMT 5KCHA 3FB9A 1G3SA 3QJ6A 3QYHB 2FL7A 5GMKi 4RKUE 1JJ2S 2M9UA 1XTDA 3HRUA 2D9TA 3BDUA 4M7DE 3BFMA 4CRIA 4XQ3A 3VV0A 5FU6C 2A3LA 4PJOD 1UGPB 2OTJA 2H3JA 1O75A 3PIOA 3CEYA 3FRNA 2QTXA 1YJWA 3O8VA 3PMTA 3OB9A 3L42A 4C92E 1W2BS 4N4IA 2QI2A 3C95A 5GAN4 3OYIA 1KHCA 5J26A 4C92B 2XG8D 3CC4T 1VQ5A 4RG2A 3CBMA 2L8DA 4C92D 2CS7A 4XU2A 4BE1A 4HT8A 3JB9I 4KULA 5FLXE 4EPCA 1K73U 3EFSA 3N5BB 4JLGA 1Q7YU 1Y96B 4OB0B 3R6OA 4BI4A 3H6ZA 3V8LA 2RJCA 2E12A 3X24B 2VV5A 1KG1A 3CCMT 4M78F 4HCBA 2F5TX 4EMKB 2JVVA 2DJZA 2HD0A 2V8KA 2ZPBB 4C92F 1NZ9A 3L2UA 5DY9A 1G3YA 2WSFE 1UGRB 2RK1A 4MZPA 3PFSA 1B34A 1QW1A 1Q86U 4OB2B 2XDBA 5LJ3h 3JSCA 4MDWA 2BIVA 2JN0A 3L2RA 1HXDA 5LJ5e 1Y71A 4C0DC 3PIPA 3J81E 5FROA 1VQ9A 1M9SA 4N0AA 3NFCA 1VQKT 3I55A 2BUDA 2DEQA 3VYGA 4E7HA 5GAN6 1UGQB 3M58A 1OZ3A 3OBWA 2KK4A 2Y4YA 3JCMb 3MP6A 2CYZB 4PJOC 2E64A 3QSUA 5LJ3e 2DAQA 3GP8A 3H8ZA 3CCEA 2GF7A 3KXTA 4C92G 1G3TA 4LDXA 3LW5E 5CKDA 4FU6A 4D6WA 4OGEA 4XTVA 3S6WA 4OGCA 3JRZA 4X9CA 3CXCA 1VQLT 4XTXA 2CZ1B 3A8GB 2K3YA 3JB9D 1WQWA 4C8QG 3JCMe 1M90U 2R5MA 4KUIA 4J6YA 2PQWA 4C0ZA 4C92C 5LJ3g 5GMKm 1YIJA 3MP8A 3OW2S 3VUZA 1KC8U 3HP9A 1BIBA 3MEVA 1P92A 4M77C 4ATOA 4IURA 3CPWA 5LL6S 3UPUA 4E47A 2DD4A 4OVAA 1M1FA 4EDUA 1Q7YC 3ZBDA 4HKEA 4QQ6A 1VQOT 3CCQA 1VUBA 2E65A 3NTKA 4IUVA 2VC8A 3MO8A 2PVOB 3DB3A 3OYBA 1NPPA 2EYQA 3MEUA 4HCZA 4PLLA 3L2VA 1YHQA 2V8IA 5IT9E 1VQ7T 1D3BA 4M75B 3L1AA 4XU3A 4A4FA 2M0OA 2K5LA 1X01A 4O5VA 4XK8E 5I2MA 4IUQA 3WVDB 3KUFA 4PKCC 4FT4A 3CMAT 1Q82U 3G6ET 4E7JA 3HPWA 2LRQA 4PJOF 2DIQA 5CO7A 1VIFA 2K5IA 1JB0E 4II1A 4RMOA 4KBMB 3V8JA 4C8QB 5CK9A 4JUVA 5GAOp 5A2QE 3S3NA 4E7LA 4Y28E 2RJEA 5HKCA 3GPLA 2OTLA 5D6YA 2L5QA 2EFIA 3MHXA 5GAN3 1QVFS 2O4XA 2EQMA 4IUPA 2WSEE 4M77G 4M75F 2RB6A 3SD4A 3NTHA 3G71T 2DTIA 1BYMA 4EMKC 4DA4A 4OB1B 2PUOB 4XTZA 3P8HA 1WQ7A 5D6XA 4BDYA 3OW2A 4JS5A 4GLKA 2DXBA 2E41A 4FL6A 1BKBA 1VQNT 4C0GA 3HFOA 3RKYA 4JDSA 3FEOA 3EAEA 3MEAA 2KVQG 1G5VA 1OI1A 4J7IA 3KBGA 4PJOE 2X4JA 4QQDA 4M75A 4J83A 1D3BB 3M56A 2P0QA 1WPYA 4XAXB 1VQKA 3F70A 4M78G 4XU0A 3VKIA 3A8HB 1H3ZA 3DB4A 2CKKA 2MMPA 2PVGB 1Y7XA 2EJGA 3E19A 2MI6A 1QVPA 1XQHA 2JZ2A 1VIEA 2RI2A 4MZMA 3LLRA 3JCMc 5GAOm 1K9MU 1M1KU 2CGHA 1I81A 4XTUA 3PTAA 2ZGWA 5LJ5g 4BD3A 2RI3A 3V7CA 1OZ2A 5GAOr 4QVDA 2QEXT 3LH0A 2D0QB 2MWPA 4NL3A 1NJIC 5FU7C 4F7UF 3FLGA 4M78B 2OTLT 1X75C 2FHDA 4MMKA 2LT4A 4HA8A 5CIUA 2L89A 2ZCFB 4M77D 5HY6A 3LYIA 4ZGJB 1Q82C 2JUFA 2WACA 1R8OB 3UT1A 4C5HA 4C92A 1BI2A 1KQSS 4JLIA 1XOVA 3CCRA 2DO3A 4C0DB 3G4ST 4M7AF 2RHZA 2FYKA 4RCCA 2AHJB 2F69A 3OS5A 4IUTA 2MWOA 4BI8B 2O01E 5GANf 4LD6A 3I55T 1YITT 4O6JA 1QP2A 5CQYA 1IZ6A 2KY9A 5GAOq 4YTLA 4BI3A 1U8RA 4ELZC 2X35A 3CC2A 3OYLA 5GANj 1YHQT 1EIFA 3L2WA 4M7DA 4FM4B 4JRQA 5GAN5 2X4YA 1VQNA 2LX9A 4X34A 4BE0A 4M7AB 1UEBA 3M9QA 3QIIA 3SWNC 1LOJA 2G3RA 3ZFJA 4BY6B 3OS1A 3OYGA 2RHYA 3BY7A 1M5Q1 1QP3A 5LJ5h 5KE3A 5IN1A 5CR2A 1K9MC 1QVGS 3V7SA 3OY9A 3CC7A 4EMHA 3A8MB 4PJOA 1JBMA 2PVDB 4QVZA 3M57A 5GAMf 1N6AA 2RJDA 1YITA 1B34B 2XU8A 2I2LA 3G4SA 1V29B 2M16A 4M7DD 1N8RU 4F7UG 1N27A 1VQ8A 2EQKA 4GY5A 4JJNK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RH2 A;  2OAU A;  2RK2 A;  3T9N A;  2RK1 A;  2P4T A;  1VIE A;  3UDC A;  3SFM A;  2VV5 A;  1VIF A;  2GQV A; 
#chains in the Genus database with same CATH topology
 2HQE A;  1D0Y A;  2K2V A;  3X26 B;  1VYT A;  4J9I A;  1UJ0 A;  2CH4 A;  2ECZ A;  1FMV A;  2DK3 A;  3V8K A;  5IAY A;  1UFF A;  3FIF A;  1M3A A;  4M78 E;  3RKX A;  1H3H A;  1YFN A;  1ZUU A;  1J3T A;  3C12 A;  4QKU A;  2O2O A;  4MML A;  1KSW A;  4JPB W;  2P0P A;  3M4Y A;  1QKX A;  3U23 A;  2RF0 A;  2MOX A;  3VS0 A;  5I21 A;  1WXB A;  3KFV A;  4RUG A;  2HKQ B;  2VXF A;  4M77 F;  1RL2 A;  2YXY A;  3CCM A;  1Y07 A;  2VGN A;  4J6W A;  2IG0 A;  2CSQ A;  4K11 A;  3MET A;  3VRZ A;  4KUD K;  3CCS T;  1VQP A;  3OYF A;  3WXM B;  4F14 A;  3MCA B;  3CME T;  1QVG A;  3RER A;  2JTM A;  2DVE A;  5LJ3 j;  3RNJ A;  1SG5 A;  2X4X A;  3JCM h;  3GIB A;  4NOY A;  4ZN3 A;  1SHG A;  3OSV A;  4A54 A;  1WHG A;  