2GQVA

High-resolution structure of a plasmid-encoded dihydrofolate reductase: pentagonal network of water molecules in the d2-symmetric active site
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
SNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of a plasmid-encoded dihydrofolate reductase: pentagonal network of water molecules in the D(2)-symmetric active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Dihydrofolate reductase type 2
total genus 12
structure length 59
sequence length 59
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2006-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gqvA00
2VV5A 2RK1A 2OAUA 2P4TA 3SFMA 3UDCA 2RH2A 3T9NA 1VIEA 2GQVA 1VIFA 2RK2A
chains in the Genus database with same CATH superfamily
4M75F 4E7IA 3QHSA 3MEUA 4KULA 3FDRA 3PVQA 1WHGA 3CCRA 2FPDA 1AWXA 2DL5A 2DTHA 2D6FA 4M78G 4XTWA 2E12A 1V1CA 4DOVA 3OYLA 3I56Q 1FWZA 5GAN6 2VASA 1NZ9A 2L89A 1S72Q 4M78D 3JAME 2E5KA 2RI5A 4JJDA 2XK0A 3CCJQ 3Q1JA 4M77A 3CCJA 1E6HA 2QEXA 1YJNA 2ZPGB 1KHIA 1OPKA 2CYZB 2CZ1B 1NYGA 4ANJA 1S72A 1YCSB 4J9HA 1TH7A 3RMSA 2MCNA 2L3SA 3CC7Q 2K3BA 4FYVB 4M78B 1BCOA 1M2VA 2YRDA 2OTLA 1R0BG 2HCKA 3M4GA 4MZMA 1TS9A 4J9EA 5KYYB 5IXFA 5GAN5 2PU9B 3GF5A 2FL7A 3EGDB 2DILA 3X25B 3KFVA 3P8HA 3E9GA 3UA7A 2PZ1A 3GNGA 4JLGA 1X69A 5GAMf 3JCMd 1WGSA 1PD1A 2O4XA 2FHDA 2EBPA 3QZ5B 3VS6A 4QVCA 3HFOA 2EYXA 5DY9A 2HBPA 3EGXB 3JB9J 1PCXA 3PT9A 4IUQA 3A1PA 2F2XA 2C06A 2XMFA 1UGVA 3R6NA 2ZPHB 4RKUE 4OMNA 5LJ5f 3QUIA 3CCMT 4LN2A 4RUGA 2LX7A 3VYHB 2ED1A 1RL2A 1WQWA 2O88A 4M7AD 1FXXA 1K9AA 2KT8A 1ZSGA 2JVVA 1QP2A 4QT7A 2NUPA 5LJ3h 1VQ4Q 3BE3A 2K3XA 4R56A 2RHIA 4DA4A 4J9CA 3G6EA 1MMDA 1SSHA 3SEMA 4IIMA 3MEWA 2V8JA 1M90U 3RESA 3I35A 4ESRA 4OB3B 1MV0B 4PKCC 1O9SA 4PJJA 3OYKA 3CCET 1X01A 1T3LA 3FLGA 2EKOA 2VGNA 2ZAEA 3KXTA 2GGRA 5A0DA 1NJIC 2A7YA 2RHXA 3SDZA 4JRIA 4OP0A 4ELZC 3CCUA 1M3AA 3VS4A 1IGUA 1M1FA 2CDTA 2VC8A 3REBB 1YJNT 3J80E 4JUVA 2O31A 2PQWA 2KSSA 4BDYA 1VQKQ 2L2PA 1VQ6T 4PFZA 1KQ2A 1RACB 4PFOA 3I55A 3GNFB 1X27A 2D0QB 2E1HA 3O8VA 4PLLA 1ZQ1A 4FSXA 4JZ3A 2FRYA 4HKEA 2A37A 2DD5A 5GAN2 1M1KU 5HK3A 3RIRA 4M77D 1ZA2B 2JT4A 5EC7A 4CI0C 4KUDK 1OV3A 2EQMA 3LLRA 4J6WA 1VQLT 2F5KA 3LGFA 4C92G 4JJBA 2DEUA 5DLOA 2CZ6B 2FPEA 5A0LA 2VB6A 2E5QA 2KDSA 3E2UA 2DXUA 3JCMX 3CBPA 3OYHA 3CXCP 2RI3A 3C12A 2EJFA 2JN0A 3BDLA 2PVOB 1UHFA 3PMIA 2EVRA 2KQWA 3RUXA 2W10A 4N0AA 4XU2A 1QVPA 3SB2A 1RAGB 2I0NA 2JS0A 1IO6A 2SEMA 3M57A 4D8DA 1M5Q1 2ECZA 1I1JA 1GCQC 2I2LA 5FU7C 2WACA 1AWWA 1Z9QA 2KR3A 1Y07A 4M7DB 2QTVA 1X2QA 2PUKB 4PJLA 2EPDA 1H92A 1MV3A 1VQKT 1WA7A 1VUBA 5LJ5h 3OYJA 4YTLA 4PJOE 1UDLA 3THKA 5I2MA 4C5GA 4DBHA 4F7UF 4J6XA 2X4XA 4B9WA 3TREA 2YSQA 4AFZC 2QQSA 1GCQA 2B86A 2MI6A 2MWOA 2JZ2A 1N5ZA 2RD1A 2EQUA 2KI7A 2HEQA 3RR6A 1G3YA 4AFSC 1W4SA 5LJ3e 3FJPA 1C1AA 1GRIA 2LCLA 3E19A 3HP9A 4K11A 1VQMT 1VQPT 4J6YA 3CC7T 1VQLQ 4J8OA 3CCMA 1KC8R 2MK5A 3QYHB 2AHJB 3AHUA 1WDXA 3OYCA 5LJ5g 5GAN3 2LT1A 1QQJA 4EMKB 3OS5A 1H3ZA 5FLXE 1KHCA 4OGEA 3PMTA 1WJSA 3RKYA 2E3IA 4RG8A 2AKLA 2KROA 2WSCE 1OZ3A 4PJMA 2EQKA 2F5TX 2C0IA 3VU3C 1QCOA 2KXCA 4A4KA 1VQ4T 3G4SQ 3GLXA 1WYXA 1MMAA 1R77A 1Q82U 1K73U 2O01E 1JJ2S 4MDXA 4PJOA 4QW2A 2YDLA 1QVGS 3VS0A 4X34A 3CPWP 2KRNA 1MMNA 3PFSA 2Y90A 3M59A 1QP3A 1M9SA 2X9HA 1UE9A 4M78E 4RTZA 2W0ZA 2KEAA 3JCMP 2RHUA 4PJOF 3LW5E 4J9IA 3VS3A 2E65A 2V1QA 1RAHB 2X35A 1U06A 1FYNA 2CH4A 4WTOB 3OS1A 4LDWA 2DLPA 2E70A 5KYWB 4NL2A 2FZKB 3P8BB 3ER0A 1VQPA 4C5EA 2CP6A 2ABLA 2AIRB 5D7UA 3EFOA 3WVDB 3BW1A 1AD5A 3D7SB 3CCLA 1QWEA 3FEOA 3TU4K 1VQ9A 3A8LB 1SSFA 5GAN7 1S1NA 2M51A 1WHHA 1ZSZB 3QO3A 4FL6A 3PIPA 1TXQA 1M1GA 2QI2A 3TVTA 3JCMc 4O5VA 4ZTFA 2J06A 1VIEA 2RMOA 3HL8A 3BDUA 1O75A 2CS7A 1SPKA 3A8MB 4IUTA 3L2ZA 2RJEA 2H3JA 1N9SA 4E7JA 4V2SA 3ZBDA 1FMKA 1WHLA 1I5OB 1Q86U 5LJ3f 2JTMA 3EFSA 4XAXB 2DPPB 1QVFP 3I5SA 1UHCA 2XU8A 2HD0A 1SRMA 2VXEA 1K4US 1WJQA 3QG1A 1PG5B 1YHQQ 4F14A 2LT4A 4DBQA 1VYTA 2DTOA 1G83A 1ZX6A 2JJ9A 4QQ6A 4BE0A 2Y4XA 4E7SA 4NL3A 2DYBA 1UB4A 2X3WD 1CKAA 3V7CA 1UGPB 2K57A 3UA6A 1XQHA 1D1AA 1QCNA 2QDLA 4M77C 4OF1A 5AT1B 2HBWA 3GIBA 1SRLA 4C8QD 2R5MA 2HQXA 1AZGB 2X3XD 3MEAA 1KQSS 2DK3A 2CT3A 2A28A 1D3BA 4EMGA 1HD3A 1Z9ZA 3FRNA 6AT1B 3EH2A 3X20B 2HNIA 3QZ9B 1NBEB 1PRLC 4CC2A 5CKFA 1Q81U 2M02A 3CCRT 4E7HA 