2GQVA

High-resolution structure of a plasmid-encoded dihydrofolate reductase: pentagonal network of water molecules in the d2-symmetric active site
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
SNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of a plasmid-encoded dihydrofolate reductase: pentagonal network of water molecules in the D(2)-symmetric active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Dihydrofolate reductase type 2
total genus 12
structure length 59
sequence length 59
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2006-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gqvA00
3UDCA 2OAUA 2RK1A 2GQVA 3SFMA 3T9NA 2P4TA 2RH2A 2VV5A 1VIFA 2RK2A 1VIEA
chains in the Genus database with same CATH superfamily
2YLBA 2EAYA 5GAOp 1VQ8T 5CKFA 4QQ6A 3KFVA 2JMAA 2E10A 2YUQA 1BIBA 4LN2A 3RIRA 2LDMA 2CUDA 2D8JA 1KD1U 1U8RA 4PJOE 2GFUA 2QDYB 1SKUB 2QAZA 3A1PA 3EH2A 3OMCA 4TVRA 5KYWA 8AT1B 1SF9A 3CCSA 4PFZA 3A8HB 2XKOC 2EQUA 1HJDA 1SPKA 1BBZA 3OYKA 4FSSA 2AZVA 1WXBA 2FRYA 3S3NA 1ZHIA 5GAOq 5I2MA 3M57A 4AG1C 1X6BA 5L8RE 5LJ5e 3EG9A 4M78D 2KEAA 2LX7A 7AT1B 2DF6A 2DILA 1QCOA 2NWMA 3OYHA 4A4FA 4J9EA 1IZ6A 1JRIA 4IKFA 1H3ZA 1ABQA 1VQ4A 1C6VX 3CC7A 1RI0A 4LD9K 2RN8A 2V1RA 4RTZA 3OYYA 2HBWA 2KXDA 4KUIA 4LDXA 1N8RC 3JB9H 2DD5A 3WVDB 3VRZA 3L42A 2M9UA 1VQ6T 2GNCA 3QHSA 5LJ3h 3NFCA 4MDXA 1QWEA 1W2BS 2YUPA 5FLXE 1VQ8A 3NTIA 4M77C 1VOMA 1XOVA 3DKMA 4C0DC 4BI8B 2XU8A 4ESRA 1U1SA 3UATA 3P8BB 1M90U 2K3XA 3RUXA 1VUBA 2K2VA 1NPRA 4C92A 1BB9A 4B9XA 2V8JA 1ZSZC 2PVOB 1TS9A 3M4GA 4QKUA 2HMAA 3UDCA 3R6OA 1M5Q1 4PJJA 1VQ5A 4M75B 2XIDA 1QW1A 3SFMA 4JS4A 2LT1A 3VUZA 3OYDA 3QUIA 2E41A 1RLPC 3CPWA 2AKKA 1Z9QA 2QEXA 3CBMA 1D3BA 4PLLA 3OYAA 2FHDA 2GQIA 2CH4A 2X3WD 1LNXA 2YWWA 1K8AU 1K9MC 2EFIA 3GNGA 3E9FA 3RBBB 2NLUA 4E7KA 4MZMA 4JLGA 1T0JA 1D1CA 1QLYA 4JS5A 3VKIA 1K73C 1OPLA 2HBPA 4PNOA 5D7UA 5I2SA 5GMKm 4C5EA 2MF2A 2QASA 5IT9E 1KHIA 4D8DA 4J9FA 3VV0A 1RUWA 5FW9A 3H41A 2OTJT 3QJ6A 1RACB 2LC4A 2PZ1A 2EQJA 4M7DB 5IXBA 2ZPFB 3TSWA 1FMKA 3PFSA 1MMGA 2NUTA 3M0RA 5FWBA 1VIFA 4HCKA 1T3SA 1U3OA 3CCVQ 3CCRA 2HDAA 2QA4Q 1BYMA 3M0QA 1WYXA 1VQOQ 1YITA 1JO8A 5LJ3d 1ACMB 2K4YA 1VQPT 1I81A 5A0GA 1IGQA 1TH7A 2OJ2A 4M7DG 2QYZA 4CC2A 1G3SA 1VA7A 3RERA 3JCMX 1TSFA 2RHUA 4LUEA 4PJLA 1PSEA 1VYUA 2COWA 1W1FA 1KC8C 2LMJA 5D6WA 2VUBA 2O88A 2K7AA 4A4GA 3LWHA 3D7SB 1MMNA 1ZUUA 1WHLA 1M8VA 1Y96B 4J9HA 5GAMj 2DD4A 4CC7A 3G1JA 5DY9A 2NUPA 4LE9A 4MZTA 4X9DA 4OMFB 4A4KA 1YITT 4KGVB 3THKA 4M78B 3QZ5B 2XD0A 4DA4A 2ESWA 4CC4B 2BZ8A 3HFNA 4M7DE 3BFMA 1YJNQ 1KQ2A 3CCRT 2D0NA 3G71A 3IQLA 2RJEA 2E3HA 3GLXA 4M7DC 1U1TA 1OZ2A 5LJ5f 5J3BA 1M3AA 1M27C 3CC7T 3GIBA 2RJDA 2MOXA 4LUDA 2RNAA 2OAUA 2JXBA 5IHIA 1YP5A 3OYLA 3OS1A 1R0BG 1BI1A 3A8OB 1YHQQ 3HSBA 1P92A 3DLLA 4XQ3A 1OPKA 1K0SA 4PJOC 2QDLA 4IUQA 3QPHA 2YLCA 1H641 4F7UE 4IUUA 4JJDA 1PHTA 1UHCA 4DBHA 4F17A 2X51A 2NUTB 8ATCB 1K73R 5IHNA 2R57A 4M7DA 1Q7YR 4A4EA 1OEBA 1UGPB 2EVRA 3P8DA 2ROLA 2MPXC 5KYWB 1VQ7T 2EQMA 4RTUA 3L2WA 2MAMA 3OW2P 1YJWT 2K5LA 1AWXA 2RO0A 1WQ7A 1UGQB 2M0OA 3JCMe 5CQYA 1TUDA 3G6EQ 2A08A 2BKDN 5CR2A 3LLRA 3QO3A 5CKEA 1JXOA 2V8IA 2QEXT 4GLMA 4R56A 3OW2S 3H0IA 1T3LA 1JJ2A 5CKHA 2C06A 4C92G 4PFOA 1PSFA 3CMEQ 1DJ7B 5AT1B 4XTWA 3N5BB 3CCVT 2E4HA 2X4JA 2RHIA 2DL3A 3H8ZA 4M7AC 4BY6B 2EGEA 4J9GA 4WF2A 3OYCA 4OB3B 4QW2A 2CP0A 3RDVA 1M1FA 1YJWQ 2J6KA 1S72Q 2K9GA 4LNPA 2FRWA 2ZPGB 1RAHB 3ZBDA 1U5SA 1F1BB 2LJ3A 2PUOB 2KYBA 1VQ4Q 1PKSA 5LL6S 2QEXQ 5FU6C 2MI6A 4Y28E 2JMCA 2P0KA 2L3QA 2OTJA 2HAXA 4JPBW 1ZLMA 2XMFA 1X6OA 3VS7A 3JCMJ 5HK3A 3GOXA 1QP3A 1G5VA 2E6ZA 1EFNA 3CCVA 2YUNA 2QQAA 3CCJQ 1QVPA 2WSCE 4XAXB 2XG8D 3UWNA 3JCMQ 1TUGB 4FSXA 3JB9J 3JSCA 4FT4A 4OF1A 1YIJT 1M90C 3X24B 3PMIA 1YITQ 1YCYA 3MP1A 3HRSA 4C92E 3HTRA 3EG2A 3EFSA 2DFUA 5GANf 2L3RA 3CC4Q 1VQPA 2VVKA 2DJQA 3LWIA 2CP6A 4IIMA 5KYYA 1B3QA 3EHRA 3AHUA 4D8KA 2K5IA 2YUOA 1X43A 3VS5A 2K2MA 2KVQG 4BE0A 4ELZC 5HY6A 1KD1R 4IUTA 1TOVA 3OQ5A 5LJ3j 3M54A 4ZNXA 2QI2A 4JJBA 1YIJA 4FYWB 4M77F 4BY6C 2CUBA 1ZBJA 1BCOA 2CP7A 4PJOG 4FYXB 2FPFA 2YXYA 3LW5E 2M16A 5IHKA 1YCSB 3CXCP 1M2OA 1S72A 3BDUA 3OSSC 2LJ1A 5IXFA 1V76A 1OU8A 5FU6B 3J81E 3HFOA 4OGCA 4JDSA 4OMNA 1BCMA 4C0ZA 3CCLQ 2DLPA 1QKXA 1QCFA 3GNFB 2L5QA 5HK0A 1UB4A 3J80E 4WTOB 1NG2A 2SRCA 4RCCA 2PVGB 5GMKh 2DTIA 2LJ0A 5GMKe 1BKBA 2EQKA 2HQHA 2RK2A 4EPCA 4ATOA 1TWBA 1OOTA 2C0OA 2GF7A 2KAFA 3KBGA 1IRXA 1S72T 4M7AF 2X9HA 3PE0A 5EG2A 1IGUA 2DZ9A 1MUZA 5KCOA 2XK0A 3FIFA 3OYGA 1M1KR 3VS4A 3FB9A 1BI2A 4M75F 4NL3A 3I5SA 2JTFA 1M3CA 3SEMA 1KQSS 2RI5A 2D6FA 1MMDA 4MMLA 3EGDB 2DO3A 4M7AB 4X34A 2YHTA 3OBWA 2COZA 4V2SA 4RTWA 1YWOA 3I56Q 4C8QF 3CC2Q 2KE9A 1QCNA 2EYQA 1KQSP 2AZSA 3RMSA 2CZ1B 4J6WA 1K0XA 5C6SA 2F2XA 2RH2A 4F7UB 2K3YA 4A4HA 1LCKA 1JXMA 2KT1A 3EG9B 3PIPA 5EC7A 5GAN7 4J9BA 4M7AG 4JLIA 2CDTA 2VYTA 2DTHA 5LJ3g 1I07A 3TVTA 3CCUA 3EFOA 2CS7A 3E1SA 1UFFA 3CCEA 1JJ2P 1VQ6A 4N4HA 1BI3A 2AIRB 5C0MA 4J9CA 1M2VB 1OX8A 4C92C 3I9QA 3MP8A 4E7JA 5KYXB 3EHQA 3L2ZA 1Q7YU 1RI9A 5CVIA 4KUDK 3TREA 2KXCA 2RK1A 1WDXA 3QDFA 4M7AD 4C8QC 1GRIA 5GANe 2YRVA 3EGXB 1O75A 3OA6A 2E12A 1RABB 1JBMA 3CCMQ 5GAMe 2L3PA 3LH5A 3MJXA 3QJYA 2GCXA 4DBFA 5GAMf 1QMCA 2LRQA 4J9IA 1PCXA 4OMPA 2EBPA 3JCMd 2FPDA 1UG1A 3RKXA 3I55A 2QTXA 2GGRA 5GMKi 3C94A 4PJOF 1VQMT 3CCUQ 5GAN2 1M1KU 5GAOl 3MHXA 2FEIA 1S1NA 3QYHB 3PT9A 4ZTJA 2FZCB 1ZUKA 3GBQA 5KYXA 2DYIA 3WXMB 3C12A 4DOWA 2RJFA 2V26A 3A8MB 4J6YA 3X25B 3X26B 1N9RA 2XDPA 1FWZA 2KRSA 1M90R 4K11A 3EG0A 1HXDA 4NOYA 2H3JA 2LQ8A 2O9SA 4ANJA 2J6FA 4AFQC 2QXFA 3CCET 1XTDA 4KT0E 3OS5A 2R5AA 5KYUB 4Z88A 1TTHB 2QQSA 2DEUA 1K8AR 1D0YA 3S3MA 1BU1A 4OMMA 2RA2A 3X28B 4HCZA 2DL4A 1HK9A 4J5YA 3MEWA 2O2OA 1IHWA 2BE9B 1Q81C 1OULA 4C92B 4M78E 2KRMA 1E6HA 2DAQA 2GBQA 2YT6A 2RQUA 3JCMW 1K73U 4M77G 1GBQA 2RQRA 2EYWA 4RTYA 2ZPHB 4M75G 4BI3A 4LDVA 1N27A 1QQJA 1VQKQ 4ZTFA 1WHGA 3LX7A 3QWXX 4E7SA 3CCLA 3CD6A 2JS2A 2K5FA 4J7IA 1I4K1 1VQOT 1VQKA 2DX1A 1EZZB 1SSFA 4ZN3A 2DIGA 3QXEB 4GLKA 1M1GA 1OI1A 4RG2A 2IVWA 5KYYB 2BTTA 1RAAB 2BZXA 2RQTA 2VWFA 3OS2A 2JVVA 2JTMA 5FRNA 2X4XA 3A8LB 3VS1A 1PG5B 2X4WA 2DETA 1I5OB 2FZKB 3EGXA 4D6WA 2A3LA 2M1HA 1KQ1A 2PQWA 3O5ZA 4M77D 