3M59 A;  4CC7 A;  1KJW A;  2EVR A;  1KHI A;  2L3P A;  4VUB A;  4F7U B;  2DTH A;  1VQ4 T;  1NJI U;  2GFU A;  4DOV A;  1G83 A;  1YNZ A;  4Y91 A;  2MAM A;  3SEM A;  2HSE B;  4BDZ A;  1OV3 A;  1QVG P;  5DM7 R;  2O4X B;  1TXQ A;  3JCM W;  2IIM A;  1UGS B;  1UHC A;  2KYM A;  3VRY A;  2VUB A;  2RNA A;  5KH6 A;  2YRV A;  1C6V X;  4J6X A;  4FT2 A;  3CXC S;  3OYH A;  3GF5 A;  2GFA A;  1QMC A;  2L2P A;  1MMG A;  1NPR A;  1B3Q A;  2PUK B;  1Y57 A;  3QZ5 B;  3JCM V;  5GAN 2;  1AWW A;  3NGP A;  2XID A;  7AT1 B;  3ASK A;  4ZTJ A;  3PVL A;  1GXI E;  3M5A A;  1VYU A;  3OYC A;  1DJ7 B;  2K6D A;  4R55 A;  2WSC E;  2EWN A;  3LH5 A;  4IUU A;  5CAI A;  2ZPI B;  1N5Z A;  2C0T A;  3OMC A;  1NYG A;  5CKB A;  4CC3 A;  3EH1 A;  4R0K A;  1BIA A;  2QA4 T;  5GAN g;  3AT1 B;  2OTJ T;  1S72 T;  1BB9 A;  2LJ1 A;  2JOY A;  4A4H A;  4M77 B;  3E9G A;  3V7R A;  3G71 A;  2IVW A;  3I35 A;  1MMA A;  5KYY A;  2V8J A;  1RAA B;  4ZGE B;  1GCQ C;  5GAM e;  3CCV T;  2O9V A;  1GRI A;  4JZ3 A;  4B9W A;  2VWF A;  4AMC A;  1WJS A;  2OAW A;  1QKW A;  3G7Z A;  3C94 A;  4M78 D;  4HCK A;  2LTO A;  2XMF A;  3HL8 A;  3VS5 A;  2AZV A;  2LT1 A;  3BDL A;  2VKN A;  5FRN A;  1KD1 U;  2QAZ A;  2MIO A;  1VQP T;  2QDY B;  1KQ2 A;  3A8L B;  2EW3 A;  2A7Y A;  1U5S A;  3CBO A;  5GAO l;  2OJ2 A;  1N9R A;  2CP6 A;  3OQ5 A;  5IXB A;  3WVE B;  4OMF B;  5CKF A;  5GMK h;  3JB9 F;  1XNI A;  2ROT A;  2EQI A;  1BK2 A;  1LJO A;  5GAM d;  1S72 A;  4E7I A;  4PJO G;  1K73 C;  1OOT A;  1RAI B;  2BZY A;  5CCA A;  3CC2 T;  1WHM A;  2FRY A;  2OI3 A;  3M0P A;  3JB9 J;  5AYF A;  4BE2 A;  2GQI A;  5KYW B;  2ZPE B;  2QEX A;  2QTV A;  1ZA1 B;  4DEX A;  2KDS A;  2DET A;  1M4Z A;  2E10 A;  2DEU A;  3QPH A;  4PL6 A;  3URG A;  5KCH A;  4RKU E;  1JJ2 S;  1XTD A;  1W2B P;  3BFM A;  1Q82 R;  2YRC A;  1D1A A;  4PJO D;  1UGP B;  2OTJ A;  2H3J A;  2JMA A;  1ZBJ A;  3EGU A;  3OB9 A;  1W2B S;  1PM3 A;  2XG8 D;  3CBM A;  1Z9Z A;  2L8D A;  2HL5 C;  3JB9 I;  5FLX E;  2V26 A;  4GBQ A;  4EPC A;  1IGU A;  2E12 A;  2HMA A;  4EMK B;  1TUG B;  2JVV A;  1C0M A;  2ZPB B;  4FYW B;  1H92 A;  2RK1 A;  1TUD A;  1VQ9 Q;  3JSC A;  4MDW A;  2BIV A;  4RTZ A;  3L2R A;  1HXD A;  5LJ5 e;  1Y71 A;  1SKU B;  3H0F A;  1AWX A;  2E3H A;  2O31 A;  4E7H A;  5GAN 6;  1ABO A;  3M58 A;  4AFZ C;  1ZSG A;  3GP8 A;  3CCE A;  1G3T A;  4OGE A;  4XTV A;  1VQL T;  2KT8 A;  1YWP A;  3A8G B;  1FMW A;  4C8Q G;  3VS4 A;  5LJ3 g;  4C0Z A;  1YIJ A;  4OML A;  4ATO A;  1D0X A;  2PTK A;  2DFU A;  1PWT A;  2FPD A;  2KRN A;  1TUC A;  1M27 C;  4DEY A;  4XU3 A;  2K5L A;  1X01 A;  4XK8 E;  4IUQ A;  2PZ1 A;  1Q82 U;  4ANJ A;  4E7J A;  5CO7 A;  2C0O A;  4RMO A;  5CK9 A;  1CSK A;  2L5Q A;  3VS3 A;  3SD4 A;  3G71 T;  4XTZ A;  1WQ7 A;  1TG0 A;  4BDY A;  2DXB A;  3HFO A;  2CP2 A;  2KVQ G;  5GJW B;  1OI1 A;  4J7I A;  2MYS A;  2K3B A;  1LVK A;  3VKI A;  2X51 A;  1AWJ A;  3A8H B;  1H3Z A;  3JCM c;  2RI2 A;  1QVP A;  4XTU A;  2ZGW A;  5LJ5 g;  5GAO r;  3H0I A;  1NJI C;  5FU7 C;  2CUD A;  4KH0 B;  3FLG A;  4F7U F;  1Q82 C;  4HA8 A;  1W1F A;  3LYI A;  4DBH A;  4PJJ A;  4CC4 B;  1XOV A;  1BBZ A;  2DO3 A;  3CME Q;  2BE9 B;  1YIT T;  1QP2 A;  2RQR A;  1U8R A;  4ELZ C;  3OYL A;  1HSQ A;  1K0X A;  2EGE A;  2DLP A;  1WHH A;  5GAN 5;  1VQN A;  1X69 A;  4X34 A;  2RN8 A;  1UEB A;  2DL3 A;  1LOJ A;  2ENM A;  3ZFJ A;  4ORZ A;  1VYV A;  4QT7 A;  1NYF A;  3G4S A;  1V29 B;  2M16 A;  1SEM A;  4F7U G;  1GFD A;  1S1N A;  1IB8 A;  2YWW A;  4AG1 C;  5GAN 8;  3NMZ C;  1WZO A;  2NUP B;  3QUI A;  1ZBX A;  1Q81 U;  4AFS C;  1OQK A;  4JZ4 A;  2HQX A;  3NTI A;  1VQ5 Q;  1VQ6 A;  2J6O A;  3GNG A;  3CD6 A;  3DLM A;  4FIB A;  2J06 A;  3HKS A;  3INZ A;  3OYY A;  1JRI A;  2CP7 A;  3SDZ A;  5FWC A;  4J5Y A;  3CQT A;  1Y96 A;  5J3B A;  3TCJ A;  4DBQ A;  1GBR A;  2F2W A;  5D6W A;  3OYE A;  4CI0 C;  4E7Z A;  1ZX6 A;  2ZPH B;  2COY A;  5IHI A;  3FC3 A;  4E2F B;  1K4U S;  2KBT A;  4ELY C;  1WJQ A;  3ME9 A;  4J9E A;  4M7D E;  3G4S Q;  4DQ2 A;  2KSS A;  4M7D F;  