1JB0E 1WXTA 3VV0A 4ME7A 1HK9A 2M16A 1Q7YR 2KGTA 2RJDA 3QKJA 5KCOA 3OYFA 2HQHA 1QVGP 4BACA 1K9MU 1YITA 1YJWT 3S3MA 1XNIA 3M0QA 2RA2A 3M9QA 3L2UA 3CD6T 4II1A 4C92B 1AVZC 1NM7A 4C0DB 1GBRA 2LQNA 2NWMA 3H9NA 4X9DA 5I22A 3JB9F 1VQ7Q 2DZCA 3OBWA 2RQUA 2G6FX 3FIFA 1W2BP 1LPLA 3CXCA 2QEXQ 4RCBA 3JB9D 4B9XA 4P5NA 2DVEA 1I81A 3JCMg 2CH4W 1GCPA 1BBZA 4FIBA 1PNJA 4LUDA 3VRZA 1ZBJA 4C0GA 3OYDA 2PTKA 3EG2A 2F1LA 3EG0A 2PNIA 4HT9A 4HVVA 5FW9A 3OYEA 1K76A 4FYWB 1K0SA 2D8HA 1VQ8A 1PKSA 2JMCA 4XU0A 2O4XB 5IN1A 1WHKA 2QQBA 4IKFA 4RTVA 5KYYA 4A54A 1JXMA 2IIMA 2K3YA 2ROTA 1CSKA 1TWBA 3CQTA 2CUDA 3EFRA 1G2BA 1N8RU 1HJDA 3CCUQ 1BI1A 1XOVA 1OQKA 1LJOA 2JOYA 2RN8A 2JTFA 1JEGA 5FU6B 1K8AC 1V76A 3L2RA 1NPRA 1VQ6Q 1RLQC 1YNZA 1J3TA 4M75E 1F1BB 5DLQE 1TTHB 3CCQT 3CXCS 1YITQ 2NUPB 4CC4B 2F2VA 1A0NB 1WXUA 3NPFA 3QDFA 2AT1B 3FB9A 3MJXA 2V8KA 2OI3A 1WJRA 3M56A 1LCKA 4M77B 1D09B 4C92E 1VQ5A 3CCVQ 4F7UA 1YP5A 4M78C 1HSQA 4JJNK 1OZ2A 2VGMA 1B7TA 1X43A 2DRMA 4M75B 5IH2A 3CCSA 3LH0A 4KUIA 3S3OA 1M2VB 3NMZC 1BIBA 2O9VA 2NLUA 2M1HA 1D3BB 1KQ1A 4BD3A 9ATCB 4KGZB 5J3BA 3EGDA 5L23A 4DQ2A 1IXDA 3PGGA 3PVLA 1U5SA 2DEQA 2DA9A 4JZ4A 4QQGA 1YWOA 2E6ZA 1RAAB 4M77G 2DIGA 4C0FA 3MP1A 2J05A 2OAWA 2RM4A 4NS5A 4C8QC 3HFNA 2GTJA 1B34B 3CMEA 2LZ6B 4XK8E 2RK2A 3A5ZB 3UWNA 1M90C 5GAOq 2WSFE 2EYYA 1I0CA 1AZEA 4J83A 3DB4A 2OTJQ 3URGA 2JXBA 2AK5A 1M1KC 1UGQB 3A98A 5GANj 1M4ZA 4L6V5 1OU9A 2DO3A 5D6XA 1Y96B 4JRKA 2AZSA 2A08A 1OU8A 3JSCA 1KQSA 4C92A 1ZBXA 3MHXA 4IURA 3OYIA 2K79A 4C5HA 5KYXA 4FW1A 3PIOA 4N4HA 2LNHB 3G1JA 5GANh 5GAOp 2R57A 3M53A 1JQQA 1N8RR 1NPPA 1NE8A 1YJ9A 5J26A 4BE2A 1K9MC 4LUEA 3CC4T 1OEBA 2XDBA 1EFNA 3I9QA 5GJWB 5GMKl 2LVMA 1VOMA 4FU6A 1Q95G 1Q81C 1ARKA 2CGHA 3OYBA 2EJGA 1Y57A 1VA7A 1VIFA 4DEXA 1YIJA 3OMCA 2OJ2A 3RBBB 2LCSA 5IHNA 5HKCA 1Y7XA 1VQ9Q 2M0OA 2C0OA 3CCQA 5GMKm 4F17A 1VQOT 1VQKA 5CQYA 4XTXA 2ZPEB 3EHRA 1ZHIA 1K8AU 2ZZDA 4RTWA 2RHZA 3SWNA 1VQ5T 1SKUB 4AMCA 1UGSB 2ENMA 4M7DF 2KNBB 2QAZA 3OA6A 2RO0A 1JXOA 4EMHA 3OBYA 3HKSA 1AWOA 3S3NA 4N0AC 4Z89A 1Q81R 3NTIA 2E6NA 1BCMA 2MYSA 3RERA 1EIFA 1YJ9T 3I55Q 2COWA 1HXDA 1UEBA 3GP8A 3QPHA 3CCLT 4M7DA 4BB7A 2CKKA 1K9MR 2CSQA 1M27C 3BFMA 1EX4A 1BYMA 3LGLA 2K6DA 5D6YA 2FZGB 4M7AF 2JW4A 4OMFB 4OMMA 3L2VA 5CKDA 1RAFB 4FM4B 4OGCA 1WHJA 1OPLA 2MIOA 4E7ZA 3CMEQ 3HHTB 1VQ4A 2PVDB 2FYKA 2D8JA 4JRPA 4WCIA 3CMAQ 1UG1A 3JCMQ 2X51A 1JRIA 1NLPC 2RPNA 5GANg 2KVQG 1QVGA 2LRQA 4E6RA 1G3TA 2EW3A 1KC8U 3CMAA 1ZA1B 4PJOG 2FZCB 2RJCA 1V29B 3V8JA 3VS1A 2LQWA 3EG9B 4DBRA 2LCCA 3BY7A 5M9OA 1QKWA 1UFFA 3MP6A 3X24B 3MO8A 3ZFJA 3OB9A 2HSPA 1KJWA 5GAMe 3CCUT 4XQ3A 2DJQA 1T0JA 4HCCA 4E47A 1I5LA 2YRCA 1W2BA 1UJYA 4PJOB 3ME9A 1D0ZA 2GF7A 2KRMA 4C0ZA 4JRQA 3L2WA 1RABB 1BI2A 1YIJT 1JU5C 3JCMW 2GFAA 5I11A 2D1XA 3CC2Q 5GAMh 2JM9A 3EFOB 5HCKA 1W6XA 1SHGA 2Y4YA 5LJ3g 4LE9A 2X4WA 5CKBA 1IHWA 1TUDA 2J7IA 2Z0WA 2QDYB 3QJ6A 2M9UA 5EG2A 2CSIA 2AKKA 4LDUA 2YWWA 1YBYA 2FB7A 4J9GA 1Q86C 2V26A 4EMKA 3HRTA 3WVEB 4O6JA 4MZPA 2P0QA 4RTTA 1VQ8Q 2VV5A 5KYUB 2G3RA 2XHCA 3G7ZA 1VQ7A 3V7RA 2CP3A 1P92A 1IREB 2E3HA 3M0RA 1FMWA 1JJ2A 1YI2A 5LJ3j 2QA4T 3UATA 4CRIA 1TUCA 4M7AA 5GAMg 3H8ZA 2SRCA 2C0TA 2M0YA 3CD6A 3QYGB 2QG9B 2DETA 1Y0MA 3QWYA 2YT6A 3E9FA 4E2FB 3R6OA 4M75G 3I56A 4XTVA 4KGXB 1T0HA 2DXTA 4C92D 1Q82R 2QTXA 4XU1A 2OAUA 3H0IA 1LVKA 4FW2A 2KXDA 2EIFA 1K1ZA 2HL5C 3JCMe 5KYWA 2GFUA 2LQ8A 1R8OB 4LDYA 3G71A 3DB3A 3LWIA 3NHNA 2QXFA 1X2KA 4M4ZA 2O2OA 2YUPA 3OYMA 2HAXA 2IG0A 2L3RA 4AFUC 4CC7A 3H6ZA 2XD0A 2GQVA 4C8QF 4OB0B 2L3QA 3OS0A 1PSFA 4PLIA 3VUZA 3N5BB 4HT8A 3TCJA 3TQ7P 2L5QA 1NLOC 4X9CA 1AHJB 1IB8A 1Q7YC 1KD1U 1W1FA 3CBMA 3EG9A 2NUTA 5LJ5e 1W70A 3L1AA 2DL8A 2CUBA 4EMKC 1GXIE 4IUPA 3CCSQ 3DLLA 1YHQA 3JCMV 2MPXC 1PSEA 2DL3A 3ZL7C 2D0NA 2LNVA 1RI0A 2RH2A 1SF9A 4J9DA 3CCVA 5L8RE 1IGQA 4PJOC 2FPFA 1QMCA 1IRXA 2FEIA 1OYXA 3C95A 3G71T 3QSUA 3MPUB 1MGQA 4E7LA 1E7OA 1QKXA 1SEMA 2LJ0A 1MUZA 4LDVA 4J5YA 4FYYB 1UUEA 3M5AA 3V8LA 3RKXA 1YI2T 4AG2C 2QA4A 1U1TA 2DAQA 1VQNA 1WPYA 2K9GA 2OX7A 5GJVB 3PNWC 2GQIA 4BI8B 4IIOA 1TSFA 1ZUKA 5GMKe 3JV3A 3H0HA 4X1VA 5FWBA 3CBOA 3UF4A 2L3PA 2H8HA 1QVFA 3OY9A 1QVFS 5GAN4 1ZLMA 4AT1B 3VUBA 2YLBA 2DNUA 3EG1A 2KYMA 2X4JA 2DE0X 4Y28E 1KFZA 3INZA 1G3SA 4FCYA 1AEYA 3CC2T 4BY6B 4AFQC 4M7DC 4HCKA 2DXCA 3LX7A 2LTOA 1RAEB 2J6OA 