2DMOA 3BDLA 2C0TA 2P4TA 1R0CB 3FEOA 2JM9A 1PKTA 3PMTA 3U23A 3JAME 4N0AA 1YBYA 1FMVA 2DXCA 3KUFA 3MP6A 3CCSQ 1QVFS 1VQLT 1Q82U 4HCBA 4AT1B 4LDYA 2KK4A 4C5HA 5GAN8 3G71T 4II1A 4X9CA 1WIEA 5I21A 2KNBB 3QKJA 3Q1JA 1UHFA 4F7UG 3CEYA 1Q7YC 2V8KA 5GAMg 1ZSZA 2KSSA 2KGTA 2CT3A 3CC2T 3VYGA 1YN8A 2FB7A 2ZGWA 1WQWA 2HCKA 1Y0MA 3M56A 4ZN1A 1VQ4T 2DXBA 1NEGA 1NBEB 2DL5A 2QQ9A 4XU0A 1W4SA 1WLPB 3V8KA 3JCMc 4L6V5 1YJWA 2RQVA 3S3OA 4M77A 1SRMA 2Y90A 4J9DA 4RKUE 3M59A 1PRLC 1MV0B 3V7SA 1M3BA 4BDYA 2X4YA 2BUDA 1ZSZB 1M8MA 3REBB 1NPPA 5CKDA 2D1XA 4XU2A 4M7DD 2ED0A 4OB0B 1VQ6Q 4EMGA 1IO6A 3CCMT 4JRKA 4J7FA 2OAWA 2KT8A 2W0ZA 1RLQC 2VC8A 4JZ3A 2HL5C 4FL6A 3CCRQ 2F5KA 1G2BA 3HL8A 2DRKA 4ME7A 3C95A 5LJ5h 3CCJT 3VJPA 2J05A 1FXXA 2HNIA 3PVLA 2DTOA 1FX7A 1HSQA 4N4GA 1WGSA 4E47A 3G71Q 1C1AA 2KDSA 3PGGA 4KBMB 3JB9D 2QQBA 1TU0B 3M0PA 3SB2A 1QVGP 3RKWA 1VQ5T 5FWCA 3ME9A 4C0DB 1FYNA 4EMKB 4QQDA 5GAN4 4OVAA 2RJCA 5LJ5g 3PNWC 2QG9B 2EQIA 3MEVA 4CC3A 2GTJA 2RI3A 4BACA 3BE3A 2EJFA 3CCJA 4N4IA 2F1LA 4KGXB 2DVJA 1W2BP 4HA8A 1I5LA 4AFZC 2HKNA 2ZPEB 1ZA2B 1KK7A 2FVUA 4NL2A 2FZGB 3BY7A 3CQTA 1AHJB 4PJNA 2V1QA 2Y4YA 4M75C 2XDBA 4M78G 2O4XB 4FU6A 4LDUA 1B34A 3GP8A 1K8AC 2DZCA 3M5AA 2IG0A 2MCNA 1VQKT 1N5ZA 1SRLA 4M7DF 2JN0A 4QVZA 3L2VA 3GF5A 4RTXA 2K79A 2CH4W 2JTEA 3JV3A 1T0HA 5GAOn 2QGFB 2RI2A 4YTLA 4C92D 2RQWA 1KHCA 4PLIA 1N9SA 2YDLA 2MYSA 2F69A 5FROA 2EYZA 3OSVA 1H8KA 4NS5A 3UF4A 2QGGA 4M78A 3INZA 5IAYA 2EYYA 3DB4A 3PVQA 2QK0A 4M78C 3OS0A 2DJZA 3CCQA 3MKDA 3CC4T 1X6GA 1D1AA 1D09B 4VUBA 1K9AA 3HRUA 1NZ9A 1AD5A 1EX4A 2EGCA 1VQLA 5AYFA 4KH0B 1RAFB 2LCCA 2J7IA 1B07A 3UPUA 4JJNK 2DBKA 4FM4B 5D6XA 1KJWA 3VYHB 1MNEA 1OU9A 2DNUA 2F2VA 4AMCA 1LOJA 4RTTA 4KRTA 1CSKA 4C0FA 2QTVA 3PTAA 4IUVA 1NE8A 4XTZA 4HVUA 3META 2SEMA 4L5GA 4C8QG 4IUPA 4PFPA 3JCMh 3OYBA 1VQ9A 5CQXA 3JCMV 1I8FA 1PM3A 5FRMA 5CCAA 5LJ5j 5IH2A 1VIEA 3P8HA 1D0ZA 2F5TX 2WSEE 1M9SA 5KE3A 4BDZA 2LZ6B 4XTVA 3H6ZA 3R6NA 1QVGS 2DERA 1SHGA 2Y4XA 1AT1B 3FJ5A 2KR3A 3ULRB 2D9TA 4QVDA 2RM4A 2F2WA 1NLOC 1VQNT 1E6GA 3JCMg 1YJ9Q 2QA4T 1Q86C 2VXFA 3MEAA 1OX9A 1UDLA 3A8GB 1LVKA 1MV3A 1A0NB 5KH6A 2CYZB 3FJPA 4EIKA 1BI0A 3OYMA 4Y92A 2E70A 4M77E 2E64A 1MNDA 3MCAB 2O9VA 3CC7Q 2DK3A 3NHNA 4KGZB 3G4SQ 1R77A 3VS0A 4Y91A 1VQNA 1AOJA 4F16A 1ZX6A 3I56A 3UT1A 2XI9A 4ORZA 4C8QD 5J39A 4XTUA 1RAIB 3SWNC 2A36A 1QVFA 1SSHA 2P0QA 2YSQA 4RCBA 4JJCA 2KBTA 2E1HA 3JB9F 3EAEA 3JCMf 3NTHA 3H0FA 2DL7A 2HL3A 2OTLT 4EMHA 5A0LA 1IB8A 1YHQA 5I22A 4RTVA 1UUEA 5KYNA 1G8XA 2KI7A 1K76A 2R58A 4E7HA 2CSQA 3CCEQ 2E5QA 2LP5A 1UGSB 1WX6A 5KCHA 1QP2A 1GXIE 1VYTA 2EPDA 1YI2T 2L0AA 3RNJA 2DE0X 2MWOA 4XU1A 4M75D 3CD6Q 2P84A 4GY5A 4FCYA 3EG3A 2ROTA 3MPUB 1VQ7Q 2E3IA 4HT8A 1WI7A 2A28A 1NEBA 2OTLA 3CCUT 3FRNA 1JEGA 2ECZA 3DB3A 1Y57A 3QBYA 1TG0A 4FW1A 3CCLT 4ZGJB 3ZFJA 1MGQA 4M7AE 3RMQA 3TU4K 5GAMh 3C0CA 3SWNB 2K6DA 1UJYA 1IXDA 4A53A 1JB0E 2E65A 3SHWA 4LD6A 2DKGA 4M75E 2DVEA 5GMKj 3NTKA 3L2UA 2HQEA 4BE2A 1RL2A 1H3HA 1VQMA 3CD6T 4XTXA 4PK4A 1Q95G 2EKOA 3A98A 1B34B 4M7AA 2CP3A 3M58A 4KULA 1FMWA 1G3WA 3EGUA 2CZ0B 2E6NA 2CREA 2DRMA 4E7IA 2XICA 4AG2C 3TEEA 4FYVB 4R0KA 3M0SA 4XU3A 3CCQQ 1AZEA 2MK5A 4PJMA 1KG1A 3H9NA 1OQKA 2M02A 3CMEA 1JJ2S 4ZGEB 4J6XA 1M4ZA 2KMTA 1Y07A 3CMAQ 5CKBA 1IHVA 1WPYA 2NUPB 3HHTB 4JRIA 3F70A 1V1CA 3G7ZA 3M0UA 3QG1A 1AWJA 3CC2A 3MEUA 2OTLQ 1UTIA 5GAN3 1YJ9A 4OP0A 3V8LA 2QA4A 5GJVB 3M53A 3QDRB 4OMLA 2ABLA 2B86A 4X1VA 2GFAA 1YWPA 2VV5A 2M51A 3I5RA 1KFZA 3OYJA 1V29B 2DPPB 1X69A 2AK5A 4HVVA 1C0MA 2J06A 1K9MR 1VQNQ 5J26A 2K57A 1ZSGA 3C4SA 4FT2A 3CBOA 1PWTA 3OYFA 5GANd 4C5GA 1UECA 3CCST 3OYNA 4IURA 2OI3A 1OZ3A 2D8HA 1VQMQ 2HKQB 1SHFA 2JNGA 2RHXA 2CKKA 4L59A 3FC3A 2DIQA 1N8RR 4ZGDB 1GCQC 2PU9B 1PD0A 1WXTA 1X2KA 2A0FB 1G3TA 5KE2A 1N8RU 1BK2A 4A54A 3CPFA 1G3YA 1W70A 4LXCA 1ZUYA 4HKEA 1Y96A 3HKSA 4Q5WA 1KC8R 2RF0A 2AKLA 3JRZA 1YFNA 1NJIR 4XK8E 1X2QA 1WJQA 4Z02A 2YRDA 2VB6A 2CSIA 2AT1B 5GAOr 2HD0A 5LJ3f 2IIMA 3RESA 3I55Q 1R8OB 4CI0C 1PD1A 3REAB 3A5ZB 2LCSA 3NGPA 2DL8A 4UC4A 2VGMA 4PJOB 3UA6A 3HP9A 3OBYA 4BE1A 1WHHA 1X01A 2EGAA 3BW1A 1B7TA 1NM7A 1U06A 3I55T 1K9MU 5HCKA 3LGLA 3L1AA 1GCPA 2EW3A 2RB6A 3QYGB 2COYA 1LJOA 2DBMA 2FG0A 4R55A 1WNLA 5GAN6 4C8QE 3NMZC 2ATCB 1J3TA 3FLGA 2HEQA 1Q81U 4Z8AA 2DEQA 1YNZA 3ASKA 3KXTA 2GTOA 3M0TA 1X27A 2EIFA 1AVZC 2LNHB 1GFCA 2L3SA 3FDRA 2ZCFB 2L89A 4MZPA 3OMGA 2JT4A 2AHJB 2HQXA 1ZBXA 1AWOA 1NJIU 2LQKA 2HZYA 2X35A 1XNIA 1WHJA 5GJWB 2CP5A 2WACA 3I35A 4XTYA 3CCMA 2ED1A 2JUFA 4OB2B 2CZ6B 4JUVA 2PVDB 4JRPA 3TQ7P 2IPOB 2A37A 3SD4A 4E2FB 1WJRA 4ELYC 2C0IA 2X3XD 4AFUC 3E19A 4RG8A 3CMET 1JQQA 3LH0A 3WVEB 3PIOA 1WJSA 4C0GA 1ABOA 2PTKA 5ECAA 2GQVA 4E6RA 2KYMA 2WSFE 4M75A 5LJ5d 2LNVA 2J6OA 2ZPIB 4HXJA 2PNIA 4A63B 4JRQA 5KYUA 1NLPC 2K3BA 3URGA 5GANj 1RAEB 2BE7D 1WHKA 4BB7A 5IN1A 5GMKl 4N0AC 2KROA 3JB9I 4OGEA 2CGHA 1VQPQ 3CC4A 3J7AF 3CBPA 4M4ZA 2DM1A 2XHCA 5A0DA 1VQ8Q 6AT1B 3SWNA 2ZZDA 4PJOA 2LX9A 3HRTA 4E7ZA 3X20B 3EGDA 5CIUA 5M9OA 2ENMA 2YRCA 1ZQ1A 2G3RA 4CRIA 3OB9A 1WXUA 1M1KC 2R5MA 5FU7B 3ZL7C 4F14A 3DLMA 2MWPA 2OX7A 1N6AA 3OW2A 1OV3A 1D0XA 2D0QB 1QVGA 1UGRB 3G4SA 3JCMb 2JZ2A 4O5VA 1OYXA 2EJGA 1D1BA 3V7RA 4OB1B 3S6WA 4DBQA 4OMOA 4PJOD 1GL5A 1JU5C 4DQ2A 2ZAEA 1W2BA 3QIIA 1TXQA 1VYVA 2W10A 2LVMA 3QSUA 3MO8A 1UGVA 1K4US 4C92F 3G6ET 4BUGA 4JZ4A 1K1ZA 2RPNA 3EFOB 3ER0A 1MMAA 4F04B 1KSWA 9ATCB 4GBQA 1I1JA 5HKCA 2O31A 1RADB 1BIAA 1VQ9Q 3M55A 2EWNA 3OYIA 1CKAA 1NJIC 3RR6A 4B6MA 2Z0WA 3LGFA 1AZGB 1AEYA 1SEMA 5GAMd 1HYOA 1QKWA 5DLQE 4HCCA 1XJWB 5GANh 2L8DA 1WFWA 3LYIA 1CKBA 4LDWA 2RHZA 3EFRA 2CZ7B 3CMAT 4C8QB 3NPFA 2B8AA 2RD1A 3ZEHA 1Y7XA 3G6EA 4KH1B 1VQLQ 4J83A 5L23A 4DEXA 1PNJA 2JOYA 3G4ST 1YHQT 4BI4A 2QQRA 1QWFA 5GAOm 5GANg 4QQGA 4EDUA 3O8VA 1Z9ZA 3CXCS 1GCQA 4EMKC 1VQ9T 2I2LA 2DA9A 3T9NA 1PC0A 1O9SA 3QZ9B 4RMOA 1ZA1B 3VRYA 1WA7A 2JW4A 1XQHA 2JM8A 4M78F 1GBRA 3V8JA 2EJ9A 3VS3A 3CXCA 1LPLA 2FO0A 2DXUA 3CMAA 5DLOA 4QT7A 3RKYA 3TSZA 1SG5A 2KQWA 1M30A 1VQ5Q 1D3BB 3UA7A 2RHYA 1WZOA 4BD3A 4C8QA 5DM7R 2HSPA 1UJ0A 4PL6A 3EG1A 4AFSC 1VQ7A 3OY9A 2CT4A 3AT1B 2A7YA 4RUGA 3L2QA 5CAIA 4P5NA 1TUCA 3M4YA 1Q82R 1G83A 3L2RA 5CO7A 2VGNA 4O6JA 2FYKA 4MMKA 2XDDA 2L2PA 1MHNA 4OMQA 2O01E 4MDWA 4EMKA 4B9WA 1YJNA 2EYXA 3CPWS 2FL7A 3M9QA 1UEBA 1ARKA 1RAGB 1IREB 1KD1C 4E7LA 2M0YA 2LCLA 2LQWA 1WHMA 1EIFA 3VS6A 3I56T 2H3EB 4PKCC 1YI2Q 5FU7C 4Z89A 3CPWP 1NYGA 2MMPA 4FYYB 2G6FX 2LT4A 3OYEA 2VXEA 5CK9A 1KIKA 2I0NA 2OTJQ 1YIJQ 1KC8U 4IIOA 3TCJA 3H0HA 1HD3A 4WCIA 3VS2A 1Q82C 5LJ3e 2JS0A 1X75C 2MIOA 3E2UA 2H8HA 2PUKB 1Q86U 1M2VA 3GPLA 2VASA 2VKNA 5D6YA 1Q86R 1AWWA 3E9GA 1PRMC 3HPWA 4DOVA 5GAN5 2RMOA 1QVFP 2P0PA 1VQOA 2BIVA 1YI2A 1NYFA 1Y71A 3EH1A 1YJ9T 1KQSA 3CCQT 2P4RA 2FPEA 5I11A 4HT9A 2CP2A 4FIBA 3QWYA 2LTOA 4HVWA 1YJNT 2KRNA 2HSEB 4J8OA 2DXTA 2EKHA 4DEYA 4F7UA 2O4XA 3VUBA 2LQNA 1Q81R 1UE9A 2E5KA 4F7UF 1I0CA 2JJ9A 1GFDA 2NYSA 2ZPBB 3SDZA 5A2QE 3JB9G 4FW2A 4DBRA 4M77B 1E7OA 2BZYA 2KY9A 2NUZA 3V7CA 4QVCA 2DYBA 3JCMP 4C5IA 3VU3C 1W6XA 1H92A