2DPP B;  2CZ6 B;  2KRO A;  5IXF A;  4KT0 E;  1M90 C;  3CC7 T;  2XDP A;  2BKD N;  4B9X A;  1VA7 A;  4F16 A;  8AT1 B;  4M7A G;  2EYX A;  3J7A F;  4NL2 A;  3G71 Q;  3M55 A;  4RG8 A;  3OYJ A;  4PJM A;  2K57 A;  1D0Z A;  3HSB A;  2YRD A;  2CZ7 B;  2QQR A;  2K4Y A;  5CQX A;  4V2S A;  1IHW A;  3QKJ A;  3EGD B;  3CCU Q;  1N8R C;  1X6G A;  3I5S A;  4C5I A;  2LC4 A;  4PNO A;  1YN8 A;  3H0H A;  3JAM E;  2KMT A;  3TRE A;  1MHN A;  1RAF B;  1NJI R;  4M75 E;  3A8O B;  4OB3 B;  2YUP A;  5EG2 A;  3CD6 T;  2LZ6 B;  4LD9 K;  5C0M A;  1BI1 A;  2A08 A;  3OMG A;  2V1Q A;  5GAM g;  5GAN 7;  1SPK A;  1TS9 A;  3M0Q A;  4J9H A;  3JCM d;  1ZSZ C;  2YLC A;  1W4S A;  1UE9 A;  1QLY A;  4XTY A;  2JXB A;  4LNP A;  2P0K A;  3OS0 A;  4DBF A;  2DTO A;  1WX6 A;  5KYX A;  1NEG A;  3QDF A;  3CBP A;  2VYT A;  2NUT B;  4ME7 A;  2QGF B;  1VQ4 Q;  4RTY A;  1AVZ C;  3HFN A;  2ZPG B;  4DBR A;  5A0D A;  5I2S A;  2ED1 A;  5KYY B;  3MEW A;  3QWY A;  2QQ9 A;  3CCU A;  2JW4 A;  5ECA A;  4EIK A;  1WHJ A;  2L0A A;  4L59 A;  1VQ5 T;  3JCM Q;  1VQ9 T;  1SF9 A;  1OPK A;  1WHK A;  4J9B A;  1QWE A;  3EHQ A;  1G3W A;  3RBB B;  1YCS B;  5DLO A;  2YLB A;  3RES A;  5GAN e;  1QVF P;  2EJF A;  1YCY A;  3C4S A;  2E6Z A;  3EGX B;  1T0J A;  1VQM Q;  4FSX A;  4KGZ B;  5LJ3 f;  3THK A;  3GOX A;  3JCM X;  2KEA A;  4C8Q D;  2R57 A;  3UWN A;  2JTF A;  2K79 A;  1VQ4 A;  2DZC A;  5DLQ E;  3CC4 A;  3VS2 A;  1SSF A;  1FYN A;  1AWO A;  1KK7 A;  3BE3 A;  4A53 A;  1U1S A;  1U1T A;  2QGG A;  1OEB A;  2LCC A;  2CT3 A;  3HRS A;  6AT1 B;  3UDC A;  4WF2 A;  3I56 Q;  5IH2 A;  4M4Z A;  1K8A C;  5KCO A;  2EQJ A;  3E1S A;  2FG0 A;  4E7K A;  1VQ8 T;  1UEC A;  3RKW A;  1Q95 G;  3RMQ A;  2RQV A;  3CME A;  3ER0 A;  3CCS A;  2KXD A;  1IRX A;  2FZK B;  2DER A;  1EX4 A;  1UB4 A;  2LQ8 A;  2VGM A;  2DRK A;  2D8J A;  4J9G A;  4MZT A;  1OUL A;  2R58 A;  2RMO A;  2LQK A;  4M77 A;  2RH2 A;  2RJF A;  4AT1 B;  3OYN A;  3HTR A;  2J6F A;  1ZSZ A;  1M2O A;  2HKN A;  4Z02 A;  1A0N B;  1I07 A;  1YIT Q;  3CCR T;  3RMS A;  4XU1 A;  1K1Z A;  4L5G A;  2CT4 A;  2LP5 A;  2RO0 A;  1YJW Q;  2QQB A;  4M7D C;  2SEM A;  1R0C B;  4PJO B;  1WFW A;  3PT9 A;  4M7D G;  1BCO A;  5CKE A;  1VQM T;  1T0H A;  1G3S A;  2FL7 A;  2H8H A;  5GMK i;  2M9U A;  2C0I A;  3MKD A;  1TOV A;  4CRI A;  5FU6 C;  1TSF A;  1RAB B;  1O75 A;  3PIO A;  3FRN A;  2QTX A;  3PMT A;  1C1A A;  3OYI A;  5GAN 4;  1JJ2 P;  4C92 B;  3CC4 T;  1TU0 B;  3D7S B;  2HZY A;  4C92 D;  2DBK A;  4OMP A;  1VQP Q;  3EFS A;  3N5B B;  1KC8 R;  4JLG A;  1Q7Y U;  4OB0 B;  3R6O A;  4BI4 A;  3V8L A;  2BE7 D;  2RJC A;  3X24 B;  1RAC B;  2VV5 A;  4LUD A;  4M78 F;  2F5T X;  2DYB A;  3L2U A;  1RAD B;  4PJN A;  1G3Y A;  1UGR B;  1GFC A;  2F2X A;  1PNJ A;  1Q86 U;  2CUB A;  1AD5 A;  2AK5 A;  3J81 E;  1VOM A;  2ROL A;  1VQ9 A;  3NFC A;  1VQK T;  2Z0W A;  1MUZ A;  5IHK A;  5FWB A;  3JCM b;  3MP6 A;  3CD6 Q;  2CYZ B;  1YHQ Q;  3QSU A;  5LJ3 e;  1Q86 R;  4C92 G;  4LDX A;  3S6W A;  4X9C A;  2CZ1 B;  2K3Y A;  4Z89 A;  1WQW A;  1WXU A;  3H41 A;  3JCM e;  2JM9 A;  1M90 U;  4J6Y A;  4KGV B;  4C92 C;  1Q7Y R;  3OW2 S;  3VS7 A;  3HP9 A;  4M77 C;  5LL6 S;  4OVA A;  1Q7Y C;  3ZBD A;  3PE0 A;  4HKE A;  4QQ6 A;  1VQO T;  1WYX A;  3DB3 A;  1NPP A;  2EYQ A;  4WCI A;  2FO0 A;  4PLL A;  2V8I A;  3UA6 A;  5IT9 E;  1D3B A;  4M75 B;  4A4F A;  3REA B;  3I9Q A;  4PKC C;  3WVD B;  3HPW A;  4PJO F;  2DIQ A;  2DYI A;  1VIF A;  2K5I A;  4II1 A;  4KBM B;  4A63 B;  2DL8 A;  4JUV A;  4Y28 E;  2DMO A;  3GPL A;  1K9A A;  3MHX A;  2O4X A;  4M77 G;  1BYM A;  4EMK C;  4OB1 B;  2PUO B;  1Z9Q A;  3P8H A;  2JS0 A;  1OU9 A;  4JS5 A;  4GLK A;  1HYO A;  3RKY A;  3EAE A;  1G5V A;  4WTO B;  1Q81 R;  4PJO E;  1ZLM A;  4QQD A;  1WDX A;  3M56 A;  2P0Q A;  1WPY A;  3DB4 A;  2CKK A;  1Y7X A;  3E19 A;  2PNI A;  2JZ2 A;  4MZM A;  1IO6 A;  2DBM A;  2EGC A;  1UDL A;  3EG1 A;  1SSH A;  3V7C A;  1OZ2 A;  4QVD A;  2COZ A;  4M78 B;  2FHD A;  2YDL A;  2L89 A;  4ZGJ B;  4C5H A;  4C92 A;  1BI2 A;  2EPD