4M75D 1HYOA 3UT1A 2RI2A 4DEYA 2JMAA 4HVUA 5CQXA 3IQLA 1BI0A 4OB2B 1XTDA 3CCRQ 1R0CB 2F2WA 2LP5A 3OMGA 3G4ST 2DRKA 1MHNA 1YN8A 2IPOB 2FRWA 2ZCFB 2ZPIB 3QXEB 4JS5A 2MF2A 4LD6A 4M77F 4XTUA 2DD4A 4A4HA 4PJNA 4EDUA 3C0CA 2OTJA 4C5IA 4XTZA 3SWNC 1X6GA 3VRYA 3GBQA 4DBFA 4JLIA 1QW1A 4F7UB 1BIAA 3KBGA 1NEGA 4FT4A 3TSZA 4M75A 2EQJA 4FYXB 2LC4A 4KBMB 4EPCA 2DTIA 4HA8A 1M90R 4KT0E 2DL7A 4J7IA 2KK4A 2FVUA 2VKNA 2LMJA 2CP0A 1E6GA 1VQLA 2CT4A 1AT1B 3JB9H 3H41A 1GFCA 2R58A 4OVAA 1WIEA 2E64A 1B34A 1TUGB 2KY9A 2RNAA 1W2BS 2YLCA 3CPWA 3OSSC 1N8RC 1WLPB 1BK2A 1M3CA 1VQ9T 1Y96A 3G71Q 4TVRA 1WQ7A 2QGFB 2XIDA 1KK7A 3M0UA 2P84A 2YHTA 4OMPA 5GMKh 3OQ5A 4OMQA 1G5VA 2E10A 4MDWA 4C0DC 2RQRA 3U23A 4M77E 3HRUA 4C92C 3S6WA 3A8HB 1BKBA 4GY5A 3PE0A 4D6WA 4IUVA 2EQIA 2JUFA 4BY6C 5KCHA 2BE7D 5GAN8 3CCEA 2BZYA 2DXBA 2YUNA 2BZXA 3SHWA 3NFCA 4OMOA 2FO0A 4M78A 3JCMf 2DBKA 8ATCB 3C4SA 4ZTJA 2EFIA 2QYZA 2EGAA 4MMKA 4A63B 3O5ZA 4ATOA 1M2OA 5LL6S 4M7DE 5FRNA 3FJ5A 1T3SA 3ZEHA 2XKOC 1X6BA 3DKMA 3SWNB 2K7AA 3NTKA 1TG0A 3RMQA 2CP2A 3AT1B 2CP7A 1IHVA 3M0TA 2P4RA 5CAIA 1KQSP 4HCZA 3CCLQ 2OTJT 4HXJA 4R55A 1TU0B 2YUOA 5KYNA 3I55T 2CREA 3QJYA 1I4K1 5KYXB 1VQNQ 1K0XA 4PJOD 3JRZA 1ACMB 2P4TA 2ROLA 3QDRB 1Y71A 2DX1A 4KH1B 4JJCA 1OX8A 1Q7YU 1KD1C 3CC2A 5CR2A 1PC0A 1ABQA 2HKNA 3V7SA 2BTTA 2KMTA 5GANe 2EGEA 2K2VA 4Y91A 1C0MA 3VS7A 2PUOB 1PWTA 3OS2A 1LOJA 4KH0B 3CCEQ 3M0PA 4J9FA 1M8VA 2EWNA 5HY6A 3VS2A 3VYGA 3QWXX 3MEVA 4PFPA 5A2QE 4A4FA 3CMAT 2RQWA 2RK1A 3UPUA 2RB6A 1VYUA 2L8DA 1AOJA 3G4SA 1U8RA 4NOYA 2RJFA 3CEYA 2H3EB 2LQKA 1YITT 5GANd 1G8XA 3JB9I 3EGXA 1D1CA 2RQVA 3EHQA 1AWJA 1UTIA 1U1SA 2JS2A 4JPBW 2HQEA 4GBQA 1M3BA 3OYYA 2QGGA 3M55A 4RCCA 3CCMQ 3HTRA 1NJIR 2COYA 1PHTA 1RADB 3M54A 2X4YA 2KRSA 4BE1A 2QQ9A 2JNGA 3C94A 1EZZB 2P0PA 1YWPA 1ZSZC 5A0GA 2B8AA 3OW2A 5I21A 2DF6A 1X6OA 2ATCB 1SHFA 4ZGEB 1FMVA 1QCFA 4Z88A 3P8DA 5AYFA 5GAMd 2PVGB 1Q86R 1M8MA 5ECAA 1D0XA 4JDSA 2YRVA 2LJ1A 1OULA 7AT1B 4M7AC 1KD1R 1MNEA 3CC7A 2K5IA 4M7AE 2QQRA 1DJ7B 5GAOm 3LYIA 4C92F 3M58A 2A0FB 4F04B 2BE9B 1I07A 2DM1A 2QK0A 2VVKA 4XTYA 5LJ5d 2V1RA 4D8KA 3L2QA 1GFDA 2DJZA 1YI2Q 1U3OA 1S72T 4M7AB 2HKQB 3M4YA 2K5LA 3CCVT 4BDZA 2EYQA 2XDDA 3M0SA 2GBQA 4JS4A 1YJWQ 2YXYA 3EH1A 2E41A 1YCYA 2DERA 3CD6Q 4R0KA 1WNLA 4GLKA 2EAYA 4KGVB 2KAFA 5C6SA 1OI1A 4A4EA 4F7UE 5IHKA 1VQNT 1UJ0A 2GTOA 5I2SA 4F7UG 2LX9A 1YJ9Q 3CPFA 5IT9E 5FROA 1D0YA 1M30A 4IUUA 2XDPA 1MMGA 1JO8A 3TEEA 2ZPFB 1G3WA 5GAMj 2MOXA 4RTUA 2HZYA 4FT2A 1YJWA 3E1SA 5CKEA 3RKWA 3CC4A 4E7KA 1FX7A 1ZUYA 2BUDA 3X26B 1RI9A 1VQPQ 3JCMh 2HMAA 3CMET 4LD9K 3F70A 2QA4Q 3MP8A 1PRMC 3L42A 5KYUA 2ZPBB 4Z02A 1QWFA 3KUFA 2VWFA 2EGCA 3JCMJ 2DBMA 5FU7B 5D6WA 4HVWA 3QIIA 5FRMA 1JBMA 4F16A 2KE9A 3TSWA 3WXMB 1XJWB 2DZ9A 4A4GA 2RHYA 1X75C 1BU1A 5FWCA 2DVJA 2ESWA 5CVIA 1D1BA 2EYZA 3QBYA 2NUTB 1RUWA 1WXBA 5GAOl 3G6EQ 2A3LA 5IHIA 2VXFA 1B07A 4KRTA 1KC8C 3EAEA 4RG2A 4UC4A 1VQ5Q 3A8OB 3OYNA 3J7AF 2QASA 1MNDA 5DM7R 4HCBA 4WF2A 3I5RA 1LNXA 4Y92A 2EJ9A 2VUBA 1WZOA 4N4IA 3MCAB 3EG3A 2MAMA 2R5AA 1JJ2P 3A8GB 2E4HA 2DKGA 4XU3A 1VQOA 3ULRB 3OW2S 2KYBA 4M7DD 4LXCA 1QLYA 4AG1C 5KH6A 4ORZA 5KE2A 1KG1A 3OYGA 3LH5A 5IXBA 1H3HA 3VS5A 1KSWA 5GMKi 4J7FA 3UDCA 3EGUA 1VQMA 4VUBA 5LJ3d 1YIJQ 3X28B 5KE3A 2L0AA 1VQ7T 2O9SA 1WFWA 2VYTA 2CZ7B 2MMPA 1M1KR 4OMLA 4ZN3A 3DLMA 3V8KA 2ED0A 1WHMA 1BB9A 1UGRB 2P0KA 3META 1WX6A 3FC3A 4C8QA 2DMOA 2F69A 3GOXA 1OOTA 1CKBA 3CCQQ 5GANf 1SG5A 5CIUA 5LJ5j 2K4YA 4L5GA 4ZN1A 4LDXA 3GPLA 2HL3A 3VJPA 5CK9A 4FSSA 2OTLT 3HPWA 1K8AR 1K73R 4M75C 4QVDA 4MMLA 4ZNXA 4M78F 2FG0A 4GLMA 1N27A 1PM3A 1TOVA 5GAOn 2KT1A 1K73C 1ABOA 2HDAA 1H8KA 2J6KA 1NYFA 4OB1B 1VQOQ 2NYSA 4Z8AA 2EYWA 5J39A 2JM8A 2ZGWA 4BUGA 1C6VX 5FU6C 1VYVA 3OYAA 2WSEE 1VQMQ 2HSEB 1VQ8T 4ZGDB 4ELYC 4LNPA 1ZSZA 3MKDA 3NTHA 3RNJA 4A53A 4PNOA 2CP5A 2K5FA 2GCXA 5IAYA 5HK0A 3RDVA 1N9RA 5GMKj 3HSBA 5CO7A 3OW2P 3CCJT 2JTEA 4BI3A 2DFUA 1PD0A 3H0FA 3J81E 2IVWA 2LDMA 3VKIA 2BKDN 3LWHA 2BZ8A 5C0MA 1YHQT 3G6ET 4QVZA 1I8FA 1RLPC 5CCAA 3REAB 3PTAA 3ASKA 3JCMb 2BIVA 2GNCA 2RF0A 2A36A 5GAOr 3NGPA 1YFNA 2DL4A 3JB9G 4DOWA 1H641 4M7AG 1RAIB 2CZ0B 1PKTA 1NJIU 2DIQA 4ZGJB 3CCST 4N4GA 4Q5WA 2D9TA 1N6AA 1GBQA 4B6MA 1ZUUA 4M7DG 1Q82C 4QKUA 2LJ3A 2XI9A 1WI7A 3CPWS 8AT1B 4BI4A 2KBTA 3CC4Q 2MWPA 5CKHA 3SD4A 2K2MA 4C8QG 2QEXT 4MZTA 4RMOA 2QQAA 1UECA 4L59A 2XICA 4C8QE 1VQ6A 2NUZA 3I56T 1BI3A 4EIKA 2J6FA 2DYIA 4CC3A 2RQTA 1KIKA 4RTYA 2OTLQ 1GL5A 3HRSA 4J9BA 2AZVA 1NEBA 3SFMA 3T9NA 1NG2A 1OX9A 1IZ6A 2COZA 2EKHA 4RTXA 2XG8D 1YJNQ 3OSVA 4C8QB 4PL6A 2V8IA 2YUQA 4QQDA 4PK4A 1B3QA