chains in the Genus database with same CATH topology
4HKEA 2YLBA 2RJCA 5LJ5g 2KVQG 1Y96A 3HKSA 3PNWC 3MEVA 2EAYA 4Q5WA 4BE0A 2RI3A 4ELZC 5GAOp 4BACA 2EJFA 3JRZA 1VQ8T 3CCJA 5HY6A 4N4IA 5CKFA 4QQ6A 4XK8E 4IUTA 2E10A 1WJQA 1BIBA 3OQ5A 4Z02A 3RIRA 3M54A 4HA8A 5LJ3j 1I5LA 2LDMA 2ZPEB 5GAOr 2HD0A 2QI2A 1YIJA 2FVUA 1KD1U 4M77F 4BY6C 1U8RA 2GFUA 2QDYB 5LJ3f 4PJOE 4NL2A 3RESA 1R8OB 3BY7A 3OMCA 4TVRA 4PJOG 1AHJB 4CI0C 2Y4YA 3LW5E 2M16A 3A5ZB 4M75C 3CCSA 2XDBA 4M78G 2O4XB 4FU6A 4LDUA 1S72A 3A8HB 3BDUA 3OSSC 2XKOC 2EQUA 1B34A 3OYKA 3GP8A 1K8AC 4UC4A 2DZCA 2VGMA 3M5AA 5FU6B 2IG0A 3J81E 3S3NA 1ZHIA 3HP9A 5I2MA 3HFOA 3OBYA 4OGCA 5GAOq 4BE1A 1VQKT 3M57A 4JDSA 4M7DF 1X01A 2JN0A 4QVZA 3L2VA 3BW1A 4C0ZA 3I55T 5L8RE 1K9MU 3GNFB 3GF5A 2L5QA 5LJ5e 3LGLA 4M78D 3L1AA 5HK0A 2RB6A 1UB4A 3J80E 5GAOn 4RCCA 3QYGB 2RI2A 2PVGB 1LJOA 4R55A 4YTLA 5GMKh 1WNLA 3OYHA 5GAN6 2DTIA 4PJOB 4C92D 4A4FA 4C8QE 5GMKe 1IZ6A 1JRIA 1KHCA 4IKFA 1H3ZA 4PLIA 1BKBA 3FLGA 1N9SA 1VQ4A 3CC7A 2F69A 1RI0A 5FROA 2EQKA 1Q81U 4LD9K 2DEQA 2RK2A 3OSVA 3ASKA 4EPCA 4ATOA 3KXTA 4NS5A 2GF7A 2EIFA 2KAFA 3KBGA 3INZA 3FDRA 3OYYA 4M78A 2ZCFB 5IAYA 1S72T 4KUIA 4LDXA 2L89A 4M7AF 1N8RC 3DB4A 4MZPA 5EG2A 3JB9H 2DD5A 3WVDB 4M78C 3OMGA 3L42A 2M9UA 2DJZA 3OS0A 1VQ6T 3QHSA 2AHJB 2DZ9A 3NFCA 2HQXA 5LJ3h 1ZBXA 3CCQA 3CC4T 1W2BS 5FLXE 5KCOA 1NJIU 1VQ8A 2XK0A 2LQKA 3NTIA 3FIFA 3OYGA 4M77C 4VUBA 3HRUA 1XOVA 2X35A 1XNIA 3DKMA 2WACA 4C0DC 3FB9A 1NZ9A 4XTYA 1BI2A 2JUFA 4M75F 3CCMA 4NL3A 4OB2B 1VQLA 5AYFA 4BI8B 2CZ6B 2XU8A 2JTFA 4JUVA 1KQSS 2LCCA 1U1SA 2RI5A 2D6FA 2PVDB 4MMLA 3P8BB 4JJNK 3UPUA 4FM4B 2K3XA 2DO3A 4M7AB 4JRPA 4X34A 5D6XA 2YHTA 3OBWA 3RUXA 4V2SA 1VUBA 3SD4A 2K2VA 3VYHB 4C8QF 1NPRA 4C92A 4B9XA 1LOJA 2EYQA 2V8JA 1WJRA 2PVOB 4ELYC 3M4GA 3UDCA 3R6OA 3RMSA 2CZ1B 3E19A 1M5Q1 4J6WA 4RG8A 4C0FA 3CMET 3PTAA 5C6SA 3LH0A 2RH2A 3WVEB 1WJSA 3PIOA 4F7UB 4IUVA 1NE8A 4XTZA 4C0GA 2K3YA 3META 4A4HA 1VQ5A 4L5GA 4M75B 4IUPA 3JCMh 4C8QG 2GQVA 3OYBA 2XIDA 1QW1A 3PIPA 2WSFE 4M75A 5CQXA 3SFMA 3JCMV 5LJ5d 4JS4A 2LT1A 1I8FA 2LNVA 3VUZA 5GAN7 3OYDA 2ZPIB 2E41A 3QUIA 4M7AG 3CPWA 5FRMA 5CCAA 4JLIA 3CCUA 2VYTA 2DTHA 5LJ3g 5LJ5j 2QEXA 4JRQA 3CBMA 1D3BA 2CS7A 3URGA 1VIEA 3E1SA 4PLLA 3P8HA 3OYAA 5GANj 4BB7A 5IN1A 2F5TX 2FHDA 4N0AC 5GMKl 3CCEA 2WSEE 1VQ6A 4N4HA 1BI3A 3JB9I 4OGEA 1M9SA 2CGHA 5C0MA 5KE3A 4BDZA 3CC4A 1LNXA 3J7AF 4C92C 3CBPA 2XHCA 5A0DA 1K8AU 1K9MC 3MP8A 4XTVA 3H6ZA 4E7JA 1Q7YU 3L2ZA 2EFIA 1QVGS 5CVIA 4KUDK 3SWNA 2ZZDA 2Y4XA 3GNGA 3TREA 3E9FA 4PJOA 2RK1A 2LX9A 2NLUA 4E7KA 4MZMA 4M7AD 2D9TA 4C8QC 2RM4A 3HRTA 4QVDA 4JLGA 5GANe 2YRVA 1O75A 1VQNT 3X20B 3OA6A 3JCMg 2E12A 5CIUA 5M9OA 4JS5A 2QA4T 3VKIA 1K73C 1JBMA 1ZQ1A 5GAMe 1Q86C 2G3RA 2VXFA 4CRIA 3MEAA 2HBPA 4PNOA 5I2SA 3QJYA 3OB9A 5GMKm 2GCXA 4C5EA 3A8GB 2R5MA 1M1KC 5GAMf 5FU7B 2MF2A 2LRQA 5IT9E 5KH6A 3DLMA 1KHIA 2CYZB 3FJPA 3RKXA 3JCMd 1BI0A 3OYMA 2MWPA 2QTXA 3I55A 5GMKi 2E70A 3VV0A 1N6AA 3C94A 3OW2A 4M77E 4PJOF 1VQMT 2OTJT 3QJ6A 2D0QB 5GAN2 2LC4A 5GAOl 3MHXA 2EQJA 1QVGA 1UGRB 1M1KU 3QYHB 4M7DB 3G4SA 3PT9A 2ZPFB 3JCMb 4ZTJA 2JZ2A 2E64A 4O5VA 1OYXA 2EJGA 3MCAB 3PFSA 3WXMB 3V7RA 3C12A 4OB1B 2RJFA 4J6YA 3A8MB 1VIFA 3S6WA 2DK3A 3X25B 1N9RA 3X26B 4OVAA 4PJOD 1VQ9A 2XDPA 1FWZA 3CCRA 4DQ2A 4Y91A 1BYMA 1W2BA 1VQNA 1HXDA 3QIIA 3I56A 4NOYA 2H3JA 2LQ8A 2XI9A 2LVMA 3UT1A 4C8QD 4XTUA 5J39A 3QSUA 3SWNC 3MO8A 1QVFA 2P0QA 1YITA 4C92F 4RCBA 2QXFA 5LJ3d 3G6ET 3CCET 2K4YA 4BUGA 1XTDA 4KT0E 3OS5A 1I81A 2E1HA 2R5AA 1VQPT 3JB9F 2QQSA 5A0GA 3ER0A 3EAEA 3S3MA 1TH7A 4M7DG 2RA2A 3X28B 1G3SA 4HCZA 3RERA 3JCMX 3JCMf 3NTHA 1HK9A 5HKCA 2RHUA 1BIAA 3M55A 4J5YA 2EWNA 3OYIA 2OTLT 4EMHA 5A0LA 1PSEA 3MEWA 1NJIC 4MDXA 1YHQA 3LGFA 1KC8C 1Q81C 5D6WA 2VUBA 4C92B 5GAMd 4M78E 4A4GA 3LWHA 5DLQE 2R58A 2DAQA 4HCCA 5GANh 4E7HA 2L8DA 2E5QA 1M8VA 3LYIA 1Y96B 5GAMj 3JCMW 1K73U 1UGSB 4M77G 4LDWA 2RHZA 3EFRA 2DD4A 2CZ7B 4X9DA 4MZTA 5DY9A 3CMAT 2ZPHB 4M75G 4C8QB 1QP2A 4OMFB 4BI3A 4LDVA 5KCHA 1GXIE 2B8AA 4A4KA 1N27A 1YITT 2RD1A 3ZEHA 1YI2T 1Y7XA 4ZTFA 3G6EA 2MWOA 4XU1A 4J83A 4M75D 3LX7A 4M78B 3QZ5B 2JOYA 3G4ST 1YHQT 4GY5A 2XD0A 4DA4A 4BI4A 2QQRA 5GAOm 5GANg 4QQGA 3CCLA 4EDUA 3O8VA 3HFNA 3CD6A 3CXCS 4EMKC 2K5FA 1VQ9T 4J7IA 1I4K1 4HT8A 1VQOT 1VQKA 4M7DA 3BFMA 4M7DE 2I2LA 1KQ2A 3CCRT 3T9NA 3G71A 1SSFA 2OTLA 4ZN3A 2DIGA 3QXEB 4GLKA 3CCUT 2RJEA 1O9SA 3QZ9B 1M1GA 3FRNA 3GLXA 1OI1A 4RMOA 4RG2A 2IVWA 4M7DC 1U1TA 3DB3A 1OZ2A 5LJ5f 5J3BA 3QBYA 3OS2A 2JVVA 2JTMA 1XQHA 5FRNA 4M78F 3V8JA 3CC7T 3GIBA 2X4XA 2RJDA 2EJ9A 3A8LB 1QVFS 3CCLT 2X4WA 3CXCA 2DXUA 2OAUA 3CMAA 4ZGJB 5DLOA 3ZFJA 3RKYA 1MGQA 3OYLA 4D6WA 4M7AE 2KQWA 3RMQA 1BI1A 3A8OB 3OS1A 3TU4K 1D3BB 5GAMh 2A3LA 2RHYA 3SWNB 1P92A 2M1HA 1KQ1A 4BD3A 4XQ3A 4C8QA 5DM7R 3DLLA 3HSBA 2PQWA 4M77D 4PJOC 4PL6A 4IUQA 4A53A 1JB0E 3QPHA 2E65A 1H641 2YLCA 3BDLA 4LD6A 1VQ7A 3OY9A 4F7UE 2DKGA 4IUUA 2A7YA 3L2QA 2P4TA 4M75E 3FEOA 5CAIA 4P5NA 2DVEA 5GMKj 3NTKA 3PMTA 3JAME 3M4YA 3L2UA 4N0AA 1YBYA 2HQEA 3L2RA 4BE2A 2DXCA 2R57A 2VGNA 1RL2A 3KUFA 3MP6A 4O6JA 5CO7A 2FYKA 4MMKA 4XTXA 4A4EA 2XDDA 1VQMA 1VQLT 3CD6T 1MHNA 1UGPB 2EKOA 1Q82U 4HCBA 1B34B 4LDYA 2KK4A 4M7AA 2O01E 4C5HA 3M58A 4KULA 5GAN8 3G71T 4MDWA 1G3WA 4II1A 4X9CA 4EMKA 2CZ0B 2E6NA 3P8DA 4B9WA 5I21A 3QKJA 2XICA 4E7IA 1YJNA 3TEEA 3CPWS 3Q1JA 1VQ7T 4F7UG 2FL7A 2EQMA 3CEYA 3L2WA 2V8KA 2MAMA 1UEBA 3M9QA 5GAMg 1Q7YC 4XU3A 1YJWT 1IREB 