A;  4M7A F;  4FCY A;  3GBQ A;  2AHJ B;  4IUT A;  4BI8 B;  4O6J A;  1IZ6 A;  2KY9 A;  2X35 A;  1EIF A;  1X27 A;  3CXC P;  1OPL A;  2GTJ A;  4BE0 A;  3QII A;  3M9Q A;  1UGV A;  2G3R A;  3OYG A;  3OS1 A;  3BY7 A;  1QP3 A;  5KE3 A;  1QQJ A;  3C0C A;  1QVG S;  4PJO A;  3CC7 A;  3A8M B;  1WI7 A;  1JBM A;  2PVD B;  1B34 B;  1NBE B;  2XU8 A;  1K9M R;  1WLP B;  2BTT A;  4JRI A;  2LDM A;  3VS6 A;  2RD1 A;  3EG9 A;  5KYN A;  2C06 A;  3PMI A;  3VYH B;  2OTJ Q;  2GQV A;  3ZEH A;  3CCM Q;  1ZSZ B;  3OS2 A;  2KT1 A;  4A4K A;  1VQ7 A;  3DLL A;  1UHF A;  4JJB A;  4M77 E;  4M7A D;  2RQU A;  1KD1 R;  3QZ9 B;  2HQH A;  2QG9 B;  3QYG B;  4HVV A;  2DL7 A;  3FDR A;  5GAN d;  2X9H A;  1MMN A;  2XK0 A;  2XD0 A;  3MJX A;  4EMG A;  2L3R A;  5FU7 B;  5KYX B;  4M7D B;  1WNL A;  2MK5 A;  2J05 A;  1BI3 A;  2QQA A;  4F04 B;  1K8A R;  5CKH A;  3SFM A;  4C5G A;  4IKF A;  3JCM f;  5GMK j;  3JB9 H;  2HNI A;  3VJP A;  2E6N A;  2QEX Q;  4JRQ A;  2R5A A;  2ATC B;  3LWH A;  2XDD A;  1QCF A;  2X4W A;  2QXF A;  2LCL A;  1JXM A;  3L2Z A;  3OSS C;  4AFQ C;  2BZX A;  5HK0 A;  2HDA A;  3LGL A;  2MCN A;  1X6O A;  5GAM h;  3SWN A;  5L8R E;  4N4G A;  2AKK A;  2EYZ A;  2KRM A;  4PFO A;  4TVR A;  1HJD A;  1PCX A;  3X28 B;  2F5K A;  4BAC A;  4L6V 5;  1N9S A;  4M78 C;  2AKL A;  1I5O B;  2D6F A;  3JB9 G;  1GCQ A;  1FX7 A;  2VXE A;  2D0N A;  1RI9 A;  1KFZ A;  1PSE A;  2PU9 B;  3CCQ T;  1FWZ A;  3MP1 A;  4JRK A;  1NE8 A;  1RI0 A;  2JTE A;  4A4E A;  5LJ3 d;  4MDX A;  5A0L A;  3PGG A;  1VQM A;  2EBP A;  3CCV A;  5IHN A;  2J7I A;  3CCJ T;  3A5Z B;  2DIL A;  4KRT A;  1W2B A;  2J6K A;  4QW2 A;  3TSZ A;  3CCL T;  4PFZ A;  3JV3 A;  3G6E Q;  4F7U E;  1S72 Q;  4C5E A;  1EZZ B;  5LJ5 j;  1YJN T;  4LXC A;  2QA4 Q;  3VU3 C;  1R0B G;  4F17 A;  2HBW A;  1PC0 A;  3SWN B;  3CCL A;  1LNX A;  2RK2 A;  1H8K A;  3UA7 A;  3CCJ A;  1AEY A;  2QYZ A;  2QA4 A;  4C8Q C;  3X20 B;  3DKM A;  2EJ9 A;  2MPX C;  2QQS A;  4D8D A;  3EGX A;  1X43 A;  4C8Q E;  2RPN A;  4PLI A;  1NG2 A;  3M0U A;  2B8A A;  2EAY A;  1VQL A;  3EHR A;  3S3M A;  2QDL A;  3VUB A;  5LJ5 d;  2V1R A;  4B6M A;  3SB2 A;  1PD1 A;  1HK9 A;  5GAN h;  3J80 E;  2DXU A;  2LNV A;  1MNE A;  3M54 A;  4BY6 C;  4M7A C;  1IRE B;  2HCK A;  4C0F A;  2YUQ A;  5GMK e;  2NLU A;  3CC2 Q;  1UJY A;  3OW2 P;  1JJ2 A;  2ABL A;  3OYK A;  2P4T A;  1RAE B;  4LE9 A;  1AOJ A;  2CZ0 B;  4M75 C;  5KE2 A;  4NS5 A;  1MND A;  2GTO A;  4FYV B;  3PNW C;  1UTI A;  2CP3 A;  4M75 G;  2FB7 A;  2LQN A;  1ABQ A;  3A1P A;  2KGT A;  4M75 D;  4OP0 A;  3P8B B;  1VQ8 Q;  5FRM A;  1I8F A;  2VAS A;  2GNC A;  2VVK A;  3VS1 A;  2MF2 A;  1QCO A;  2X3X D;  3L2Q A;  5LJ5 f;  2XIC A;  3NPF A;  4J9D A;  3TQ7 P;  4IIM A;  1YBY A;  2DL5 A;  2XHC A;  4HVW A;  1ARK A;  2HAX A;  2YHT A;  2E70 A;  1E6H A;  1YJN A;  2D8H A;  2RI5 A;  2LJ3 A;  2E1H A;  2LNH B;  2EIF A;  3P8D A;  4ZTF A;  3FB9 A;  3QJ6 A;  3QYH B;  5HCK A;  1W70 A;  3HRU A;  3BDU A;  2JS2 A;  3VV0 A;  2A3L A;  4LUE A;  2FZC B;  3L42 A;  1T3S A;  2QI2 A;  3C95 A;  1Y0M A;  1KHC A;  5J26 A;  4PK4 A;  1HD3 A;  1VQL Q;  2KXC A;  2FPE A;  2CS7 A;  4BE1 A;  4KUL A;  1K73 U;  2YUN A;  1Y96 B;  1V76 A;  1KG1 A;  3CCM T;  5KYU A;  2HD0 A;  2DRM A;  2WSF E;  3M0S A;  3PFS A;  2A0F B;  1QW1 A;  4OB2 B;  4OMQ A;  5LJ3 h;  1JEG A;  2JN0 A;  3PVQ A;  1M2V A;  2CP5 A;  1M30 A;  4LN2 A;  3PIP A;  5FRO A;  1RAG B;  1M9S A;  4N0A A;  4FW1 A;  2DEQ A;  3VYG A;  1LPL A;  4KGX B;  2E64 A;  1PG5 B;  2E4H A;  4X1V A;  2ED0 A;  2H3E B;  3LW5 E;  4FU6 A;  1RUW A;  2F1L A;  1QWF A;  3JRZ A;  4OGC A;  3CXC A;  2CH4 W;  3EG3 A;  3JB9 D;  2PQW A;  5GMK m;  1QCN A;  1BIB A;  3MEV A;  1YJ9 Q;  3CPW A;  3UPU A;  4E47 A;  2DM1 A;  1M1F A;  5FW9 A;  3UAT A;  1VUB A;  2E65 A;  3NTK A;  4IUV A;  2M51 A;  1GCP A;  2M02 A;  1M2V B;  1VQ7 T;  3L1A A;  2DVJ A;  1YI2 Q;  4O5V A;  3KUF A;  4J9F A;  3CMA T;  4RTV A;  5KYW A;  1PKS A;  4C8Q B;  3H9N A;  1CKB A;  3CCJ Q;  5GAN 3;  1VQ6 Q;  1SHF A;  2EFI A;  1NLP C;  4IUP