chains in the Genus database with same CATH topology
1U1SA 2FB7A 1Q86C 2HQEA 4M75F 4EMKA 3HRTA 3V7CA 4E7IA 1UGPB 3OYYA 3QHSA 3M55A 3MEUA 4MZPA 2P0QA 2K57A 3FDRA 4KULA 1XQHA 2VV5A 4RCCA 4M77C 3CCRA 2G3RA 2XHCA 3G7ZA 3M54A 1VQ7A 2X4YA 4OF1A 3GIBA 3V7RA 2DTHA 1P92A 4C8QD 1IREB 4BE1A 2D6FA 4M78G 4XTWA 2E12A 2QQ9A 1JJ2A 2JNGA 3C94A 5LJ3j 4DOVA 1YI2A 2P0PA 3OYLA 2QA4T 1FWZA 5GAN6 2R5MA 2HQXA 4CRIA 4M7AA 5GAMg 1NZ9A 2L89A 3H8ZA 3MEAA 4M78D 3JAME 1KQSS 2RI5A 5A0GA 2DK3A 3CD6A 2XK0A 3QYGB 2B8AA 3OW2A 1D3BA 3Q1JA 4M77A 5I21A 4EMGA 3CCJA 1X6OA 2QEXA 1YJNA 2ZPGB 3FRNA 1KHIA 4ZGEB 2CYZB 2CZ1B 1S72A 3P8DA 5AYFA 3RMSA 1TH7A 3X20B 3E9FA 5GAMd 2PVGB 2HNIA 3R6OA 3QZ9B 4M75G 3I56A 4XTVA 4M78B 4JDSA 2OTLA 2YRVA 2DXTA 3M4GA 4MZMA 5CKFA 4C92D 1Q81U 2QTXA 4XU1A 3CCRT 1JB0E 5GAN5 2OAUA 4E7HA 4M7AC 3CC7A 3VV0A 2PU9B 3GF5A 2FL7A 4ME7A 1HK9A 2M16A 2K5IA 2EIFA 2RJDA 3QKJA 3P8HA 3X25B 5KCOA 3JCMe 3OYFA 2QQRA 2GFUA 3E9GA 4M7AE 3GNGA 4BACA 4JLGA 1K9MU 2LQ8A 1R8OB 5GAMf 1DJ7B 3JCMd 5GAOm 4LDYA 3G71A 3LYIA 4C92F 1YITA 3M58A 1XNIA 3S3MA 3DB3A 3LWIA 1YJWT 2QXFA 1WGSA 2RA2A 2O4XA 2FHDA 3QZ5B 3M9QA 4QVCA 3L2UA 3CD6T 3HFOA 5LJ5d 4II1A 4XTYA 4C92B 5DY9A 4C0DB 2HBPA 3L2QA 3OYMA 2HAXA 2DJZA 3JB9J 3PT9A 2IG0A 2L3RA 4IUQA 4X9DA 1S72T 4M7AB 3M4YA 2C06A 3H6ZA 2K5LA 2XD0A 3JB9F 2GQVA 2DZCA 2ZPHB 4RKUE 4C8QF 4OB0B 3CCVT 3OBWA 3OS0A 4BDZA 2EYQA 1PSFA 2XDDA 4PLIA 3FIFA 3VUZA 5LJ5f 3N5BB 4JS4A 4HT8A 3CXCA 3TCJA 3QUIA 3CCMT 2L5QA 4RCBA 3VYHB 3JB9D 4X9CA 1AHJB 4B9XA 2E41A 1YCYA 4P5NA 2DVEA 1I81A 1Q7YC 1KD1U 1RL2A 1WQWA 3JCMg 4M7AD 1FXXA 3CBMA 5LJ5e 1WNLA 4FIBA 3L1AA 4GLKA 2JVVA 2EAYA 5C6SA 2KAFA 1OI1A 1QP2A 4C0GA 4A4EA 3OYDA 5LJ3h 4F7UE 4EMKC 1GXIE 4HT9A 2K3XA 4IUPA 4R56A 1VQNT 3DLLA 2RHIA 4DA4A 5I2SA 1YHQA 3OYEA 3JCMV 4F7UG 3G6EA 2LX9A 3CPFA 1PSEA 5IT9E 1VQ8A 5FROA 4IUUA 2LNVA 1RI0A 2XDPA 2RH2A 3MEWA 2V8JA 4XU0A 2O4XB 5IN1A 1M90U 3RESA 3CCVA 2QQBA 4IKFA 4OB3B 3TEEA 2ZPFB 5L8RE 4PJOC 1G3WA 4PKCC 4A54A 1OYXA 3C95A 5GAMj 1O9SA 3G71T 3OYKA 3QSUA 2K3YA 4FT2A 1YJWA 1MGQA 3E1SA 4E7LA 5CKEA 3RKWA 3CCET 3CC4A 1X01A 4E7KA 1FX7A 3FLGA 2BUDA 2EKOA 3EFRA 3X26B 1N8RU 2VGNA 4LDVA 4J5YA 3JCMh 5A0DA 3KXTA 3CMET 3M5AA 1NJIC 4LD9K 3F70A 3V8LA 1BI1A 3RKXA 1YI2T 1XOVA 2A7YA 2QA4A 1U1TA 3MP8A 1LJOA 2JOYA 2DAQA 2RHXA 3L42A 3SDZA 1VQNA 1WPYA 2JTFA 2ZPBB 4JRIA 4OP0A 5FU6B 1K8AC 4ELZC 3PNWC 4Z02A 3CCUA 3KUFA 4BI8B 1NPRA 3L2RA 4M75E 3JCMJ 5GMKe 5FU7B 1M1FA 5DLQE 2VC8A 5D6WA 3CCQT 3CBOA 3CXCS 1YJNT 3J80E 4JUVA 3QIIA 5FRMA 1JBMA 2PQWA 3WXMB 2KSSA 1QVFA 2DZ9A 4BDYA 4A4GA 3OY9A 1QVFS 2RHYA 1VQ6T 1X75C 5GAN4 3FB9A 2V8KA 1KQ2A 1WJRA 3M56A 4M77B 5CVIA 3VUBA 4C92E 2YLBA 1VQ5A 3QBYA 4F7UA 3I55A 4M78C 3GNFB 4JJNK 1OZ2A 2VGMA 2X4JA 2D0QB 4M75B 3CCSA 2E1HA 3O8VA 4PLLA 1ZQ1A 3LH0A 4FSXA 4HKEA 2DD5A 5GAN2 5GAOl 4KUIA 4Y28E 5HK3A 1M1KU 2A3LA 3RIRA 2VXFA 3INZA 1G3SA 3S3OA 1KC8C 3EAEA 4RG2A 4BY6B 3CC2T 1BIBA 2NLUA 2M1HA 4UC4A 1KQ1A 1D3BB 3A8OB 4BD3A 4M77D 3OYNA 4M7DC 5J3BA 3J7AF 2DXCA 4DQ2A 3PGGA 5DM7R 3LX7A 2LTOA 4HCBA 4CI0C 2DEQA 4QQGA 4KUDK 4M75D 2E6ZA 2EQMA 4M77G 4WF2A 2DIGA 1LNXA 3LLRA 4J6WA 3UT1A 4C0FA 3MP1A 5GANj 2RI2A 1VQLT 2RM4A 2F5KA 2EJ9A 2VUBA 4NS5A 4C8QC 3LGFA 4C92G 3HFNA 1B34B 4N4IA 5CQXA 1BI0A 3MCAB 3CMEA 4OB2B 2MAMA 2RK2A 1XTDA 4XK8E 5DLOA 2R5AA 2CZ6B 3A5ZB 3UWNA 1M90C 3A8GB 3WVEB 2WSFE 5GAOq 5A0LA 2DKGA 2E5QA 2KDSA 4J83A 3DB4A 2DXUA 3JCMX 3CBPA 3OMGA 4XU3A 3URGA 3OYHA 1M1KC 2RI3A 3C12A 1UGQB 2EJFA 2JN0A 3BDLA 3G4ST 1M4ZA 2PVOB 4L6V5 3PMIA 2DO3A 2KQWA 3OW2S 1MHNA 1VQOA 5D6XA 3RUXA 1Y96B 4JRKA 4M7DD 2ZCFB 2ZPIB 3QXEB 4N0AA 3JSCA 2MF2A 4JS5A 1KQSA 4XU2A 4C92A 1QVPA 4LD6A 4M77F 3SB2A 1ZBXA 5KH6A 3MHXA 4IURA 4XTUA 3OYIA 5KE2A 3M57A 1KG1A 3OYGA 1M5Q1 2DD4A 4A4HA 4C5HA 2I2LA 3PIOA 5FU7C 4EDUA 2WACA 4N4HA 5GMKi 5GANh 4J7FA 3UDCA 2OTJA 5GAOp 2R57A 3M53A 4C5IA 1Y07A 1VQMA 4M7DB 4VUBA 5LJ3d 4XTZA 3SWNC 2PUKB 3X28B 5KE3A 1VQ7T 1NPPA 1NE8A 4JLIA 1YJ9A 1QW1A 4F7UB 2VYTA 5J26A 1VQKT 1BIAA 1VUBA 2CZ7B 2MMPA 4YTLA 5LJ5h 3OYJA 4PJOE 