2K5LA 4E7LA 1KD1C 2RO0A 1WQ7A 2LCLA 2KSSA 1UGQB 2M0OA 3JCMe 3CMEA 3CC2T 3VYGA 1EIFA 1KG1A 5CQYA 2FB7A 3I56T 2ZGWA 1JJ2S 1WQWA 4PKCC 4ZGEB 2BKDN 5CR2A 3LLRA 5FU7C 4J6XA 1M4ZA 3QO3A 5CKEA 2KMTA 2MMPA 2V8IA 2QEXT 1Y07A 4R56A 3OW2S 3M56A 4ZN1A 2LT4A 3OYEA 2VXEA 1VQ4T 5CKBA 2DXBA 1WPYA 1JJ2A 5CKHA 5CK9A 4C92G 2C06A 1PSFA 2QQ9A 1KC8U 3HHTB 4JRIA 1DJ7B 3F70A 4XU0A 1W4SA 3V8KA 3TCJA 3G7ZA 4L6V5 4XTWA 3JCMc 3N5BB 1YJWA 3CCVT 3QG1A 3S3OA 4M77A 1Q82C 2X4JA 2RHIA 5LJ3e 2Y90A 3MEUA 3H8ZA 3CC2A 1X75C 4RKUE 4M7AC 4BY6B 3M59A 3OYCA 4WF2A 5GAN3 3V7SA 1YJ9A 4OB3B 4QW2A 4OP0A 3V8LA 2PUKB 4BDYA 1Q86U 1M1FA 2QA4A 2X4YA 2BUDA 3GPLA 3M53A 3QDRB 2ZPGB 5D6YA 3ZBDA 2PUOB 1NPPA 3E9GA 5CKDA 5LL6S 2GFAA 3HPWA 2VV5A 2MI6A 5FU6C 4DOWA 4DOVA 5GAN5 4Y28E 2P0PA 4XU2A 4M7DD 4OB0B 1VQOA 4EMGA 2BIVA 3CCMT 1YI2A 2P0KA 4JRKA 2OTJA 4J7FA 2HAXA 1Y71A 3OYJA 1V29B 2DPPB 1X6OA 3CCQT 1YJ9T 1KQSA 3JCMJ 5HK3A 3GOXA 1QP3A 2VC8A 1G5VA 4HT9A 4FIBA 4FL6A 5J26A 2K57A 2LTOA 1YJNT 2F5KA 3HL8A 2E6ZA 3CCVA 4ME7A 3C95A 5LJ5h 2QQAA 3C4SA 4FT2A 1QVPA 3CBOA 2DXTA 4J8OA 3CCJT 3OYFA 2WSCE 4XAXB 4C5GA 4F7UA 5GANd 3VJPA 2XG8D 3UWNA 3CCST 3JCMQ 3OYNA 4IURA 2O4XA 1OZ3A 4FSXA 3JB9J 1FXXA 2HNIA 3JSCA 3VUBA 4FT4A 4OF1A 1YIJT 2DTOA 1FX7A 3X24B 1M90C 2JNGA 1WGSA 3PMIA 4N4GA 1YCYA 4F7UF 2RHXA 2CKKA 3MP1A 4L59A 4E47A 3HRSA 4C92E 3FC3A 2DIQA 3EFSA 2KDSA 3PGGA 4KBMB 4ZGDB 3JB9D 5GANf 2ZPBB 3SDZA 2L3RA 2QQBA 5A2QE 3JB9G 2PU9B 1VQPA 1G3TA 4M77B 3SB2A 5KE2A 1N8RU 3LWIA 4A54A 3RKWA 3CPFA 1VQ5T 2KY9A 3V7CA 4QVCA 3ME9A 4C0DB 3JCMP 1G3YA 4C5IA 3VU3C 4EMKB 4QQDA 3AHUA 5GAN4 2K5IA 1M90U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UDC A;  2OAU A;  2RK1 A;  2GQV A;  3SFM A;  3T9N A;  2P4T A;  2RH2 A;  2VV5 A;  1VIF A;  2RK2 A;  1VIE A; 
#chains in the Genus database with same CATH topology
 2YLB A;  2EAY A;  5GAO p;  1VQ8 T;  5CKF A;  4QQ6 A;  3KFV A;  2JMA A;  2E10 A;  2YUQ A;  1BIB A;  4LN2 A;  3RIR A;  2LDM A;  2CUD A;  2D8J A;  1KD1 U;  1U8R A;  4PJO E;  2GFU A;  2QDY B;  1SKU B;  2QAZ A;  3A1P A;  3EH2 A;  3OMC A;  4TVR A;  5KYW A;  8AT1 B;  1SF9 A;  3CCS A;  4PFZ A;  3A8H B;  2XKO C;  2EQU A;  1HJD A;  1SPK A;  1BBZ A;  3OYK A;  4FSS A;  2AZV A;  1WXB A;  2FRY A;  3S3N A;  1ZHI A;  5GAO q;  5I2M A;  3M57 A;  4AG1 C;  1X6B A;  5L8R E;  5LJ5 e;  3EG9 A;  4M78 D;  2KEA A;  2LX7 A;  7AT1 B;  2DF6 A;  2DIL A;  1QCO A;  2NWM A;  3OYH A;  4A4F A;  4J9E A;  1IZ6 A;  1JRI A;  4IKF A;  1H3Z A;  1ABQ A;  1VQ4 A;  1C6V X;  3CC7 A;  1RI0 A;  4LD9 K;  2RN8 A;  2V1R A;  4RTZ A;  3OYY A;  2HBW A;  2KXD A;  4KUI A;  4LDX A;  1N8R C;  3JB9 H;  2DD5 A;  3WVD B;  3VRZ A;  3L42 A;  2M9U A;  1VQ6 T;  2GNC A;  3QHS A;  5LJ3 h;  3NFC A;  4MDX A;  1QWE A;  1W2B S;  2YUP A;  5FLX E;  1VQ8 A;  3NTI A;  4M77 C;  1VOM A;  1XOV A;  3DKM A;  4C0D C;  4BI8 B;  2XU8 A;  4ESR A;  1U1S A;  3UAT A;  3P8B B;  1M90 U;  2K3X A;  3RUX A;  1VUB A;  2K2V A;  1NPR A;  4C92 A;  1BB9 A;  4B9X A;  2V8J A;  1ZSZ C;  2PVO B;  1TS9 A;  3M4G A;  4QKU A;  2HMA A;  3UDC A;  3R6O A;  1M5Q 1;  4PJJ A;  1VQ5 A;  4M75 B;  2XID A;  1QW1 A;  3SFM A;  4JS4 A;  2LT1 A;  3VUZ A;  3OYD A;  3QUI A;  2E41 A;  1RLP C;  3CPW A;  2AKK A;  1Z9Q A;  2QEX A;  3CBM A;  1D3B A;  4PLL A;  3OYA A;  2FHD A;  2GQI A;  2CH4 A;  2X3W D;  1LNX A;  2YWW A;  1K8A U;  1K9M C;  2EFI A;  3GNG A;  3E9F A;  3RBB B;  2NLU A;  4E7K A;  4MZM A;  4JLG A;  1T0J A;  1D1C A;  1QLY A;  4JS5 A;  3VKI A;  1K73 C;  1OPL A;  2HBP A;  4PNO A;  5D7U A;  5I2S A;  5GMK m;  4C5E A;  2MF2 A;  2QAS A;  5IT9 E;  1KHI A;  4D8D A;  4J9F A;  3VV0 A;  1RUW A;  5FW9 A;  3H41 A;  2OTJ T;  3QJ6 A;  1RAC B;  2LC4 A;  2PZ1 A;  2EQJ A;  4M7D B;  5IXB A;  2ZPF B;  3TSW A;  1FMK A;  3PFS A;  1MMG A;  2NUT A;  3M0R A;  5FWB A;  1VIF A;  4HCK A;  1T3S A;  1U3O A;  3CCV Q;  3CCR A;  2HDA A;  2QA4 Q;  1BYM A;  3M0Q A;  1WYX A;  1VQO Q;  1YIT A;  1JO8 A;  5LJ3 d;  1ACM B;  2K4Y A;  1VQP T;  1I81 A;  5A0G A;  1IGQ A;  1TH7 A;  2OJ2 A;  4M7D G;  2QYZ A;  4CC2 A;  1G3S A;  1VA7 A;  3RER A;  3JCM X;  1TSF A;  2RHU A;  4LUE A;  4PJL A;  1PSE A;  1VYU A;  2COW A;  1W1F A;  1KC8 C;  2LMJ A;  5D6W A;  2VUB A;  2O88 A;  2K7A A;  4A4G A;  3LWH A;  3D7S B;  1MMN A;  1ZUU A;  1WHL A;  1M8V A;  1Y96 B;  4J9H A;  5GAM j;  2DD4 A;  4CC7 A;  3G1J A;  5DY9 A;  2NUP A;  4LE9 A;  4MZT A;  4X9D A;  4OMF B;  4A4K A;  1YIT T;  4KGV B;  3THK A;  4M78 B;  3QZ5 B;  2XD0 A;  4DA4 A;  2ESW A;  4CC4 B;  2BZ8 A;  3HFN A;  4M7D E;  3BFM A;  1YJN Q;  1KQ2 A;  3CCR T;  2D0N A;  3G71 A;  3IQL A;  2RJE A;  2E3H A;  3GLX A;  4M7D C;  1U1T A;  1OZ2 A;  5LJ5 f;  5J3B A;  1M3A A;  1M27 C;  3CC7 T;  3GIB A;  2RJD A;  2MOX A;  4LUD A;  2RNA A;  2OAU A;  2JXB A;  5IHI A;  1YP5 A;  3OYL A;  3OS1 A;  1R0B G;  1BI1 A;  3A8O B;  1YHQ Q;  3HSB A;  1P92 A;  3DLL A;  4XQ3 A;  1OPK A;  1K0S A;  4PJO C;  2QDL A;  4IUQ A;  3QPH A;  2YLC A;  1H64 1;  4F7U E;  4IUU A;  4JJD A;  1PHT A;  1UHC A;  4DBH A;  4F17 A;  2X51 A;  2NUT B;  8ATC B;  1K73 R;  5IHN A;  2R57 A;  4M7D A;  1Q7Y R;  4A4E A;  1OEB A;  1UGP B;  2EVR A;  3P8D A;  2ROL A;  2MPX C;  5KYW B;  1VQ7 T;  2EQM A;  4RTU A;  3L2W A;  2MAM A;  3OW2 P;  1YJW T;  2K5L A;  1AWX A;  2RO0 A;  1WQ7 A;  1UGQ B;  2M0O A;  3JCM e;  5CQY A;  1TUD A;  3G6E Q;  2A08 A;  2BKD N;  5CR2 A;  3LLR A;  3QO3 A;  5CKE A;  1JXO A;  2V8I A;  2QEX T;  4GLM A;  4R56 A;  3OW2 S;  3H0I A;  1T3L A;  1JJ2 A;  5CKH A;  2C06 A;  4C92 G;  4PFO A;  1PSF A;  3CME Q;  1DJ7 B;  5AT1 B;  4XTW A;  3N5B B;  3CCV T;  2E4H A;  2X4J A;  2RHI A;  2DL3 A;  3H8Z A;  4M7A C;  4BY6 B;  2EGE A;  4J9G A;  4WF2 A;  3OYC A;  4OB3 B;  4QW2 A;  2CP0 A;  3RDV A;  1M1F A;  1YJW Q;  2J6K A;  1S72 Q;  2K9G A;  4LNP A;  2FRW A;  2ZPG B;  1RAH B;  3ZBD A;  1U5S A;  1F1B B;  2LJ3 A;  2PUO B;  2KYB A;  1VQ4 Q;  1PKS A;  5LL6 S;  2QEX Q;  5FU6 C;  2MI6 A;  4Y28 E;  2JMC A;  2P0K A;  2L3Q A;  2OTJ A;  2HAX A;  4JPB W;  1ZLM A;  2XMF A;  1X6O A;  3VS7 A;  3JCM J;  5HK3 A;  3GOX A;  1QP3 A;  1G5V A;  2E6Z A;  1EFN A;  3CCV A;  2YUN A;  2QQA A;  3CCJ Q;  1QVP A;  2WSC E;  4XAX B;  2XG8 D;  3UWN A;  3JCM