A;  4PJL A;  1D1B A;  1BKB A;  4OMO A;  4C0G A;  1F1B B;  3FEO A;  3KBG A;  2X4J A;  4PFP A;  3EG2 A;  4XAX B;  4XU0 A;  4Z88 A;  2MMP A;  1M3C A;  2EJG A;  1K0S A;  1M1K U;  3LLR A;  1K9M U;  5GAO m;  3CPW P;  2CGH A;  3LH0 A;  2MWP A;  2OTL T;  1X75 C;  5CIU A;  2LT4 A;  2ZCF B;  4OMN A;  2JUF A;  1R8O B;  3UT1 A;  1KQS S;  4JLI A;  3CCR A;  3REB B;  1VQO Q;  4C0D B;  2RHZ A;  2LX7 A;  2KYB A;  5GAN f;  3OS5 A;  3I55 T;  2MWO A;  2O01 E;  4LD6 A;  1AZE A;  2EGA A;  1UG1 A;  5GAO q;  2NUP A;  4BI3 A;  5GAN j;  1YHQ T;  2O9S A;  3L2W A;  2X4Y A;  1SRM A;  4FW2 A;  2LX9 A;  4E7S A;  3EFO A;  3JCM P;  1MMD A;  2RHY A;  1M5Q 1;  5IN1 A;  3V7S A;  3OY9 A;  4EMH A;  1G8X A;  2E5K A;  4QVZ A;  2CRE A;  1N6A A;  2RJD A;  2YUO A;  1VQ8 A;  3CCV Q;  5D6X A;  4CC2 A;  4R56 A;  4JJN K;  3CC7 Q;  1X2Q A;  3E2U A;  3JCM J;  1TWB A;  5D7U A;  3MPU B;  4A4G A;  4M78 A;  3OBY A;  3ULR B;  3Q1J A;  3M0T A;  2LCS A;  3CCS Q;  3RDV A;  4FYX B;  2FVU A;  5GAO n;  4JRP A;  3QO3 A;  1VQO A;  4ZGD B;  1BI0 A;  2LMJ A;  1YIJ T;  1Q86 C;  1KD1 C;  2DJQ A;  1PD0 A;  4LDU A;  4JS4 A;  1ZHI A;  2OTL Q;  2A28 A;  1M1K C;  1WJR A;  1KIK A;  2JJ9 A;  3M53 A;  2DXT A;  5M9O A;  3CCE T;  3HRT A;  4C8Q F;  3QDR B;  1M1K R;  3I56 A;  3E9F A;  3FJ5 A;  2NUZ A;  2ESW A;  3CCQ Q;  2P4R A;  4HT9 A;  1H64 1;  1OYX A;  3QHS A;  1FXX A;  1CKA A;  4N0A C;  2DD5 A;  2DNU A;  3S3O A;  2CP0 A;  3LWI A;  1KC8 C;  2RHX A;  2DZ9 A;  3QWX X;  2Y90 A;  1QVF A;  5EC7 A;  3T9N A;  3FJP A;  1WIE A;  1YJW T;  1M90 R;  4M7A A;  5FU6 B;  3CCE Q;  3RIR A;  3GNF B;  4M7A E;  2FRW A;  1PRL C;  1W6X A;  1B07 A;  3CPF A;  2HSP A;  4HVU A;  2GBQ A;  3QBY A;  1TTH B;  1MGQ A;  1KQS A;  2EQU A;  1YI2 T;  1NEB A;  1BU1 A;  3TEE A;  3UF4 A;  2O88 A;  3G6E A;  2NWM A;  4LDW A;  5CVI A;  2HBP A;  2E5Q A;  1PKT A;  4FYY B;  1U3O A;  3JCM g;  2OX7 A;  1YJ9 T;  1E7O A;  1PRM C;  5HK3 A;  4OF1 A;  2L3Q A;  2ZPF B;  4J7F A;  3LX7 A;  3OYD A;  4HCC A;  1WGS A;  4X9D A;  3QJY A;  2DL4 A;  3EG0 A;  4F7U A;  5I11 A;  3OYA A;  2HL3 A;  1KQS P;  1JU5 C;  3I56 T;  1GBQ A;  5GAM j;  8ATC B;  3EFO B;  3EFR A;  3G1J A;  4RCB A;  1ZUY A;  2ZZD A;  3CPW S;  4QQG A;  1K8A U;  4IIO A;  3QG1 A;  3QXE B;  2OAU A;  1ZQ1 A;  1NLO C;  1ACM B;  1UUE A;  2D1X A;  4EMK A;  4J9C A;  1KQ1 A;  1E6G A;  1YJN Q;  1M8V A;  2RA2 A;  2LQW A;  4Z8A A;  2GCX A;  2XI9 A;  3BW1 A;  1WA7 A;  2BZ8 A;  2EYY A;  3TU4 K;  2ZAE A;  1K73 R;  4N4H A;  5A0G A;  1VQK Q;  4AG2 C;  3RUX A;  1JO8 A;  1PHT A;  4RTT A;  4Q5W A;  3OYM A;  1X6B A;  4J8O A;  2K5F A;  3M0R A;  3AHU A;  1SRL A;  5L23 A;  1N8R R;  1OU8 A;  3EG9 B;  2RHU A;  1VQ6 T;  2DKG A;  4P5N A;  2JMC A;  3X25 B;  2DE0 X;  1IGQ A;  2K3X A;  3GLX A;  3CMA Q;  5C6S A;  1M3B A;  3HHT B;  2Y4X A;  5J39 A;  4UC4 A;  1AHJ B;  2KQW A;  1VQN Q;  1D09 B;  4DOW A;  1EFN A;  2GGR A;  4LDY A;  3CMA A;  1V1C A;  2DF6 A;  2LVM A;  4HXJ A;  2X3W D;  3CC4 Q;  5GJV B;  4BB7 A;  1I1J A;  2EKO A;  2KAF A;  2QK0 A;  3M4G A;  2M1H A;  4ZN1 A;  5GMK l;  3A98 A;  1RAH B;  2LJ0 A;  4Y92 A;  4BUG A;  5I22 A;  4C8Q A;  2G6F X;  4QVC A;  1TH7 A;  2KRS A;  1PSF A;  3RR6 A;  2VB6 A;  2DIG A;  2DX1 A;  2JNG A;  1M1G A;  1ZUK A;  3LGF A;  3CCU T;  2CDT A;  1YJ9 A;  2P84 A;  1O9S A;  1RLP C;  2KE9 A;  1Q81 C;  2FEI A;  2XKO C;  2DXC A;  2FZG B;  4XTW A;  2NUT A;  2RM4 A;  1IHV A;  1K76 A;  3TSW A;  1I4K 1;  2RHI A;  1YI2 A;  1I5L A;  4LDV A;  1B7T A;  1LCK A;  2A37 A;  3NHN A;  2D9T A;  2A36 A;  4XQ3 A;  4RTW A;  2KI7 A;  3CEY A;  1YJW A;  2W0Z A;  3O8V A;  4C92 E;  1VQ7 Q;  4N4I A;  2B86 A;  1XJW B;  3I5R A;  1VQ5 A;  4RG2 A;  3EH2 A;  2E3I A;  2JM8 A;  4XU2 A;  9ATC B;  2YSQ A;  4HT8 A;  1AZG B;  3H6Z A;  2M0Y A;  2SRC A;  4HCB A;  2DJZ A;  2V8K A;  4C92 F;  1NZ9 A;  2L3S A;  5DY9 A;  4MZP A;  1B34 A;  2XDB A;  3I55 Q;  1OX9 A;  1M8M A;  4C0D C;  3R6N A;  1GL5 A;  3I55 A;  2BUD A;  2IPO B;  1UGQ B;  2QAS A;  1OZ3 A;  3OBW A;  2KK4 A;  2Y4Y A;  4RTU A;  