3KBGA 4FT4A 4ZN3A 4M75A 2EQJA 3DLMA 5I2MA 4C5GA 4BE2A 3V8KA 2LC4A 4KBMB 4F7UF 4EPCA 4J6XA 1K9MC 2DTIA 4HA8A 1UGRB 2P0KA 3CC4T 2XDBA 2X4XA 4B9WA 4KT0E 3META 3TREA 4J7IA 5GMKl 2LVMA 2KK4A 3FC3A 4C8QA 2FVUA 2QQSA 4FU6A 1Q81C 2F69A 2MI6A 3GOXA 2MWOA 2JZ2A 1VQLA 2RD1A 5CIUA 5GANf 5LJ5j 2K4YA 2EQUA 2CGHA 4L5GA 3JB9H 4ZN1A 4LDXA 3OYBA 2EJGA 1G3YA 3GPLA 1W4SA 5LJ3e 1VIFA 2R58A 4OVAA 3VJPA 5CK9A 3FJPA 1YIJA 2OTLT 2LCLA 3HPWA 3E19A 3OMCA 2E64A 3HP9A 4M75C 1B34A 1VQMT 1VQPT 4QVDA 5HKCA 2KY9A 1Y7XA 4MMLA 4J6YA 3CC7T 2M0OA 3CCQA 4J8OA 4M78F 3CCMA 2YLCA 5GMKm 1W2BS 1VQOT 3QYHB 2AHJB 1N27A 3AHUA 1VQKA 5GAOn 5CQYA 3CPWA 3OYCA 3OSSC 4XTXA 5LJ5g 5GAN3 2ZPEB 1N8RC 2LT1A 1ZHIA 4EMKB 3OS5A 1K8AU 2ZZDA 1H3ZA 2RHZA 3SWNA 1VQ9T 5FLXE 1K73C 1KHCA 1Y96A 4OGEA 1VQ5T 3PMTA 1WQ7A 4OB1B 1WJSA 4TVRA 3RKYA 4RG8A 2XIDA 1UGSB 4M7DF 2WSCE 1OZ3A 5J39A 2EQKA 2YHTA 3OA6A 2F5TX 2RO0A 4BUGA 2ZGWA 3VU3C 5GMKh 3OQ5A 4EMHA 3OBYA 4A4KA 1G5VA 1VQ4T 2E10A 3HKSA 5FU6C 3GLXA 4MDWA 3OYAA 3S3NA 4N0AC 2WSEE 4C0DC 1Q82U 4M77E 1VQ8T 3NTIA 2E6NA 3HRUA 4C92C 4ZGDB 3RERA 3S6WA 1K73U 1EIFA 2O01E 4ELYC 1YJ9T 1JJ2S 1HXDA 1UEBA 3GP8A 3A8HB 1BKBA 3NTHA 3QPHA 4GY5A 4A53A 3CCLT 4M7DA 4BB7A 4PNOA 4PJOA 4QW2A 4O6JA 4D6WA 1QVGS 4IUVA 4X34A 2K5FA 2CKKA 2JUFA 2GCXA 2Y90A 3M59A 3PFSA 5IAYA 5HK0A 4BY6C 5KCHA 1QP3A 1N9RA 3BFMA 5GMKj 3HSBA 5CO7A 5GAN8 3CCEA 1M9SA 2DXBA 1BYMA 4M78E 3LGLA 3NFCA 5D6YA 3CCJT 3JCMP 4M7AF 2RHUA 4BI3A 4M78A 4PJOF 3LW5E 3JCMf 2E65A 4OMFB 2X35A 3C4SA 3L2VA 5CKDA 4ZTJA 2EFIA 3J81E 2IVWA 4FM4B 3OS1A 4MMKA 2LDMA 3VKIA 2BKDN 4LDWA 3LWHA 4OGCA 5C0MA 2E70A 1YHQT 5LL6S 4ATOA 4M7DE 3G6ET 5FRNA 4NL2A 4QVZA 3HHTB 1I8FA 3ZEHA 1VQ4A 5CCAA 2PVDB 2FYKA 2XKOC 3P8BB 3ER0A 3PTAA 4C5EA 4JRPA 1VQPA 3DKMA 3ASKA 3SWNB 3NTKA 4MDXA 3JCMQ 3WVDB 3JCMb 3BW1A 3RMQA 2BIVA 3CCLA 1JRIA 5GANg 2KVQG 1QVGA 3FEOA 2LRQA 1G3TA 5GAOr 1KC8U 5CAIA 3CMAA 4PJOG 4HCZA 3TU4K 3A8LB 3JB9G 1VQ9A 1SSFA 2RJCA 1V29B 3V8JA 2OTJT 5GAN7 4R55A 4DOWA 3I55T 1H641 4M7AG 2CZ0B 1NJIU 3QJYA 1I4K1 2DIQA 2LCCA 4ZGJB 3QO3A 3CCST 3BY7A 4FL6A 4PJOD 4N4GA 4Q5WA 3PIPA 2D9TA 1N6AA 2QI2A 1M1GA 5M9OA 3JRZA 3JCMc 3MP6A 3X24B 2P4TA 3QDRB 4O5VA 1Y71A 3MO8A 4M7DG 4ZTFA 1Q7YU 1KD1C 3CC2A 1VIEA 3ZFJA 3OB9A 3HL8A 5CR2A 1Q82C 3BDUA 1O75A 2CS7A 3A8MB 5GAMe 3CCUT 4XQ3A 2XI9A 3V7SA 3CPWS 4IUTA 3L2ZA 2KMTA 4BI4A 4HCCA 4E47A 2RJEA 2H3JA 1N9SA 4E7JA 1I5LA 5GANe 2K2VA 4Y91A 4V2SA 3ZBDA 2MWPA 2PUOB 1W2BA 5CKHA 3SD4A 4C8QG 2QEXT 4PJOB 3OS2A 3ME9A 1Q86U 1LOJA 2GF7A 4MZTA 5LJ3f 2JTMA 4RMOA 3EFSA 4XAXB 4C0ZA 2DPPB 4JRQA 1M8VA 2EWNA 2QQAA 5HY6A 4L59A 2XICA 2XU8A 3VYGA 2HD0A 4C8QE 3MEVA 5A2QE 3L2WA 1VQ6A 4A4FA 2VXEA 3CMAT 1BI2A 1WJQA 3I56T 1BI3A 1YIJT 2RK1A 3JCMW 2GFAA 3UPUA 2RB6A 3QG1A 5GAMh 3HRSA 2LT4A 2L8DA 3SFMA 2Y4YA 3G4SA 5LJ3g 1U8RA 3T9NA 4NOYA 2RJFA 1IZ6A 2X4WA 5CKBA 3CEYA 2DTOA 2XG8D 1YITT 2LQKA 5GANd 3OSVA 4C8QB 2QDYB 4PL6A 4QQ6A 2V8IA 4BE0A 3JB9I 3QJ6A 2M9UA 4QQDA 2Y4XA 5EG2A 4LDUA 4NL3A 1YBYA 1UB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VV5 A;  2RK1 A;  2OAU A;  2P4T A;  3SFM A;  3UDC A;  2RH2 A;  3T9N A;  1VIE A;  2GQV A;  1VIF A;  2RK2 A; 
#chains in the Genus database with same CATH topology
 4M75 F;  4E7I A;  3QHS A;  3MEU A;  4KUL A;  3FDR A;  3PVQ A;  1WHG A;  3CCR A;  2FPD A;  1AWX A;  2DL5 A;  2DTH A;  2D6F A;  4M78 G;  4XTW A;  2E12 A;  1V1C A;  4DOV A;  3OYL A;  3I56 Q;  1FWZ A;  5GAN 6;  2VAS A;  1NZ9 A;  2L89 A;  1S72 Q;  4M78 D;  3JAM E;  2E5K A;  2RI5 A;  4JJD A;  2XK0 A;  3CCJ Q;  3Q1J A;  4M77 A;  3CCJ A;  1E6H A;  2QEX A;  1YJN A;  2ZPG B;  1KHI A;  1OPK A;  2CYZ B;  2CZ1 B;  1NYG A;  4ANJ A;  1S72 A;  1YCS B;  4J9H A;  1TH7 A;  3RMS A;  2MCN A;  2L3S A;  3CC7 Q;  2K3B A;  4FYV B;  4M78 B;  1BCO A;  1M2V A;  2YRD A;  2OTL A;  1R0B G;  2HCK A;  3M4G A;  4MZM A;  1TS9 A;  4J9E A;  5KYY B;  5IXF A;  5GAN 5;  2PU9 B;  3GF5 A;  2FL7 A;  3EGD B;  2DIL A;  3X25 B;  3KFV A;  3P8H A;  3E9G A;  3UA7 A;  2PZ1 A;  3GNG A;  4JLG A;  1X69 A;  5GAM f;  3JCM d;  1WGS A;  1PD1 A;  2O4X A;  2FHD A;  2EBP A;  3QZ5 B;  3VS6 A;  4QVC A;  3HFO A;  2EYX A;  5DY9 A;  2HBP A;  3EGX B;  3JB9 J;  1PCX A;  3PT9 A;  4IUQ A;  3A1P A;  2F2X A;  2C06 A;  2XMF A;  1UGV A;  3R6N A;  2ZPH B;  4RKU E;  4OMN A;  5LJ5 f;  3QUI A;  