Q;  1TUG B;  4FSX A;  3JB9 J;  3JSC A;  4FT4 A;  4OF1 A;  1YIJ T;  1M90 C;  3X24 B;  3PMI A;  1YIT Q;  1YCY A;  3MP1 A;  3HRS A;  4C92 E;  3HTR A;  3EG2 A;  3EFS A;  2DFU A;  5GAN f;  2L3R A;  3CC4 Q;  1VQP A;  2VVK A;  2DJQ A;  3LWI A;  2CP6 A;  4IIM A;  5KYY A;  1B3Q A;  3EHR A;  3AHU A;  4D8K A;  2K5I A;  2YUO A;  1X43 A;  3VS5 A;  2K2M A;  2KVQ G;  4BE0 A;  4ELZ C;  5HY6 A;  1KD1 R;  4IUT A;  1TOV A;  3OQ5 A;  5LJ3 j;  3M54 A;  4ZNX A;  2QI2 A;  4JJB A;  1YIJ A;  4FYW B;  4M77 F;  4BY6 C;  2CUB A;  1ZBJ A;  1BCO A;  2CP7 A;  4PJO G;  4FYX B;  2FPF A;  2YXY A;  3LW5 E;  2M16 A;  5IHK A;  1YCS B;  3CXC P;  1M2O A;  1S72 A;  3BDU A;  3OSS C;  2LJ1 A;  5IXF A;  1V76 A;  1OU8 A;  5FU6 B;  3J81 E;  3HFO A;  4OGC A;  4JDS A;  4OMN A;  1BCM A;  4C0Z A;  3CCL Q;  2DLP A;  1QKX A;  1QCF A;  3GNF B;  2L5Q A;  5HK0 A;  1UB4 A;  3J80 E;  4WTO B;  1NG2 A;  2SRC A;  4RCC A;  2PVG B;  5GMK h;  2DTI A;  2LJ0 A;  5GMK e;  1BKB A;  2EQK A;  2HQH A;  2RK2 A;  4EPC A;  4ATO A;  1TWB A;  1OOT A;  2C0O A;  2GF7 A;  2KAF A;  3KBG A;  1IRX A;  1S72 T;  4M7A F;  2X9H A;  3PE0 A;  5EG2 A;  1IGU A;  2DZ9 A;  1MUZ A;  5KCO A;  2XK0 A;  3FIF A;  3OYG A;  1M1K R;  3VS4 A;  3FB9 A;  1BI2 A;  4M75 F;  4NL3 A;  3I5S A;  2JTF A;  1M3C A;  3SEM A;  1KQS S;  2RI5 A;  2D6F A;  1MMD A;  4MML A;  3EGD B;  2DO3 A;  4M7A B;  4X34 A;  2YHT A;  3OBW A;  2COZ A;  4V2S A;  4RTW A;  1YWO A;  3I56 Q;  4C8Q F;  3CC2 Q;  2KE9 A;  1QCN A;  2EYQ A;  1KQS P;  2AZS A;  3RMS A;  2CZ1 B;  4J6W A;  1K0X A;  5C6S A;  2F2X A;  2RH2 A;  4F7U B;  2K3Y A;  4A4H A;  1LCK A;  1JXM A;  2KT1 A;  3EG9 B;  3PIP A;  5EC7 A;  5GAN 7;  4J9B A;  4M7A G;  4JLI A;  2CDT A;  2VYT A;  2DTH A;  5LJ3 g;  1I07 A;  3TVT A;  3CCU A;  3EFO A;  2CS7 A;  3E1S A;  1UFF A;  3CCE A;  1JJ2 P;  1VQ6 A;  4N4H A;  1BI3 A;  2AIR B;  5C0M A;  4J9C A;  1M2V B;  1OX8 A;  4C92 C;  3I9Q A;  3MP8 A;  4E7J A;  5KYX B;  3EHQ A;  3L2Z A;  1Q7Y U;  1RI9 A;  5CVI A;  4KUD K;  3TRE A;  2KXC A;  2RK1 A;  1WDX A;  3QDF A;  4M7A D;  4C8Q C;  1GRI A;  5GAN e;  2YRV A;  3EGX B;  1O75 A;  3OA6 A;  2E12 A;  1RAB B;  1JBM A;  3CCM Q;  5GAM e;  2L3P A;  3LH5 A;  3MJX A;  3QJY A;  2GCX A;  4DBF A;  5GAM f;  1QMC A;  2LRQ A;  4J9I A;  1PCX A;  4OMP A;  2EBP A;  3JCM d;  2FPD A;  1UG1 A;  3RKX A;  3I55 A;  2QTX A;  2GGR A;  5GMK i;  3C94 A;  4PJO F;  1VQM T;  3CCU Q;  5GAN 2;  1M1K U;  5GAO l;  3MHX A;  2FEI A;  1S1N A;  3QYH B;  3PT9 A;  4ZTJ A;  2FZC B;  1ZUK A;  3GBQ A;  5KYX A;  2DYI A;  3WXM B;  3C12 A;  4DOW A;  2RJF A;  2V26 A;  3A8M B;  4J6Y A;  3X25 B;  3X26 B;  1N9R A;  2XDP A;  1FWZ A;  2KRS A;  1M90 R;  4K11 A;  3EG0 A;  1HXD A;  4NOY A;  2H3J A;  2LQ8 A;  2O9S A;  4ANJ A;  2J6F A;  4AFQ C;  2QXF A;  3CCE T;  1XTD A;  4KT0 E;  3OS5 A;  2R5A A;  5KYU B;  4Z88 A;  1TTH B;  2QQS A;  2DEU A;  1K8A R;  1D0Y A;  3S3M A;  1BU1 A;  4OMM A;  2RA2 A;  3X28 B;  4HCZ A;  2DL4 A;  1HK9 A;  4J5Y A;  3MEW A;  2O2O A;  1IHW A;  2BE9 B;  1Q81 C;  1OUL A;  4C92 B;  4M78 E;  2KRM A;  1E6H A;  2DAQ A;  2GBQ A;  2YT6 A;  2RQU A;  3JCM W;  1K73 U;  4M77 G;  1GBQ A;  2RQR A;  2EYW A;  4RTY A;  2ZPH B;  4M75 G;  4BI3 A;  4LDV A;  1N27 A;  1QQJ A;  1VQK Q;  4ZTF A;  1WHG A;  3LX7 A;  3QWX X;  4E7S A;  3CCL A;  3CD6 A;  2JS2 A;  2K5F A;  4J7I A;  1I4K 1;  1VQO T;  1VQK A;  2DX1 A;  1EZZ B;  1SSF A;  4ZN3 A;  2DIG A;  3QXE B;  4GLK A;  1M1G A;  1OI1 A;  4RG2 A;  2IVW A;  5KYY B;  2BTT A;  1RAA B;  2BZX A;  2RQT A;  2VWF A;  3OS2 A;  2JVV A;  2JTM A;  5FRN A;  2X4X A;  3A8L B;  3VS1 A;  1PG5 B;  2X4W A;  2DET A;  1I5O B;  2FZK B;  3EGX A;  4D6W A;  2A3L A;  2M1H A;  1KQ1 A;  2PQW A;  3O5Z A;  4M77 D;  2DMO A;  3BDL A;  2C0T A;  2P4T A;  1R0C B;  3FEO A;  2JM9 A;  1PKT A;  3PMT A;  3U23 A;  3JAM E;  4N0A A;  1YBY A;  1FMV A;  2DXC A;  3KUF A;  3MP6 A;  3CCS Q;  1QVF S;  1VQL T;  1Q82 U;  4HCB A;  4AT1 B;  4LDY A;  2KK4 A;  4C5H A;  5GAN 8;  3G71 T;  4II1 A;  4X9C A;  1WIE A;  5I21 A;  2KNB B;  3QKJ A;  3Q1J A;  1UHF A;  4F7U G;  3CEY A;  1Q7Y C;  2V8K A;  5GAM g;  1ZSZ A;  2KSS A;  2KGT A;  2CT3 A;  3CC2 T;  3VYG A;  1YN8 A;  2FB7 A;  2ZGW A;  1WQW A;  2HCK A;  1Y0M A;  3M56 A;  4ZN1 A;  1VQ4 T;  2DXB A;  1NEG A;  1NBE B;  2DL5 A;  2QQ9 A;  4XU0 A;  1W4S A;  1WLP B;  3V8K A;  3JCM c;  4L6V 5;  1YJW A;  2RQV A;  3S3O A;  4M77 A;  1SRM A;  2Y90 A;  4J9D A;  4RKU E;  3M59 A;  1PRL C;  1MV0 B;  3V7S A;  1M3B A;  4BDY A;  2X4Y A;  2BUD A;  1ZSZ B;  1M8M A;  3REB B;  1NPP A;  5CKD A;  2D1X A;  4XU2 A;  4M7D D;  2ED0 A;  4OB0 B;  1VQ6 Q;  4EMG A;  1IO6 A;  3CCM T;  4JRK A;  4J7F A;  2OAW A;  2KT8 A;  2W0Z A;  1RLQ C;  2VC8 A;  4JZ3 A;  2HL5 C;  4FL6 A;  3CCR Q;  2F5K A;  1G2B A;  3HL8 A;  2DRK A;  4ME7 A;  3C95 A;  5LJ5 h;  3CCJ T;  3VJP A;  2J05 A;  1FXX A;  2HNI A;  3PVL A;  2DTO A;  1FX7 A;  1HSQ A;  4N4G A;  1WGS A;  4E47 A;  3G71 Q;  1C1A A;  2KDS A;  3PGG A;  4KBM B;  3JB9 D;  2QQB A;  1TU0 B;  3M0P A;  3SB2 A;  1QVG P;  3RKW A;  1VQ5 T;  5FWC A;  3ME9 A;  4C0D B;  1FYN A;  4EMK B;  4QQD A;  5GAN 4;  4OVA A;  2RJC A;  5LJ5 g;  3PNW C;  2QG9 B;  2EQI A;  3MEV A;  4CC3 A;  2GTJ A;  2RI3 A;  4BAC A;  3BE3 A;  2EJF A;  3CCJ A;  4N4I A;  2F1L A;  4KGX B;  2DVJ A;  1W2B P;  4HA8 A;  1I5L A;  4AFZ C;  2HKN A;  2ZPE B;  1ZA2 B;  1KK7 A;  2FVU A;  4NL2 A;  2FZG B;  3BY7 A;  3CQT A;  1AHJ B;  4PJN A;  2V1Q A;  2Y4Y A;  4M75 C;  2XDB A;  4M78 G;  2O4X B;  4FU6 A;  4LDU A;  1B34 A;  3GP8 A;  1K8A C;  2DZC A;  3M5A A;  2IG0 A;  2MCN A;  1VQK T;  1N5Z A;  1SRL A;  4M7D F;  2JN0 A;  4QVZ A;  3L2V A;  3GF5 A;  4RTX A;  2K79 A;  2CH4 W;  2JTE A;  3JV3 A;  1T0H A;  5GAO n;  2QGF B;  2RI2 A;  4YTL A;  4C92 D;  2RQW A;  1KHC A;  4PLI A;  1N9S A;  2YDL A;  2MYS A;  2F69 A;  5FRO A;  2EYZ A;  3OSV A;  1H8K A;  4NS5 A;  3UF4 A;  2QGG A;  4M78 A;  3INZ A;  5IAY A;  2EYY A;  3DB4 A;  3PVQ A;  2QK0 A;  4M78 C;  3OS0 A;  2DJZ A;  3CCQ A;  3MKD A;  3CC4 T;  1X6G A;  1D1A A;  1D09 B;  4VUB A;  1K9A A;  3HRU A;  1NZ9 A;  1AD5 A;  1EX4 A;  2EGC A;  1VQL A;  5AYF A;  4KH0 B;  1RAF B;  2LCC A;  2J7I A;  