3CCR Q;  4PJO C;  3CCL Q;  2DAQ A;  3H8Z A;  2GF7 A;  3KXT A;  5CKD A;  4D6W A;  4XTX A;  3IQL A;  1MV3 A;  4ZNX A;  2R5M A;  4KUI A;  3MP8 A;  3SHW A;  1JXO A;  3VUZ A;  1KC8 U;  1P92 A;  4RTX A;  4IUR A;  2DD4 A;  4EDU A;  4OMM A;  3CCQ A;  1I0C A;  2VC8 A;  3MO8 A;  2K9G A;  2PVO B;  3ZL7 C;  3OYB A;  2JT4 A;  3MEU A;  4HCZ A;  2DA9 A;  3L2V A;  1YHQ A;  2M0O A;  5I2M A;  1IXD A;  4FT4 A;  2AIR B;  2CSI A;  2K2M A;  3G6E T;  4JJC A;  2LRQ A;  1R77 A;  2W10 A;  1JB0 E;  5GAO p;  3V8J A;  5A2Q E;  3S3N A;  4E7L A;  2RJE A;  1X2K A;  5HKC A;  1G2B A;  5D6Y A;  2OTL A;  4AFU C;  1QVF S;  2EQM A;  2WSE E;  1OX8 A;  2RB6 A;  4M75 F;  3NTH A;  1T3L A;  2DTI A;  4DA4 A;  2AT1 B;  2COW A;  3OW2 A;  2AZS A;  2E41 A;  3EGD A;  4FL6 A;  3O5Z A;  1VQN T;  4JDS A;  3MEA A;  1WHL A;  4J83 A;  4M75 A;  1D3B B;  2F2V A;  1VQK A;  3F70 A;  4M78 G;  2YT6 A;  1YWO A;  2PVG B;  4FSS A;  2MI6 A;  1XQH A;  1JQQ A;  1VIE A;  1AT1 B;  1WXT A;  1I81 A;  4KH1 B;  3PTA A;  3TVT A;  4BD3 A;  2RQT A;  2RI3 A;  2QEX T;  2D0Q B;  4NL3 A;  2NYS A;  1NM7 A;  1BCM A;  5HY6 A;  4MMK A;  4M77 D;  2WAC A;  4E6R A;  2I0N A;  3G4S T;  2FYK A;  4RCC A;  4ESR A;  2F69 A;  2KNB B;  2KR3 A;  2FPF A;  5CQY A;  1U06 A;  1ZA2 B;  4YTL A;  3CC2 A;  2HEQ A;  4M7D A;  4FM4 B;  5AT1 B;  2EKH A;  1YIJ Q;  1MV0 B;  4GLM A;  4D8K A;  4M7A B;  1RLQ C;  4BY6 B;  3SWN C;  3OA6 A;  1YP5 A;  1FMK A;  2RQW A;  5LJ5 h;  5KYU B;  2K7A A;  5CR2 A;  1K9M C;  1D1C A;  2EYW A;  5GAM f;  3M57 A;  1YIT A;  2I2L A;  4M7D D;  1N8R U;  1N27 A;  2EQK A;  4GY5 A;  4JJD A; 
#chains in the Genus database with same CATH homology
 4R56 A;  2HQE A;  2LDM A;  3JCM J;  2RD1 A;  2K2V A;  3X26 B;  2C06 A;  5GAN 8;  3PMI A;  3VYH B;  2GQV A;  4A4G A;  4M78 A;  3ZEH A;  3OBY A;  3QUI A;  1ZBX A;  3Q1J A;  3OS2 A;  1Q81 U;  4A4K A;  1VQ7 A;  3DLL A;  4M77 E;  2DK3 A;  2HQX A;  4M7A D;  3V8K A;  2FVU A;  3NTI A;  5GAO n;  4JRP A;  1VQ6 A;  5IAY A;  3GNG A;  3CD6 A;  3FIF A;  3QO3 A;  3QZ9 B;  3DLM A;  4FIB A;  4M78 E;  4ZGD B;  1VQO A;  1BI0 A;  3RKX A;  1YIJ T;  1Q86 C;  1KD1 C;  3HKS A;  4LDU A;  3QYG B;  3C12 A;  3INZ A;  4JS4 A;  1ZHI A;  3OYY A;  1JRI A;  4MML A;  3FDR A;  5GAN d;  2P0P A;  3M4Y A;  3SDZ A;  2XK0 A;  4J5Y A;  4EMG A;  2XD0 A;  2L3R A;  1Y96 A;  5FU7 B;  5J3B A;  3TCJ A;  1M1K C;  1WJR A;  5D6W A;  5I21 A;  3M53 A;  4M7D B;  2DXT A;  5M9O A;  3CCE T;  3OYE A;  2VXF A;  1WNL A;  3HRT A;  4M77 F;  4C8Q F;  4CI0 C;  1RL2 A;  3QDR B;  2ZPH B;  3I56 A;  3E9F A;  1BI3 A;  1Y07 A;  2QQA A;  3CCM A;  5CKH A;  3SFM A;  3FC3 A;  2VGN A;  4J6W A;  4C5G A;  4IKF A;  2IG0 A;  3JCM f;  5GMK j;  3JB9 H;  2HNI A;  3MET A;  3VJP A;  2E6N A;  4KUD K;  3CCS T;  4HT9 A;  1VQP A;  3OYF A;  2R5A A;  1H64 1;  1OYX A;  1WJQ A;  3ME9 A;  3QHS A;  3WXM B;  1FXX A;  4ELY C;  4N0A C;  3MCA B;  2DD5 A;  3LWH A;  3CME T;  3LWI A;  4DQ2 A;  2XDD A;  2KSS A;  3S3O A;  1QVG A;  1KC8 C;  3RER A;  2DPP B;  4M7D F;  2X4W A;  2CZ6 B;  2DVE A;  2JTM A;  2RHX A;  2DZ9 A;  5LJ3 j;  2QXF A;  4KT0 E;  2LCL A;  1M90 C;  3L2Z A;  3OSS C;  2Y90 A;  3CC7 T;  1QVF A;  2XDP A;  2BKD N;  4B9X A;  3T9N A;  2X4X A;  5HK0 A;  4M7A G;  3FJP A;  3LGL A;  3JCM h;  1X6O A;  5GAM h;  3GIB A;  4NOY A;  1YJW T;  3J7A F;  4NL2 A;  4M7A A;  5FU6 B;  3SWN A;  4ZN3 A;  3RIR A;  3GNF B;  3M55 A;  3OSV A;  4RG8 A;  4N4G A;  5L8R E;  4A54 A;  3M59 A;  3OYJ A;  4M7A E;  2K57 A;  3HSB A;  1KHI A;  4TVR A;  3CPF A;  2CZ7 B;  2QQR A;  2K4Y A;  5CQX A;  4V2S A;  3X28 B;  2F5K A;  3QBY A;  3QKJ A;  4BAC A;  1MGQ A;  4JRI A;  4L6V 5;  1KQS A;  2EQU A;  1N9S A;  4VUB A;  4F7U B;  2DTH A;  1N8R C;  1VQ4 T;  1YI2 T;  1NJI U;  2GFU A;  4C5I A;  4DOV A;  2LC4 A;  4PNO A;  4Y91 A;  2MAM A;  3JAM E;  2KMT A;  3TEE A;  4BDZ A;  4M78 C;  3TRE A;  3G6E A;  1MHN A;  5CVI A;  4LDW A;  2D6F A;  3JB9 G;  5DM7 R;  4M75 E;  2O4X B;  3A8O B;  3JCM W;  2HBP A;  1UGS B;  4OB3 B;  1FX7 A;  2VXE A;  2E5Q A;  5EG2 A;  