3CCM T;  4LN2 A;  4RUG A;  2LX7 A;  3VYH B;  2ED1 A;  1RL2 A;  1WQW A;  2O88 A;  4M7A D;  1FXX A;  1K9A A;  2KT8 A;  1ZSG A;  2JVV A;  1QP2 A;  4QT7 A;  2NUP A;  5LJ3 h;  1VQ4 Q;  3BE3 A;  2K3X A;  4R56 A;  2RHI A;  4DA4 A;  4J9C A;  3G6E A;  1MMD A;  1SSH A;  3SEM A;  4IIM A;  3MEW A;  2V8J A;  1M90 U;  3RES A;  3I35 A;  4ESR A;  4OB3 B;  1MV0 B;  4PKC C;  1O9S A;  4PJJ A;  3OYK A;  3CCE T;  1X01 A;  1T3L A;  3FLG A;  2EKO A;  2VGN A;  2ZAE A;  3KXT A;  2GGR A;  5A0D A;  1NJI C;  2A7Y A;  2RHX A;  3SDZ A;  4JRI A;  4OP0 A;  4ELZ C;  3CCU A;  1M3A A;  3VS4 A;  1IGU A;  1M1F A;  2CDT A;  2VC8 A;  3REB B;  1YJN T;  3J80 E;  4JUV A;  2O31 A;  2PQW A;  2KSS A;  4BDY A;  1VQK Q;  2L2P A;  1VQ6 T;  4PFZ A;  1KQ2 A;  1RAC B;  4PFO A;  3I55 A;  3GNF B;  1X27 A;  2D0Q B;  2E1H A;  3O8V A;  4PLL A;  1ZQ1 A;  4FSX A;  4JZ3 A;  2FRY A;  4HKE A;  2A37 A;  2DD5 A;  5GAN 2;  1M1K U;  5HK3 A;  3RIR A;  4M77 D;  1ZA2 B;  2JT4 A;  5EC7 A;  4CI0 C;  4KUD K;  1OV3 A;  2EQM A;  3LLR A;  4J6W A;  1VQL T;  2F5K A;  3LGF A;  4C92 G;  4JJB A;  2DEU A;  5DLO A;  2CZ6 B;  2FPE A;  5A0L A;  2VB6 A;  2E5Q A;  2KDS A;  3E2U A;  2DXU A;  3JCM X;  3CBP A;  3OYH A;  3CXC P;  2RI3 A;  3C12 A;  2EJF A;  2JN0 A;  3BDL A;  2PVO B;  1UHF A;  3PMI A;  2EVR A;  2KQW A;  3RUX A;  2W10 A;  4N0A A;  4XU2 A;  1QVP A;  3SB2 A;  1RAG B;  2I0N A;  2JS0 A;  1IO6 A;  2SEM A;  3M57 A;  4D8D A;  1M5Q 1;  2ECZ A;  1I1J A;  1GCQ C;  2I2L A;  5FU7 C;  2WAC A;  1AWW A;  1Z9Q A;  2KR3 A;  1Y07 A;  4M7D B;  2QTV A;  1X2Q A;  2PUK B;  4PJL A;  2EPD A;  1H92 A;  1MV3 A;  1VQK T;  1WA7 A;  1VUB A;  5LJ5 h;  3OYJ A;  4YTL A;  4PJO E;  1UDL A;  3THK A;  5I2M A;  4C5G A;  4DBH A;  4F7U F;  4J6X A;  2X4X A;  4B9W A;  3TRE A;  2YSQ A;  4AFZ C;  2QQS A;  1GCQ A;  2B86 A;  2MI6 A;  2MWO A;  2JZ2 A;  1N5Z A;  2RD1 A;  2EQU A;  2KI7 A;  2HEQ A;  3RR6 A;  1G3Y A;  4AFS C;  1W4S A;  5LJ3 e;  3FJP A;  1C1A A;  1GRI A;  2LCL A;  3E19 A;  3HP9 A;  4K11 A;  1VQM T;  1VQP T;  4J6Y A;  3CC7 T;  1VQL Q;  4J8O A;  3CCM A;  1KC8 R;  2MK5 A;  3QYH B;  2AHJ B;  3AHU A;  1WDX A;  3OYC A;  5LJ5 g;  5GAN 3;  2LT1 A;  1QQJ A;  4EMK B;  3OS5 A;  1H3Z A;  5FLX E;  1KHC A;  4OGE A;  3PMT A;  1WJS A;  3RKY A;  2E3I A;  4RG8 A;  2AKL A;  2KRO A;  2WSC E;  1OZ3 A;  4PJM A;  2EQK A;  2F5T X;  2C0I A;  3VU3 C;  1QCO A;  2KXC A;  4A4K A;  1VQ4 T;  3G4S Q;  3GLX A;  1WYX A;  1MMA A;  1R77 A;  1Q82 U;  1K73 U;  2O01 E;  1JJ2 S;  4MDX A;  4PJO A;  4QW2 A;  2YDL A;  1QVG S;  3VS0 A;  4X34 A;  3CPW P;  2KRN A;  1MMN A;  3PFS A;  2Y90 A;  3M59 A;  1QP3 A;  1M9S A;  2X9H A;  1UE9 A;  4M78 E;  4RTZ A;  2W0Z A;  2KEA A;  3JCM P;  2RHU A;  4PJO F;  3LW5 E;  4J9I A;  3VS3 A;  2E65 A;  2V1Q A;  1RAH B;  2X35 A;  1U06 A;  1FYN A;  2CH4 A;  4WTO B;  3OS1 A;  4LDW A;  2DLP A;  2E70 A;  5KYW B;  4NL2 A;  2FZK B;  3P8B B;  3ER0 A;  1VQP A;  4C5E A;  2CP6 A;  2ABL A;  2AIR B;  5D7U A;  3EFO A;  3WVD B;  3BW1 A;  1AD5 A;  3D7S B;  3CCL A;  1QWE A;  3FEO A;  3TU4 K;  1VQ9 A;  3A8L B;  1SSF A;  5GAN 7;  1S1N A;  2M51 A;  1WHH A;  1ZSZ B;  3QO3 A;  4FL6 A;  3PIP A;  1TXQ A;  1M1G A;  2QI2 A;  3TVT A;  3JCM c;  4O5V A;  4ZTF A;  2J06 A;  1VIE A;  2RMO A;  3HL8 A;  3BDU A;  1O75 A;  2CS7 A;  1SPK A;  3A8M B;  4IUT A;  3L2Z A;  2RJE A;  2H3J A;  1N9S A;  4E7J A;  4V2S A;  3ZBD A;  1FMK A;  1WHL A;  1I5O B;  1Q86 U;  5LJ3 f;  2JTM A;  3EFS A;  4XAX B;  2DPP B;  1QVF P;  3I5S A;  1UHC A;  2XU8 A;  2HD0 A;  1SRM A;  2VXE A;  1K4U S;  1WJQ A;  3QG1 A;  1PG5 B;  1YHQ Q;  4F14 A;  2LT4 A;  4DBQ A;  1VYT A;  2DTO A;  1G83 A;  1ZX6 A;  2JJ9 A;  4QQ6 A;  4BE0 A;  2Y4X A;  4E7S A;  4NL3 A;  2DYB A;  1UB4 A;  2X3W D;  1CKA A;  3V7C A;  1UGP B;  2K57 A;  3UA6 A;  1XQH A;  1D1A A;  1QCN A;  2QDL A;  4M77 C;  4OF1 A;  5AT1 B;  2HBW A;  3GIB A;  1SRL A;  4C8Q D;  2R5M A;  2HQX A;  1AZG B;  2X3X D;  3MEA A;  1KQS S;  2DK3 A;  2CT3 A;  2A28 A;  1D3B A;  4EMG A;  1HD3 A;  1Z9Z A;  3FRN A;  6AT1 B;  3EH2 A;  3X20 B;  2HNI A;  3QZ9 B;  1NBE B;  1PRL C;  4CC2 A;  5CKF A;  1Q81 U;  2M02 A;  3CCR T;  4E7H A;  1JB0 E;  1WXT A;  3VV0 A;  4ME7 A;  1HK9 A;  2M16 A;  1Q7Y R;  2KGT A;  2RJD A;  3QKJ A;  5KCO A;  3OYF A;  2HQH A;  1QVG P;  