1B07 A;  3UPU A;  4JJN K;  2DBK A;  4FM4 B;  5D6X A;  1KJW A;  3VYH B;  1MNE A;  1OU9 A;  2DNU A;  2F2V A;  4AMC A;  1LOJ A;  4RTT A;  4KRT A;  1CSK A;  4C0F A;  2QTV A;  3PTA A;  4IUV A;  1NE8 A;  4XTZ A;  4HVU A;  3MET A;  2SEM A;  4L5G A;  4C8Q G;  4IUP A;  4PFP A;  3JCM h;  3OYB A;  1VQ9 A;  5CQX A;  3JCM V;  1I8F A;  1PM3 A;  5FRM A;  5CCA A;  5LJ5 j;  5IH2 A;  1VIE A;  3P8H A;  1D0Z A;  2F5T X;  2WSE E;  1M9S A;  5KE3 A;  4BDZ A;  2LZ6 B;  4XTV A;  3H6Z A;  3R6N A;  1QVG S;  2DER A;  1SHG A;  2Y4X A;  1AT1 B;  3FJ5 A;  2KR3 A;  3ULR B;  2D9T A;  4QVD A;  2RM4 A;  2F2W A;  1NLO C;  1VQN T;  1E6G A;  3JCM g;  1YJ9 Q;  2QA4 T;  1Q86 C;  2VXF A;  3MEA A;  1OX9 A;  1UDL A;  3A8G B;  1LVK A;  1MV3 A;  1A0N B;  5KH6 A;  2CYZ B;  3FJP A;  4EIK A;  1BI0 A;  3OYM A;  4Y92 A;  2E70 A;  4M77 E;  2E64 A;  1MND A;  3MCA B;  2O9V A;  3CC7 Q;  2DK3 A;  3NHN A;  4KGZ B;  3G4S Q;  1R77 A;  3VS0 A;  4Y91 A;  1VQN A;  1AOJ A;  4F16 A;  1ZX6 A;  3I56 A;  3UT1 A;  2XI9 A;  4ORZ A;  4C8Q D;  5J39 A;  4XTU A;  1RAI B;  3SWN C;  2A36 A;  1QVF A;  1SSH A;  2P0Q A;  2YSQ A;  4RCB A;  4JJC A;  2KBT A;  2E1H A;  3JB9 F;  3EAE A;  3JCM f;  3NTH A;  3H0F A;  2DL7 A;  2HL3 A;  2OTL T;  4EMH A;  5A0L A;  1IB8 A;  1YHQ A;  5I22 A;  4RTV A;  1UUE A;  5KYN A;  1G8X A;  2KI7 A;  1K76 A;  2R58 A;  4E7H A;  2CSQ A;  3CCE Q;  2E5Q A;  2LP5 A;  1UGS B;  1WX6 A;  5KCH A;  1QP2 A;  1GXI E;  1VYT A;  2EPD A;  1YI2 T;  2L0A A;  3RNJ A;  2DE0 X;  2MWO A;  4XU1 A;  4M75 D;  3CD6 Q;  2P84 A;  4GY5 A;  4FCY A;  3EG3 A;  2ROT A;  3MPU B;  1VQ7 Q;  2E3I A;  4HT8 A;  1WI7 A;  2A28 A;  1NEB A;  2OTL A;  3CCU T;  3FRN A;  1JEG A;  2ECZ A;  3DB3 A;  1Y57 A;  3QBY A;  1TG0 A;  4FW1 A;  3CCL T;  4ZGJ B;  3ZFJ A;  1MGQ A;  4M7A E;  3RMQ A;  3TU4 K;  5GAM h;  3C0C A;  3SWN B;  2K6D A;  1UJY A;  1IXD A;  4A53 A;  1JB0 E;  2E65 A;  3SHW A;  4LD6 A;  2DKG A;  4M75 E;  2DVE A;  5GMK j;  3NTK A;  3L2U A;  2HQE A;  4BE2 A;  1RL2 A;  1H3H A;  1VQM A;  3CD6 T;  4XTX A;  4PK4 A;  1Q95 G;  2EKO A;  3A98 A;  1B34 B;  4M7A A;  2CP3 A;  3M58 A;  4KUL A;  1FMW A;  1G3W A;  3EGU A;  2CZ0 B;  2E6N A;  2CRE A;  2DRM A;  4E7I A;  2XIC A;  4AG2 C;  3TEE A;  4FYV B;  4R0K A;  3M0S A;  4XU3 A;  3CCQ Q;  1AZE A;  2MK5 A;  4PJM A;  1KG1 A;  3H9N A;  1OQK A;  2M02 A;  3CME A;  1JJ2 S;  4ZGE B;  4J6X A;  1M4Z A;  2KMT A;  1Y07 A;  3CMA Q;  5CKB A;  1IHV A;  1WPY A;  2NUP B;  3HHT B;  4JRI A;  3F70 A;  1V1C A;  3G7Z A;  3M0U A;  3QG1 A;  1AWJ A;  3CC2 A;  3MEU A;  2OTL Q;  1UTI A;  5GAN 3;  1YJ9 A;  4OP0 A;  3V8L A;  2QA4 A;  5GJV B;  3M53 A;  3QDR B;  4OML A;  2ABL A;  2B86 A;  4X1V A;  2GFA A;  1YWP A;  2VV5 A;  2M51 A;  3I5R A;  1KFZ A;  3OYJ A;  1V29 B;  2DPP B;  1X69 A;  2AK5 A;  4HVV A;  1C0M A;  2J06 A;  1K9M R;  1VQN Q;  5J26 A;  2K57 A;  1ZSG A;  3C4S A;  4FT2 A;  3CBO A;  1PWT A;  3OYF A;  5GAN d;  4C5G A;  1UEC A;  3CCS T;  3OYN A;  4IUR A;  2OI3 A;  1OZ3 A;  2D8H A;  1VQM Q;  2HKQ B;  1SHF A;  2JNG A;  2RHX A;  2CKK A;  4L59 A;  3FC3 A;  2DIQ A;  1N8R R;  4ZGD B;  1GCQ C;  2PU9 B;  1PD0 A;  1WXT A;  1X2K A;  2A0F B;  1G3T A;  5KE2 A;  1N8R U;  1BK2 A;  4A54 A;  3CPF A;  1G3Y A;  1W70 A;  4LXC A;  1ZUY A;  4HKE A;  1Y96 A;  3HKS A;  4Q5W A;  1KC8 R;  2RF0 A;  2AKL A;  3JRZ A;  1YFN A;  1NJI R;  4XK8 E;  1X2Q A;  1WJQ A;  4Z02 A;  2YRD A;  2VB6 A;  2CSI A;  2AT1 B;  5GAO r;  2HD0 A;  5LJ3 f;  2IIM A;  3RES A;  3I55 Q;  1R8O B;  4CI0 C;  1PD1 A;  3REA B;  3A5Z B;  2LCS A;  3NGP A;  2DL8 A;  4UC4 A;  2VGM A;  4PJO B;  3UA6 A;  3HP9 A;  3OBY A;  4BE1 A;  1WHH A;  1X01 A;  2EGA A;  3BW1 A;  1B7T A;  1NM7 A;  1U06 A;  3I55 T;  1K9M U;  5HCK A;  3LGL A;  3L1A A;  1GCP A;  2EW3 A;  2RB6 A;  3QYG B;  2COY A;  1LJO A;  2DBM A;  2FG0 A;  4R55 A;  1WNL A;  5GAN 6;  4C8Q E;  3NMZ C;  2ATC B;  1J3T A;  3FLG A;  2HEQ A;  1Q81 U;  4Z8A A;  2DEQ A;  1YNZ A;  3ASK A;  3KXT A;  2GTO A;  3M0T A;  1X27 A;  2EIF A;  1AVZ C;  2LNH B;  1GFC A;  2L3S A;  3FDR A;  2ZCF B;  2L89 A;  4MZP A;  3OMG A;  2JT4 A;  2AHJ B;  2HQX A;  1ZBX A;  1AWO A;  1NJI U;  2LQK A;  2HZY A;  2X35 A;  1XNI A;  1WHJ A;  5GJW B;  2CP5 A;  2WAC A;  3I35 A;  4XTY A;  3CCM A;  2ED1 A;  2JUF A;  4OB2 B;  2CZ6 B;  4JUV A;  2PVD B;  4JRP A;  3TQ7 P;  2IPO B;  2A37 A;  3SD4 A;  4E2F B;  1WJR A;  4ELY C;  2C0I A;  2X3X D;  4AFU C;  3E19 A;  4RG8 A;  3CME T;  1JQQ A;  3LH0 A;  3WVE B;  3PIO A;  1WJS A;  4C0G A;  1ABO A;  2PTK A;  5ECA A;  2GQV A;  4E6R A;  2KYM A;  2WSF E;  4M75 A;  5LJ5 d;  2LNV A;  2J6O A;  2ZPI B;  4HXJ A;  2PNI A;  4A63 B;  4JRQ A;  5KYU A;  1NLP C;  2K3B A;  3URG A;  5GAN j;  1RAE B;  2BE7 D;  1WHK A;  4BB7 A;  5IN1 A;  5GMK l;  4N0A C;  2KRO A;  3JB9 I;  4OGE A;  2CGH A;  1VQP Q;  3CC4 A;  3J7A F;  3CBP A;  4M4Z A;  2DM1 A;  2XHC A;  5A0D A;  1VQ8 Q;  6AT1 B;  3SWN A;  2ZZD A;  4PJO A;  2LX9 A;  3HRT A;  4E7Z A;  3X20 B;  3EGD A;  5CIU A;  5M9O A;  2ENM A;  2YRC A;  1ZQ1 A;  2G3R A;  4CRI A;  3OB9 A;  1WXU A;  1M1K C;  2R5M A;  5FU7 B;  3ZL7 C;  4F14 A;  3DLM A;  2MWP A;  2OX7 A;  1N6A A;  3OW2 A;  1OV3 A;  1D0X A;  2D0Q B;  1QVG A;  1UGR B;  3G4S A;  3JCM b;  2JZ2 A;  4O5V A;  1OYX A;  2EJG A;  1D1B A;  3V7R A;  4OB1 B;  3S6W A;  4DBQ A;  4OMO A;  4PJO D;  1GL5 A;  1JU5 C;  4DQ2 A;  2ZAE A;  1W2B A;  3QII A;  1TXQ A;  1VYV A;  2W10 A;  2LVM A;  3QSU A;  3MO8 A;  1UGV A;  1K4U S;  4C92 F;  3G6E T;  4BUG A;  4JZ4 A;  1K1Z A;  2RPN A;  3EFO B;  3ER0 A;  1MMA A;  4F04 B;  1KSW A;  9ATC B;  4GBQ A;  1I1J A;  5HKC A;  2O31 A;  1RAD B;  1BIA A;  1VQ9 Q;  3M55 A;  2EWN A;  3OYI A;  1CKA A;  1NJI C;  3RR6 A;  4B6M A;  2Z0W A;  3LGF A;  1AZG B;  1AEY A;  1SEM A;  5GAM d;  1HYO A;  1QKW A;  5DLQ E;  4HCC A;  1XJW B;  5GAN h;  2L8D A;  1WFW A;  3LYI A;  1CKB A;  4LDW A;  2RHZ A;  3EFR A;  2CZ7 B;  3CMA T;  4C8Q B;  3NPF A;  2B8A A;  2RD1 A;  3ZEH A;  1Y7X A;  3G6E A;  4KH1 B;  1VQL Q;  4J83 A;  5L23 A;  4DEX A;  1PNJ A;  2JOY A;  3G4S T;  1YHQ T;  4BI4 A;  2QQR A;  1QWF A;  5GAO m;  5GAN g;  4QQG A;  4EDU A;  3O8V A;  1Z9Z A;  3CXC S;  1GCQ A;  4EMK C;  1VQ9 T;  