3CD6 T;  4LD9 K;  2VUB A;  5C0M A;  1BI1 A;  5KH6 A;  2YRV A;  3OMG A;  3JCM g;  1PSE A;  2PU9 B;  5GAM g;  1FWZ A;  4J6X A;  3CCQ T;  1YJ9 T;  3MP1 A;  5GAN 7;  4FT2 A;  4JRK A;  5HK3 A;  3CXC S;  4OF1 A;  2ZPF B;  1NE8 A;  3JCM d;  2YLC A;  1RI0 A;  3GF5 A;  4J7F A;  1W4S A;  3LX7 A;  5LJ3 d;  4A4E A;  2GFA A;  4XTY A;  5A0L A;  3PGG A;  4MDX A;  1VQM A;  3OYD A;  4HCC A;  1WGS A;  3CCV A;  1NPR A;  2P0K A;  4X9D A;  2PUK B;  3OS0 A;  3QZ5 B;  3JCM V;  3QJY A;  3CCJ T;  5GAN 2;  2DTO A;  3A5Z B;  4F7U A;  3OYA A;  2XID A;  4QW2 A;  1W2B A;  3CBP A;  2VYT A;  3CCL T;  3ASK A;  4ME7 A;  4F7U E;  4ZTJ A;  1GXI E;  4C5E A;  3HFN A;  3I56 T;  2ZPG B;  5LJ5 j;  1YJN T;  5GAM j;  3VU3 C;  3M5A A;  3EFR A;  5A0D A;  3SWN B;  4RCB A;  5I2S A;  2ZZD A;  3CCL A;  1LNX A;  3CPW S;  2RK2 A;  4QQG A;  1K8A U;  3OYC A;  1DJ7 B;  3MEW A;  2QQ9 A;  3CCU A;  4R55 A;  2WSC E;  2EWN A;  3CCJ A;  4IUU A;  5CAI A;  3QG1 A;  3QXE B;  2ZPI B;  2OAU A;  2QA4 A;  1ZQ1 A;  3OMC A;  4L59 A;  1VQ5 T;  5CKB A;  3JCM Q;  4C8Q C;  1VQ9 T;  3X20 B;  4EMK A;  1BIA A;  1KQ1 A;  3OA6 A;  2QA4 T;  5GAN g;  1M8V A;  2RA2 A;  3DKM A;  2GCX A;  2EJ9 A;  2XI9 A;  2OTJ T;  3BW1 A;  1S72 T;  2QQS A;  1G3W A;  3TU4 K;  5DLO A;  2JOY A;  2YLB A;  4A4H A;  3RES A;  4M77 B;  5GAN e;  4N4H A;  5A0G A;  3E9G A;  4C8Q E;  2EJF A;  3RUX A;  1YCY A;  3C4S A;  2E6Z A;  4PLI A;  3V7R A;  3G71 A;  2IVW A;  4FSX A;  4Q5W A;  5LJ3 f;  3OYM A;  2B8A A;  3GOX A;  3JCM X;  2V8J A;  4J8O A;  2EAY A;  4C8Q D;  2K5F A;  2R57 A;  3UWN A;  4ZGE B;  1VQL A;  3AHU A;  5GAM e;  3S3M A;  2JTF A;  3VUB A;  3CCV T;  1VQ4 A;  2DZC A;  5DLQ E;  5LJ5 d;  3CC4 A;  2RHU A;  4B9W A;  3SB2 A;  1HK9 A;  5GAN h;  1SSF A;  1WJS A;  3J80 E;  1VQ6 T;  2DXU A;  2DKG A;  2LNV A;  4P5N A;  3M54 A;  3X25 B;  1U1S A;  4A53 A;  3G7Z A;  3C94 A;  1U1T A;  4BY6 C;  4M78 D;  1IRE B;  4C0F A;  3JCM P;  4M7A C;  2LCC A;  3HRS A;  2LTO A;  2K3X A;  3UDC A;  3GLX A;  4WF2 A;  5C6S A;  5GMK e;  2NLU A;  5KCO A;  1K8A C;  3HL8 A;  3HHT B;  2Y4X A;  1JJ2 A;  2EQJ A;  3E1S A;  5J39 A;  3OYK A;  2LT1 A;  3BDL A;  2P4T A;  1AHJ B;  4UC4 A;  4E7K A;  1VQ8 T;  3RKW A;  2KQW A;  5FRN A;  1KD1 U;  3RMQ A;  2CZ0 B;  4M75 C;  1VQP T;  4DOW A;  5KE2 A;  2QDY B;  1KQ2 A;  3A8L B;  4LDY A;  3CME A;  3CMA A;  2A7Y A;  4NS5 A;  3CBO A;  5GAO l;  2LVM A;  3ER0 A;  3PNW C;  3CCS A;  4BB7 A;  1N9R A;  2EKO A;  2KAF A;  3OQ5 A;  4M75 G;  1UB4 A;  2FB7 A;  3M4G A;  2M1H A;  3WVE B;  2LQ8 A;  4ZN1 A;  2VGM A;  4OMF B;  5CKF A;  5GMK h;  4M75 D;  4OP0 A;  5GMK l;  3JB9 F;  1XNI A;  3P8B B;  4MZT A;  1LJO A;  5GAM d;  4BUG A;  1S72 A;  5FRM A;  2R58 A;  1I8F A;  2LQK A;  4E7I A;  4PJO G;  4C8Q A;  4QVC A;  1K73 C;  4M77 A;  1TH7 A;  5CCA A;  2RH2 A;  2MF2 A;  2RJF A;  1PSF A;  3OYN A;  3CC2 T;  3OYH A;  4Z02 A;  2DIG A;  3L2Q A;  5LJ5 f;  3JB9 J;  2JNG A;  1M1G A;  5AYF A;  3RMS A;  2XIC A;  4XU1 A;  3CCR T;  4BE2 A;  3LGF A;  3CCU T;  1YJ9 A;  4L5G A;  1O9S A;  2RO0 A;  1YBY A;  2XHC A;  1Q81 C;  2QQB A;  2ZPE B;  4M7D C;  2HAX A;  2QEX A;  2YHT A;  2E70 A;  1YJN A;  2XKO C;  2DXC A;  4PJO B;  2KDS A;  2RI5 A;  4XTW A;  2RM4 A;  3PT9 A;  1M4Z A;  2E10 A;  1I4K 1;  2RHI A;  4M7D G;  2E1H A;  3QPH A;  4PL6 A;  1YI2 A;  1I5L A;  3URG A;  4LDV A;  2EIF A;  3P8D A;  5CKE A;  4ZTF A;  1VQM T;  5KCH A;  3FB9 A;  1G3S A;  3QJ6 A;  3QYH B;  2FL7 A;  5GMK i;  4RKU E;  1JJ2 S;  2M9U A;  1XTD A;  3HRU A;  2D9T A;  3BDU A;  4M7D E;  3BFM A;  4CRI A;  4XQ3 A;  3VV0 A;  5FU6 C;  2A3L A;  4PJO D;  1UGP B;  2OTJ A;  2H3J A;  1O75 A;  3PIO A;  3CEY A;  3FRN A;  2QTX A;  1YJW A;  3O8V A;  3PMT A;  3OB9 A;  3L42 A;  4C92 E;  1W2B S;  4N4I A;  2QI2 A;  3C95 A;  5GAN 4;  3OYI A;  1KHC A;  5J26 A;  4C92 B;  2XG8 D;  3CC4 T;  1VQ5 A;  4RG2 A;  3CBM A;  2L8D A;  4C92 D;  2CS7 A;  4XU2 A;  4BE1 A;  4HT8 A;  3JB9 I;  4KUL A;  5FLX E;  4EPC A;  1K73 U;  3EFS A;  3N5B B;  4JLG A;  1Q7Y U;  1Y96 B;  4OB0 B;  3R6O