4BAC A;  1K9M U;  1YIT A;  1YJW T;  3S3M A;  1XNI A;  3M0Q A;  2RA2 A;  3M9Q A;  3L2U A;  3CD6 T;  4II1 A;  4C92 B;  1AVZ C;  1NM7 A;  4C0D B;  1GBR A;  2LQN A;  2NWM A;  3H9N A;  4X9D A;  5I22 A;  3JB9 F;  1VQ7 Q;  2DZC A;  3OBW A;  2RQU A;  2G6F X;  3FIF A;  1W2B P;  1LPL A;  3CXC A;  2QEX Q;  4RCB A;  3JB9 D;  4B9X A;  4P5N A;  2DVE A;  1I81 A;  3JCM g;  2CH4 W;  1GCP A;  1BBZ A;  4FIB A;  1PNJ A;  4LUD A;  3VRZ A;  1ZBJ A;  4C0G A;  3OYD A;  2PTK A;  3EG2 A;  2F1L A;  3EG0 A;  2PNI A;  4HT9 A;  4HVV A;  5FW9 A;  3OYE A;  1K76 A;  4FYW B;  1K0S A;  2D8H A;  1VQ8 A;  1PKS A;  2JMC A;  4XU0 A;  2O4X B;  5IN1 A;  1WHK A;  2QQB A;  4IKF A;  4RTV A;  5KYY A;  4A54 A;  1JXM A;  2IIM A;  2K3Y A;  2ROT A;  1CSK A;  1TWB A;  3CQT A;  2CUD A;  3EFR A;  1G2B A;  1N8R U;  1HJD A;  3CCU Q;  1BI1 A;  1XOV A;  1OQK A;  1LJO A;  2JOY A;  2RN8 A;  2JTF A;  1JEG A;  5FU6 B;  1K8A C;  1V76 A;  3L2R A;  1NPR A;  1VQ6 Q;  1RLQ C;  1YNZ A;  1J3T A;  4M75 E;  1F1B B;  5DLQ E;  1TTH B;  3CCQ T;  3CXC S;  1YIT Q;  2NUP B;  4CC4 B;  2F2V A;  1A0N B;  1WXU A;  3NPF A;  3QDF A;  2AT1 B;  3FB9 A;  3MJX A;  2V8K A;  2OI3 A;  1WJR A;  3M56 A;  1LCK A;  4M77 B;  1D09 B;  4C92 E;  1VQ5 A;  3CCV Q;  4F7U A;  1YP5 A;  4M78 C;  1HSQ A;  4JJN K;  1OZ2 A;  2VGM A;  1B7T A;  1X43 A;  2DRM A;  4M75 B;  5IH2 A;  3CCS A;  3LH0 A;  4KUI A;  3S3O A;  1M2V B;  3NMZ C;  1BIB A;  2O9V A;  2NLU A;  2M1H A;  1D3B B;  1KQ1 A;  4BD3 A;  9ATC B;  4KGZ B;  5J3B A;  3EGD A;  5L23 A;  4DQ2 A;  1IXD A;  3PGG A;  3PVL A;  1U5S A;  2DEQ A;  2DA9 A;  4JZ4 A;  4QQG A;  1YWO A;  2E6Z A;  1RAA B;  4M77 G;  2DIG A;  4C0F A;  3MP1 A;  2J05 A;  2OAW A;  2RM4 A;  4NS5 A;  4C8Q C;  3HFN A;  2GTJ A;  1B34 B;  3CME A;  2LZ6 B;  4XK8 E;  2RK2 A;  3A5Z B;  3UWN A;  1M90 C;  5GAO q;  2WSF E;  2EYY A;  1I0C A;  1AZE A;  4J83 A;  3DB4 A;  2OTJ Q;  3URG A;  2JXB A;  2AK5 A;  1M1K C;  1UGQ B;  3A98 A;  5GAN j;  1M4Z A;  4L6V 5;  1OU9 A;  2DO3 A;  5D6X A;  1Y96 B;  4JRK A;  2AZS A;  2A08 A;  1OU8 A;  3JSC A;  1KQS A;  4C92 A;  1ZBX A;  3MHX A;  4IUR A;  3OYI A;  2K79 A;  4C5H A;  5KYX A;  4FW1 A;  3PIO A;  4N4H A;  2LNH B;  3G1J A;  5GAN h;  5GAO p;  2R57 A;  3M53 A;  1JQQ A;  1N8R R;  1NPP A;  1NE8 A;  1YJ9 A;  5J26 A;  4BE2 A;  1K9M C;  4LUE A;  3CC4 T;  1OEB A;  2XDB A;  1EFN A;  3I9Q A;  5GJW B;  5GMK l;  2LVM A;  1VOM A;  4FU6 A;  1Q95 G;  1Q81 C;  1ARK A;  2CGH A;  3OYB A;  2EJG A;  1Y57 A;  1VA7 A;  1VIF A;  4DEX A;  1YIJ A;  3OMC A;  2OJ2 A;  3RBB B;  2LCS A;  5IHN A;  5HKC A;  1Y7X A;  1VQ9 Q;  2M0O A;  2C0O A;  3CCQ A;  5GMK m;  4F17 A;  1VQO T;  1VQK A;  5CQY A;  4XTX A;  2ZPE B;  3EHR A;  1ZHI A;  1K8A U;  2ZZD A;  4RTW A;  2RHZ A;  3SWN A;  1VQ5 T;  1SKU B;  4AMC A;  1UGS B;  2ENM A;  4M7D F;  2KNB B;  2QAZ A;  3OA6 A;  2RO0 A;  1JXO A;  4EMH A;  3OBY A;  3HKS A;  1AWO A;  3S3N A;  4N0A C;  4Z89 A;  1Q81 R;  3NTI A;  2E6N A;  1BCM A;  2MYS A;  3RER A;  1EIF A;  1YJ9 T;  3I55 Q;  2COW A;  1HXD A;  1UEB A;  3GP8 A;  3QPH A;  3CCL T;  4M7D A;  4BB7 A;  2CKK A;  1K9M R;  2CSQ A;  1M27 C;  3BFM A;  1EX4 A;  1BYM A;  3LGL A;  2K6D A;  5D6Y A;  2FZG B;  4M7A F;  2JW4 A;  4OMF B;  4OMM A;  3L2V A;  5CKD A;  1RAF B;  4FM4 B;  4OGC A;  1WHJ A;  1OPL A;  2MIO A;  4E7Z A;  3CME Q;  3HHT B;  1VQ4 A;  2PVD B;  2FYK A;  2D8J A;  4JRP A;  4WCI A;  3CMA Q;  1UG1 A;  3JCM Q;  2X51 A;  1JRI A;  1NLP C;  2RPN A;  5GAN g;  2KVQ G;  1QVG A;  2LRQ A;  4E6R A;  1G3T A;  2EW3 A;  1KC8 U;  3CMA A;  1ZA1 B;  4PJO G;  2FZC B;  2RJC A;  1V29 B;  3V8J A;  3VS1 A;  2LQW A;  3EG9 B;  4DBR A;  2LCC A;  3BY7 A;  5M9O A;  1QKW A;  1UFF A;  3MP6 A;  3X24 B;  3MO8 A;  3ZFJ A;  3OB9 A;  2HSP A;  1KJW A;  5GAM e;  3CCU T;  4XQ3 A;  2DJQ A;  1T0J A;  4HCC A;  4E47 A;  1I5L A;  2YRC A;  1W2B A;  1UJY A;  4PJO B;  3ME9 A;  1D0Z A;  2GF7 A;  2KRM A;  4C0Z A;  4JRQ A;  3L2W A;  1RAB B;  1BI2 A;  1YIJ T;  1JU5 C;  3JCM W;  2GFA A;  5I11 A;  2D1X A;  3CC2 Q;  5GAM h;  2JM9 A;  3EFO B;  5HCK A;  1W6X A;  1SHG A;  2Y4Y A;  5LJ3 g;  4LE9 A;  2X4W A;  5CKB A;  1IHW A;  1TUD A;  2J7I A;  2Z0W A;  2QDY B;  3QJ6 A;  2M9U A;  5EG2 A;  2CSI A;  2AKK A;  4LDU A;  2YWW A;  1YBY A;  2FB7 A;  4J9G A;  1Q86 C;  