2I2L A;  2DA9 A;  3T9N A;  1PC0 A;  1O9S A;  3QZ9 B;  4RMO A;  1ZA1 B;  3VRY A;  1WA7 A;  2JW4 A;  1XQH A;  2JM8 A;  4M78 F;  1GBR A;  3V8J A;  2EJ9 A;  3VS3 A;  3CXC A;  1LPL A;  2FO0 A;  2DXU A;  3CMA A;  5DLO A;  4QT7 A;  3RKY A;  3TSZ A;  1SG5 A;  2KQW A;  1M30 A;  1VQ5 Q;  1D3B B;  3UA7 A;  2RHY A;  1WZO A;  4BD3 A;  4C8Q A;  5DM7 R;  2HSP A;  1UJ0 A;  4PL6 A;  3EG1 A;  4AFS C;  1VQ7 A;  3OY9 A;  2CT4 A;  3AT1 B;  2A7Y A;  4RUG A;  3L2Q A;  5CAI A;  4P5N A;  1TUC A;  3M4Y A;  1Q82 R;  1G83 A;  3L2R A;  5CO7 A;  2VGN A;  4O6J A;  2FYK A;  4MMK A;  2XDD A;  2L2P A;  1MHN A;  4OMQ A;  2O01 E;  4MDW A;  4EMK A;  4B9W A;  1YJN A;  2EYX A;  3CPW S;  2FL7 A;  3M9Q A;  1UEB A;  1ARK A;  1RAG B;  1IRE B;  1KD1 C;  4E7L A;  2M0Y A;  2LCL A;  2LQW A;  1WHM A;  1EIF A;  3VS6 A;  3I56 T;  2H3E B;  4PKC C;  1YI2 Q;  5FU7 C;  4Z89 A;  3CPW P;  1NYG A;  2MMP A;  4FYY B;  2G6F X;  2LT4 A;  3OYE A;  2VXE A;  5CK9 A;  1KIK A;  2I0N A;  2OTJ Q;  1YIJ Q;  1KC8 U;  4IIO A;  3TCJ A;  3H0H A;  1HD3 A;  4WCI A;  3VS2 A;  1Q82 C;  5LJ3 e;  2JS0 A;  1X75 C;  2MIO A;  3E2U A;  2H8H A;  2PUK B;  1Q86 U;  1M2V A;  3GPL A;  2VAS A;  2VKN A;  5D6Y A;  1Q86 R;  1AWW A;  3E9G A;  1PRM C;  3HPW A;  4DOV A;  5GAN 5;  2RMO A;  1QVF P;  2P0P A;  1VQO A;  2BIV A;  1YI2 A;  1NYF A;  1Y71 A;  3EH1 A;  1YJ9 T;  1KQS A;  3CCQ T;  2P4R A;  2FPE A;  5I11 A;  4HT9 A;  2CP2 A;  4FIB A;  3QWY A;  2LTO A;  4HVW A;  1YJN T;  2KRN A;  2HSE B;  4J8O A;  2DXT A;  2EKH A;  4DEY A;  4F7U A;  2O4X A;  3VUB A;  2LQN A;  1Q81 R;  1UE9 A;  2E5K A;  4F7U F;  1I0C A;  2JJ9 A;  1GFD A;  2NYS A;  2ZPB B;  3SDZ A;  5A2Q E;  3JB9 G;  4FW2 A;  4DBR A;  4M77 B;  1E7O A;  2BZY A;  2KY9 A;  2NUZ A;  3V7C A;  4QVC A;  2DYB A;  3JCM P;  4C5I A;  3VU3 C;  1W6X A;  1H92 A; 
#chains in the Genus database with same CATH homology
 4HKE A;  2YLB A;  2RJC A;  5LJ5 g;  2KVQ G;  1Y96 A;  3HKS A;  3PNW C;  3MEV A;  2EAY A;  4Q5W A;  4BE0 A;  2RI3 A;  4ELZ C;  5GAO p;  4BAC A;  2EJF A;  3JRZ A;  1VQ8 T;  3CCJ A;  5HY6 A;  4N4I A;  5CKF A;  4QQ6 A;  4XK8 E;  4IUT A;  2E10 A;  1WJQ A;  1BIB A;  3OQ5 A;  4Z02 A;  3RIR A;  3M54 A;  4HA8 A;  5LJ3 j;  1I5L A;  2LDM A;  2ZPE B;  5GAO r;  2HD0 A;  2QI2 A;  1YIJ A;  2FVU A;  1KD1 U;  4M77 F;  4BY6 C;  1U8R A;  2GFU A;  2QDY B;  5LJ3 f;  4PJO E;  4NL2 A;  3RES A;  1R8O B;  3BY7 A;  3OMC A;  4TVR A;  4PJO G;  1AHJ B;  4CI0 C;  2Y4Y A;  3LW5 E;  2M16 A;  3A5Z B;  4M75 C;  3CCS A;  2XDB A;  4M78 G;  2O4X B;  4FU6 A;  4LDU A;  1S72 A;  3A8H B;  3BDU A;  3OSS C;  2XKO C;  2EQU A;  1B34 A;  3OYK A;  3GP8 A;  1K8A C;  4UC4 A;  2DZC A;  2VGM A;  3M5A A;  5FU6 B;  2IG0 A;  3J81 E;  3S3N A;  1ZHI A;  3HP9 A;  5I2M A;  3HFO A;  3OBY A;  4OGC A;  5GAO q;  4BE1 A;  1VQK T;  3M57 A;  4JDS A;  4M7D F;  1X01 A;  2JN0 A;  4QVZ A;  3L2V A;  3BW1 A;  4C0Z A;  3I55 T;  5L8R E;  1K9M U;  3GNF B;  3GF5 A;  2L5Q A;  5LJ5 e;  3LGL A;  4M78 D;  3L1A A;  5HK0 A;  2RB6 A;  1UB4 A;  3J80 E;  5GAO n;  4RCC A;  3QYG B;  2RI2 A;  2PVG B;  1LJO A;  4R55 A;  4YTL A;  5GMK h;  1WNL A;  3OYH A;  5GAN 6;  2DTI A;  4PJO B;  4C92 D;  4A4F A;  4C8Q E;  5GMK e;  1IZ6 A;  1JRI A;  1KHC A;  4IKF A;  1H3Z A;  4PLI A;  1BKB A;  3FLG A;  1N9S A;  1VQ4 A;  3CC7 A;  2F69 A;  1RI0 A;  5FRO A;  2EQK A;  1Q81 U;  4LD9 K;  2DEQ A;  2RK2 A;  3OSV A;  3ASK A;  4EPC A;  4ATO A;  3KXT A;  4NS5 A;  2GF7 A;  2EIF A;  2KAF A;  3KBG A;  3INZ A;  3FDR A;  3OYY A;  4M78 A;  2ZCF B;  5IAY A;  1S72 T;  4KUI A;  4LDX A;  2L89 A;  4M7A F;  1N8R C;  3DB4 A;  4MZP A;  5EG2 A;  3JB9 H;  2DD5 A;  3WVD B;  4M78 C;  3OMG A;  3L42 A;  2M9U A;  2DJZ A;  3OS0 A;  1VQ6 T;  3QHS A;  2AHJ B;  2DZ9 A;  3NFC A;  2HQX A;  5LJ3 h;  1ZBX A;  3CCQ A;  3CC4 T;  1W2B S;  5FLX E;  5KCO A;  1NJI U;  1VQ8 A;  2XK0 A;  2LQK A;  3NTI A;  3FIF A;  3OYG A;  4M77 C;  4VUB A;  3HRU A;  1XOV A;  2X35 A;  1XNI A;  3DKM A;  2WAC A;  4C0D C;  3FB9 A;  1NZ9 A;  4XTY A;  1BI2 A;  2JUF A;  4M75 F;  3CCM A;  4NL3 A;  4OB2 B;  1VQL A;  5AYF A;  4BI8 B;  2CZ6 B;  2XU8 A;  2JTF A;  4JUV A;  1KQS S;  2LCC A;  1U1S A;  2RI5 A;  2D6F A;  2PVD B;  4MML A;  3P8B B;  4JJN K;  3UPU A;  4FM4 B;  2K3X A;  2DO3 A;  4M7A B;  4JRP A;  4X34 A;  5D6X A;  2YHT A;  3OBW A;  3RUX A;  4V2S A;  1VUB A;  3SD4 A;  2K2V A;  3VYH B;  4C8Q F;  1NPR A;  4C92 A;  4B9X A;  1LOJ A;  2EYQ A;  2V8J A;  1WJR A;  2PVO B;  4ELY C;  3M4G A;  3UDC A;  3R6O A;  3RMS A;  2CZ1 B;  3E19 A;  1M5Q 1;  4J6W A;  4RG8 A;  4C0F A;  3CME T;  3PTA A;  5C6S A;  3LH0 A;  2RH2 A;  3WVE B;  1WJS A;  3PIO A;  4F7U B;  4IUV A;  1NE8 A;  4XTZ A;  4C0G A;  2K3Y A;  3MET A;  4A4H A;  1VQ5 A;  4L5G A;  4M75 B;  4IUP A;  3JCM h;  4C8Q G;  2GQV A;  3OYB A;  2XID A;  1QW1 A;  3PIP A;  2WSF E;  4M75 A;  5CQX A;  3SFM A;  3JCM V;  5LJ5 d;  4JS4 A;  2LT1 A;  1I8F A;  2LNV A;  3VUZ A;  5GAN 7;  3OYD A;  2ZPI B;  2E41 A;  3QUI A;  4M7A G;  3CPW A;  5FRM A;  5CCA A;  4JLI A;  3CCU A;  2VYT A;  2DTH A;  5LJ3 g;  5LJ5 j;  2QEX A;  4JRQ A;  3CBM A;  1D3B A;  2CS7 A;  3URG A;  1VIE A;  3E1S A;  4PLL A;  3P8H A;  3OYA A;  5GAN j;  4BB7 A;  5IN1 A;  2F5T X;  2FHD A;  4N0A C;  5GMK l;  3CCE A;  2WSE E;  1VQ6 A;  4N4H A;  1BI3 A;  3JB9 I;  4OGE A;  1M9S A;  2CGH A;  5C0M A;  5KE3 A;  4BDZ A;  3CC4 A;  1LNX A;  3J7A F;  4C92 C;  3CBP A;  2XHC A;  5A0D A;  1K8A U;  1K9M C;  3MP8 A;  4XTV A;  3H6Z A;  4E7J A;  1Q7Y U;  3L2Z A;  2EFI A;  1QVG S;  5CVI A;  4KUD K;  3SWN A;  2ZZD A;  2Y4X A;  3GNG A;  3TRE A;  3E9F A;  4PJO A;  2RK1 A;  2LX9 A;  2NLU A;  4E7K A;  4MZM A;  4M7A D;  2D9T A;  4C8Q C;  2RM4 A;  3HRT A;  4QVD A;  4JLG A;  5GAN e;  2YRV A;  1O75 A;  1VQN T;  3X20 B;  3OA6 A;  3JCM g;  2E12 A;  5CIU A;  5M9O A;  4JS5 A;  2QA4 T;  3VKI A;  1K73 C;  1JBM A;  1ZQ1 A;  5GAM e;  1Q86 C;  2G3R A;  2VXF A;  4CRI A;  3MEA A;  2HBP A;  4PNO A;  5I2S A;  3QJY A;  3OB9 A;  5GMK m;  2GCX A;  4C5E A;  3A8G B;  2R5M A;  1M1K C;  5GAM f;  5FU7 B;  2MF2 A;  2LRQ A;  5IT9 E;  5KH6 A;  3DLM A;  1KHI A;  2CYZ B;  3FJP A;  3RKX A;  3JCM d;  1BI0 A;  3OYM A;  2MWP A;  2QTX A;  