A;  4BI4 A;  3H6Z A;  3V8L A;  2RJC A;  2E12 A;  3X24 B;  2VV5 A;  1KG1 A;  3CCM T;  4M78 F;  4HCB A;  2F5T X;  4EMK B;  2JVV A;  2DJZ A;  2HD0 A;  2V8K A;  2ZPB B;  4C92 F;  1NZ9 A;  3L2U A;  5DY9 A;  1G3Y A;  2WSF E;  1UGR B;  2RK1 A;  4MZP A;  3PFS A;  1B34 A;  1QW1 A;  1Q86 U;  4OB2 B;  2XDB A;  5LJ3 h;  3JSC A;  4MDW A;  2BIV A;  2JN0 A;  3L2R A;  1HXD A;  5LJ5 e;  1Y71 A;  4C0D C;  3PIP A;  3J81 E;  5FRO A;  1VQ9 A;  1M9S A;  4N0A A;  3NFC A;  1VQK T;  3I55 A;  2BUD A;  2DEQ A;  3VYG A;  4E7H A;  5GAN 6;  1UGQ B;  3M58 A;  1OZ3 A;  3OBW A;  2KK4 A;  2Y4Y A;  3JCM b;  3MP6 A;  2CYZ B;  4PJO C;  2E64 A;  3QSU A;  5LJ3 e;  2DAQ A;  3GP8 A;  3H8Z A;  3CCE A;  2GF7 A;  3KXT A;  4C92 G;  1G3T A;  4LDX A;  3LW5 E;  5CKD A;  4FU6 A;  4D6W A;  4OGE A;  4XTV A;  3S6W A;  4OGC A;  3JRZ A;  4X9C A;  3CXC A;  1VQL T;  4XTX A;  2CZ1 B;  3A8G B;  2K3Y A;  3JB9 D;  1WQW A;  4C8Q G;  3JCM e;  1M90 U;  2R5M A;  4KUI A;  4J6Y A;  2PQW A;  4C0Z A;  4C92 C;  5LJ3 g;  5GMK m;  1YIJ A;  3MP8 A;  3OW2 S;  3VUZ A;  1KC8 U;  3HP9 A;  1BIB A;  3MEV A;  1P92 A;  4M77 C;  4ATO A;  4IUR A;  3CPW A;  5LL6 S;  3UPU A;  4E47 A;  2DD4 A;  4OVA A;  1M1F A;  4EDU A;  1Q7Y C;  3ZBD A;  4HKE A;  4QQ6 A;  1VQO T;  3CCQ A;  1VUB A;  2E65 A;  3NTK A;  4IUV A;  2VC8 A;  3MO8 A;  2PVO B;  3DB3 A;  3OYB A;  1NPP A;  2EYQ A;  3MEU A;  4HCZ A;  4PLL A;  3L2V A;  1YHQ A;  2V8I A;  5IT9 E;  1VQ7 T;  1D3B A;  4M75 B;  3L1A A;  4XU3 A;  4A4F A;  2M0O A;  2K5L A;  1X01 A;  4O5V A;  4XK8 E;  5I2M A;  4IUQ A;  3WVD B;  3KUF A;  4PKC C;  4FT4 A;  3CMA T;  1Q82 U;  3G6E T;  4E7J A;  3HPW A;  2LRQ A;  4PJO F;  2DIQ A;  5CO7 A;  1VIF A;  2K5I A;  1JB0 E;  4II1 A;  4RMO A;  4KBM B;  3V8J A;  4C8Q B;  5CK9 A;  4JUV A;  5GAO p;  5A2Q E;  3S3N A;  4E7L A;  4Y28 E;  2RJE A;  5HKC A;  3GPL A;  2OTL A;  5D6Y A;  2L5Q A;  2EFI A;  3MHX A;  5GAN 3;  1QVF S;  2O4X A;  2EQM A;  4IUP A;  2WSE E;  4M77 G;  4M75 F;  2RB6 A;  3SD4 A;  3NTH A;  3G71 T;  2DTI A;  1BYM A;  4EMK C;  4DA4 A;  4OB1 B;  2PUO B;  4XTZ A;  3P8H A;  1WQ7 A;  5D6X A;  4BDY A;  3OW2 A;  4JS5 A;  4GLK A;  2DXB A;  2E41 A;  4FL6 A;  1BKB A;  1VQN T;  4C0G A;  3HFO A;  3RKY A;  4JDS A;  3FEO A;  3EAE A;  3MEA A;  2KVQ G;  1G5V A;  1OI1 A;  4J7I A;  3KBG A;  4PJO E;  2X4J A;  4QQD A;  4M75 A;  4J83 A;  1D3B B;  3M56 A;  2P0Q A;  1WPY A;  4XAX B;  1VQK A;  3F70 A;  4M78 G;  4XU0 A;  3VKI A;  3A8H B;  1H3Z A;  3DB4 A;  2CKK A;  2MMP A;  2PVG B;  1Y7X A;  2EJG A;  3E19 A;  2MI6 A;  1QVP A;  1XQH A;  2JZ2 A;  1VIE A;  2RI2 A;  4MZM A;  3LLR A;  3JCM c;  5GAO m;  1K9M U;  1M1K U;  2CGH A;  1I81 A;  4XTU A;  3PTA A;  2ZGW A;  5LJ5 g;  4BD3 A;  2RI3 A;  3V7C A;  1OZ2 A;  5GAO r;  4QVD A;  2QEX T;  3LH0 A;  2D0Q B;  2MWP A;  4NL3 A;  1NJI C;  5FU7 C;  4F7U F;  3FLG A;  4M78 B;  2OTL T;  1X75 C;  2FHD A;  4MMK A;  2LT4 A;  4HA8 A;  5CIU A;  2L89 A;  2ZCF B;  4M77 D;  5HY6 A;  3LYI A;  4ZGJ B;  1Q82 C;  2JUF A;  2WAC A;  1R8O B;  3UT1 A;  4C5H A;  4C92 A;  1BI2 A;  1KQS S;  4JLI A;  1XOV A;  3CCR A;  2DO3 A;  4C0D B;  3G4S T;  4M7A F;  2RHZ A;  2FYK A;  4RCC A;  2AHJ B;  2F69 A;  3OS5 A;  4IUT A;  2MWO A;  4BI8 B;  2O01 E;  5GAN f;  4LD6 A;  3I55 T;  1YIT T;  4O6J A;  1QP2 A;  5CQY A;  1IZ6 A;  2KY9 A;  5GAO q;  4YTL A;  4BI3 A;  1U8R A;  4ELZ C;  2X35 A;  3CC2 A;  3OYL A;  5GAN j;  1YHQ T;  1EIF A;  3L2W A;  4M7D A;  4FM4 B;  4JRQ A;  5GAN 5;  2X4Y A;  1VQN A;  2LX9 A;  4X34 A;  4BE0 A;  4M7A B;  1UEB A;  3M9Q A;  3QII A;  3SWN C;  1LOJ A;  2G3R A;  3ZFJ A;  4BY6 B;  3OS1 A;  3OYG A;  2RHY A;  3BY7 A;  1M5Q 1;  1QP3 A;  5LJ5 h;  5KE3 A;  5IN1 A;  5CR2 A;  1K9M C;  1QVG S;  3V7S A;  3OY9 A;  3CC7 A;  4EMH A;  3A8M B;  4PJO A;  1JBM A;  2PVD B;  4QVZ A;  3M57 A;  5GAM f;  1N6A A;  2RJD A;  1YIT A;  1B34 B;  2XU8 A;  2I2L A;  3G4S A;  1V29 B;  2M16 A;  4M7D D;  1N8R U;  4F7U G;  1N27 A;  1VQ8 A;  2EQK A;  4GY5 A;  4JJN K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...