3I55 A;  5GMK i;  2E70 A;  3VV0 A;  1N6A A;  3C94 A;  3OW2 A;  4M77 E;  4PJO F;  1VQM T;  2OTJ T;  3QJ6 A;  2D0Q B;  5GAN 2;  2LC4 A;  5GAO l;  3MHX A;  2EQJ A;  1QVG A;  1UGR B;  1M1K U;  3QYH B;  4M7D B;  3G4S A;  3PT9 A;  2ZPF B;  3JCM b;  4ZTJ A;  2JZ2 A;  2E64 A;  4O5V A;  1OYX A;  2EJG A;  3MCA B;  3PFS A;  3WXM B;  3V7R A;  3C12 A;  4OB1 B;  2RJF A;  4J6Y A;  3A8M B;  1VIF A;  3S6W A;  2DK3 A;  3X25 B;  1N9R A;  3X26 B;  4OVA A;  4PJO D;  1VQ9 A;  2XDP A;  1FWZ A;  3CCR A;  4DQ2 A;  4Y91 A;  1BYM A;  1W2B A;  1VQN A;  1HXD A;  3QII A;  3I56 A;  4NOY A;  2H3J A;  2LQ8 A;  2XI9 A;  2LVM A;  3UT1 A;  4C8Q D;  4XTU A;  5J39 A;  3QSU A;  3SWN C;  3MO8 A;  1QVF A;  2P0Q A;  1YIT A;  4C92 F;  4RCB A;  2QXF A;  5LJ3 d;  3G6E T;  3CCE T;  2K4Y A;  4BUG A;  1XTD A;  4KT0 E;  3OS5 A;  1I81 A;  2E1H A;  2R5A A;  1VQP T;  3JB9 F;  2QQS A;  5A0G A;  3ER0 A;  3EAE A;  3S3M A;  1TH7 A;  4M7D G;  2RA2 A;  3X28 B;  1G3S A;  4HCZ A;  3RER A;  3JCM X;  3JCM f;  3NTH A;  1HK9 A;  5HKC A;  2RHU A;  1BIA A;  3M55 A;  4J5Y A;  2EWN A;  3OYI A;  2OTL T;  4EMH A;  5A0L A;  1PSE A;  3MEW A;  1NJI C;  4MDX A;  1YHQ A;  3LGF A;  1KC8 C;  1Q81 C;  5D6W A;  2VUB A;  4C92 B;  5GAM d;  4M78 E;  4A4G A;  3LWH A;  5DLQ E;  2R58 A;  2DAQ A;  4HCC A;  5GAN h;  4E7H A;  2L8D A;  2E5Q A;  1M8V A;  3LYI A;  1Y96 B;  5GAM j;  3JCM W;  1K73 U;  1UGS B;  4M77 G;  4LDW A;  2RHZ A;  3EFR A;  2DD4 A;  2CZ7 B;  4X9D A;  4MZT A;  5DY9 A;  3CMA T;  2ZPH B;  4M75 G;  4C8Q B;  1QP2 A;  4OMF B;  4BI3 A;  4LDV A;  5KCH A;  1GXI E;  2B8A A;  4A4K A;  1N27 A;  1YIT T;  2RD1 A;  3ZEH A;  1YI2 T;  1Y7X A;  4ZTF A;  3G6E A;  2MWO A;  4XU1 A;  4J83 A;  4M75 D;  3LX7 A;  4M78 B;  3QZ5 B;  2JOY A;  3G4S T;  1YHQ T;  4GY5 A;  2XD0 A;  4DA4 A;  4BI4 A;  2QQR A;  5GAO m;  5GAN g;  4QQG A;  3CCL A;  4EDU A;  3O8V A;  3HFN A;  3CD6 A;  3CXC S;  4EMK C;  2K5F A;  1VQ9 T;  4J7I A;  1I4K 1;  4HT8 A;  1VQO T;  1VQK A;  4M7D A;  3BFM A;  4M7D E;  2I2L A;  1KQ2 A;  3CCR T;  3T9N A;  3G71 A;  1SSF A;  2OTL A;  4ZN3 A;  2DIG A;  3QXE B;  4GLK A;  3CCU T;  2RJE A;  1O9S A;  3QZ9 B;  1M1G A;  3FRN A;  3GLX A;  1OI1 A;  4RMO A;  4RG2 A;  2IVW A;  4M7D C;  1U1T A;  3DB3 A;  1OZ2 A;  5LJ5 f;  5J3B A;  3QBY A;  3OS2 A;  2JVV A;  2JTM A;  1XQH A;  5FRN A;  4M78 F;  3V8J A;  3CC7 T;  3GIB A;  2X4X A;  2RJD A;  2EJ9 A;  3A8L B;  1QVF S;  3CCL T;  2X4W A;  3CXC A;  2DXU A;  2OAU A;  3CMA A;  4ZGJ B;  5DLO A;  3ZFJ A;  3RKY A;  1MGQ A;  3OYL A;  4D6W A;  4M7A E;  2KQW A;  3RMQ A;  1BI1 A;  3A8O B;  3OS1 A;  3TU4 K;  1D3B B;  5GAM h;  2A3L A;  2RHY A;  3SWN B;  1P92 A;  2M1H A;  1KQ1 A;  4BD3 A;  4XQ3 A;  4C8Q A;  5DM7 R;  3DLL A;  3HSB A;  2PQW A;  4M77 D;  4PJO C;  4PL6 A;  4IUQ A;  4A53 A;  1JB0 E;  3QPH A;  2E65 A;  1H64 1;  2YLC A;  3BDL A;  4LD6 A;  1VQ7 A;  3OY9 A;  4F7U E;  2DKG A;  4IUU A;  2A7Y A;  3L2Q A;  2P4T A;  4M75 E;  3FEO A;  5CAI A;  4P5N A;  2DVE A;  5GMK j;  3NTK A;  3PMT A;  3JAM E;  3M4Y A;  3L2U A;  4N0A A;  1YBY A;  2HQE A;  3L2R A;  4BE2 A;  2DXC A;  2R57 A;  2VGN A;  1RL2 A;  3KUF A;  3MP6 A;  4O6J A;  5CO7 A;  2FYK A;  4MMK A;  4XTX A;  4A4E A;  2XDD A;  1VQM A;  1VQL T;  3CD6 T;  1MHN A;  1UGP B;  2EKO A;  1Q82 U;  4HCB A;  1B34 B;  4LDY A;  2KK4 A;  4M7A A;  2O01 E;  4C5H A;  3M58 A;  4KUL A;  5GAN 8;  3G71 T;  4MDW A;  1G3W A;  4II1 A;  4X9C A;  4EMK A;  2CZ0 B;  2E6N A;  3P8D A;  4B9W A;  5I21 A;  3QKJ A;  2XIC A;  4E7I A;  1YJN A;  3TEE A;  3CPW S;  3Q1J A;  1VQ7 T;  4F7U G;  2FL7 A;  2EQM A;  3CEY A;  3L2W A;  2V8K A;  2MAM A;  1UEB A;  3M9Q A;  5GAM g;  1Q7Y C;  4XU3 A;  1YJW T;  1IRE B;  2K5L A;  4E7L A;  1KD1 C;  2RO0 A;  1WQ7 A;  2LCL A;  2KSS A;  1UGQ B;  2M0O A;  3JCM e;  3CME A;  3CC2 T;  3VYG A;  1EIF A;  1KG1 A;  5CQY A;  2FB7 A;  3I56 T;  2ZGW A;  1JJ2 S;  1WQW A;  4PKC C;  4ZGE B;  2BKD N;  5CR2 A;  3LLR A;  5FU7 C;  4J6X A;  1M4Z A;  3QO3 A;  5CKE A;  2KMT A;  2MMP A;  2V8I A;  2QEX T;  1Y07 A;  4R56 A;  3OW2 S;  3M56 A;  4ZN1 A;  2LT4 A;  3OYE A;  2VXE A;  1VQ4 T;  5CKB A;  2DXB A;  1WPY A;  1JJ2 A;  5CKH A;  5CK9 A;  4C92 G;  2C06 A;  1PSF A;  2QQ9 A;  1KC8 U;  3HHT B;  4JRI A;  1DJ7 B;  3F70 A;  4XU0 A;  1W4S A;  3V8K A;  3TCJ A;  3G7Z A;  4L6V 5;  4XTW A;  3JCM c;  3N5B B;  1YJW A;  3CCV T;  3QG1 A;  3S3O A;  4M77 A;  1Q82 C;  2X4J A;  2RHI A;  5LJ3 e;  2Y90 A;  3MEU A;  3H8Z A;  3CC2 A;  1X75 C;  4RKU E;  4M7A C;  4BY6 B;  3M59 A;  3OYC A;  4WF2 A;  5GAN 3;  3V7S A;  1YJ9 A;  4OB3 B;  4QW2 A;  4OP0 A;  3V8L A;  2PUK B;  4BDY A;  1Q86 U;  1M1F A;  2QA4 A;  2X4Y A;  2BUD A;  3GPL A;  3M53 A;  3QDR B;  2ZPG B;  5D6Y A;  3ZBD A;  2PUO B;  1NPP A;  3E9G A;  5CKD A;  5LL6 S;  2GFA A;  3HPW A;  2VV5 A;  2MI6 A;  5FU6 C;  4DOW A;  4DOV A;  5GAN 5;  4Y28 E;  2P0P A;  4XU2 A;  4M7D D;  4OB0 B;  1VQO A;  4EMG A;  2BIV A;  3CCM T;  1YI2 A;  2P0K A;  4JRK A;  2OTJ A;  4J7F A;  2HAX A;  1Y71 A;  3OYJ A;  1V29 B;  2DPP B;  1X6O A;  3CCQ T;  1YJ9 T;  1KQS A;  3JCM J;  5HK3 A;  3GOX A;  1QP3 A;  2VC8 A;  1G5V A;  4HT9 A;  4FIB A;  4FL6 A;  5J26 A;  2K57 A;  2LTO A;  1YJN T;  2F5K A;  3HL8 A;  2E6Z A;  3CCV A;  4ME7 A;  3C95 A;  5LJ5 h;  2QQA A;  3C4S A;  4FT2 A;  1QVP A;  3CBO A;  2DXT A;  4J8O A;  3CCJ T;  3OYF A;  2WSC E;  4XAX B;  4C5G A;  4F7U A;  5GAN d;  3VJP A;  2XG8 D;  3UWN A;  3CCS T;  3JCM Q;  3OYN A;  4IUR A;  2O4X A;  1OZ3 A;  4FSX A;  3JB9 J;  1FXX A;  2HNI A;  3JSC A;  3VUB A;  4FT4 A;  4OF1 A;  1YIJ T;  2DTO A;  1FX7 A;  3X24 B;  1M90 C;  2JNG A;  1WGS A;  3PMI A;  4N4G A;  1YCY A;  4F7U F;  2RHX A;  2CKK A;  3MP1 A;  4L59 A;  4E47 A;  3HRS A;  4C92 E;  3FC3 A;  2DIQ A;  3EFS A;  2KDS A;  3PGG A;  4KBM B;  4ZGD B;  3JB9 D;  5GAN f;  2ZPB B;  3SDZ A;  2L3R A;  2QQB A;  5A2Q E;  3JB9 G;  2PU9 B;  1VQP A;  1G3T A;  4M77 B;  3SB2 A;  5KE2 A;  1N8R U;  3LWI A;  4A54 A;  3RKW A;  3CPF A;  1VQ5 T;  2KY9 A;  3V7C A;  4QVC A;  3ME9 A;  4C0D B;  3JCM P;  1G3Y A;  4C5I A;  3VU3 C;  4EMK B;  4QQD A;  3AHU A;  5GAN 4;  2K5I A;  1M90 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...