2V26 A;  4EMK A;  3HRT A;  3WVE B;  4O6J A;  4MZP A;  2P0Q A;  4RTT A;  1VQ8 Q;  2VV5 A;  5KYU B;  2G3R A;  2XHC A;  3G7Z A;  1VQ7 A;  3V7R A;  2CP3 A;  1P92 A;  1IRE B;  2E3H A;  3M0R A;  1FMW A;  1JJ2 A;  1YI2 A;  5LJ3 j;  2QA4 T;  3UAT A;  4CRI A;  1TUC A;  4M7A A;  5GAM g;  3H8Z A;  2SRC A;  2C0T A;  2M0Y A;  3CD6 A;  3QYG B;  2QG9 B;  2DET A;  1Y0M A;  3QWY A;  2YT6 A;  3E9F A;  4E2F B;  3R6O A;  4M75 G;  3I56 A;  4XTV A;  4KGX B;  1T0H A;  2DXT A;  4C92 D;  1Q82 R;  2QTX A;  4XU1 A;  2OAU A;  3H0I A;  1LVK A;  4FW2 A;  2KXD A;  2EIF A;  1K1Z A;  2HL5 C;  3JCM e;  5KYW A;  2GFU A;  2LQ8 A;  1R8O B;  4LDY A;  3G71 A;  3DB3 A;  3LWI A;  3NHN A;  2QXF A;  1X2K A;  4M4Z A;  2O2O A;  2YUP A;  3OYM A;  2HAX A;  2IG0 A;  2L3R A;  4AFU C;  4CC7 A;  3H6Z A;  2XD0 A;  2GQV A;  4C8Q F;  4OB0 B;  2L3Q A;  3OS0 A;  1PSF A;  4PLI A;  3VUZ A;  3N5B B;  4HT8 A;  3TCJ A;  3TQ7 P;  2L5Q A;  1NLO C;  4X9C A;  1AHJ B;  1IB8 A;  1Q7Y C;  1KD1 U;  1W1F A;  3CBM A;  3EG9 A;  2NUT A;  5LJ5 e;  1W70 A;  3L1A A;  2DL8 A;  2CUB A;  4EMK C;  1GXI E;  4IUP A;  3CCS Q;  3DLL A;  1YHQ A;  3JCM V;  2MPX C;  1PSE A;  2DL3 A;  3ZL7 C;  2D0N A;  2LNV A;  1RI0 A;  2RH2 A;  1SF9 A;  4J9D A;  3CCV A;  5L8R E;  1IGQ A;  4PJO C;  2FPF A;  1QMC A;  1IRX A;  2FEI A;  1OYX A;  3C95 A;  3G71 T;  3QSU A;  3MPU B;  1MGQ A;  4E7L A;  1E7O A;  1QKX A;  1SEM A;  2LJ0 A;  1MUZ A;  4LDV A;  4J5Y A;  4FYY B;  1UUE A;  3M5A A;  3V8L A;  3RKX A;  1YI2 T;  4AG2 C;  2QA4 A;  1U1T A;  2DAQ A;  1VQN A;  1WPY A;  2K9G A;  2OX7 A;  5GJV B;  3PNW C;  2GQI A;  4BI8 B;  4IIO A;  1TSF A;  1ZUK A;  5GMK e;  3JV3 A;  3H0H A;  4X1V A;  5FWB A;  3CBO A;  3UF4 A;  2L3P A;  2H8H A;  1QVF A;  3OY9 A;  1QVF S;  5GAN 4;  1ZLM A;  4AT1 B;  3VUB A;  2YLB A;  2DNU A;  3EG1 A;  2KYM A;  2X4J A;  2DE0 X;  4Y28 E;  1KFZ A;  3INZ A;  1G3S A;  4FCY A;  1AEY A;  3CC2 T;  4BY6 B;  4AFQ C;  4M7D C;  4HCK A;  2DXC A;  3LX7 A;  2LTO A;  1RAE B;  2J6O A;  4M75 D;  1HYO A;  3UT1 A;  2RI2 A;  4DEY A;  2JMA A;  4HVU A;  5CQX A;  3IQL A;  1BI0 A;  4OB2 B;  1XTD A;  3CCR Q;  1R0C B;  2F2W A;  2LP5 A;  3OMG A;  3G4S T;  2DRK A;  1MHN A;  1YN8 A;  2IPO B;  2FRW A;  2ZCF B;  2ZPI B;  3QXE B;  4JS5 A;  2MF2 A;  4LD6 A;  4M77 F;  4XTU A;  2DD4 A;  4A4H A;  4PJN A;  4EDU A;  3C0C A;  2OTJ A;  4C5I A;  4XTZ A;  3SWN C;  1X6G A;  3VRY A;  3GBQ A;  4DBF A;  4JLI A;  1QW1 A;  4F7U B;  1BIA A;  3KBG A;  1NEG A;  4FT4 A;  3TSZ A;  4M75 A;  2EQJ A;  4FYX B;  2LC4 A;  4KBM B;  4EPC A;  2DTI A;  4HA8 A;  1M90 R;  4KT0 E;  2DL7 A;  4J7I A;  2KK4 A;  2FVU A;  2VKN A;  2LMJ A;  2CP0 A;  1E6G A;  1VQL A;  2CT4 A;  1AT1 B;  3JB9 H;  3H41 A;  1GFC A;  2R58 A;  4OVA A;  1WIE A;  2E64 A;  1B34 A;  1TUG B;  2KY9 A;  2RNA A;  1W2B S;  2YLC A;  3CPW A;  3OSS C;  1N8R C;  1WLP B;  1BK2 A;  1M3C A;  1VQ9 T;  1Y96 A;  3G71 Q;  4TVR A;  1WQ7 A;  2QGF B;  2XID A;  1KK7 A;  3M0U A;  2P84 A;  2YHT A;  4OMP A;  5GMK h;  3OQ5 A;  4OMQ A;  1G5V A;  2E10 A;  4MDW A;  4C0D C;  2RQR A;  3U23 A;  4M77 E;  3HRU A;  4C92 C;  3S6W A;  3A8H B;  1BKB A;  4GY5 A;  3PE0 A;  4D6W A;  4IUV A;  2EQI A;  2JUF A;  4BY6 C;  5KCH A;  2BE7 D;  5GAN 8;  3CCE A;  2BZY A;  2DXB A;  2YUN A;  2BZX A;  3SHW A;  3NFC A;  4OMO A;  2FO0 A;  4M78 A;  3JCM f;  2DBK A;  8ATC B;  3C4S A;  4ZTJ A;  2EFI A;  2QYZ A;  2EGA A;  4MMK A;  4A63 B;  3O5Z A;  4ATO A;  1M2O A;  5LL6 S;  4M7D E;  5FRN A;  3FJ5 A;  1T3S A;  3ZEH A;  2XKO C;  1X6B A;  3DKM A;  3SWN B;  2K7A A;  3NTK A;  1TG0 A;  3RMQ A;  2CP2 A;  3AT1 B;  2CP7 A;  1IHV A;  3M0T A;  2P4R A;  5CAI A;  1KQS P;  4HCZ A;  3CCL Q;  2OTJ T;  4HXJ A;  4R55 A;  1TU0 B;  2YUO A;  5KYN A;  3I55 T;  2CRE A;  3QJY A;  1I4K 1;  5KYX B;  1VQN Q;  1K0X A;  4PJO D;  3JRZ A;  1ACM B;  2P4T A;  2ROL A;  3QDR B;  1Y71 A;  2DX1 A;  4KH1 B;  4JJC A;  1OX8 A;  1Q7Y U;  1KD1 C;  3CC2 A;  5CR2 A;  1PC0 A;  1ABQ A;  2HKN A;  3V7S A;  2BTT A;  2KMT A;  5GAN e;  2EGE A;  2K2V A;  4Y91 A;  1C0M A;  3VS7 A;  2PUO B;  1PWT A;  3OS2 A;  1LOJ A;  4KH0 B;  3CCE Q;  3M0P A;  4J9F A;  1M8V A;  2EWN A;  5HY6 A;  3VS2 A;  3VYG A;  3QWX X;  3MEV A;  4PFP A;  5A2Q E;  4A4F A;  3CMA T;  2RQW A;  2RK1 A;  3UPU A;  2RB6 A;  1VYU A;  2L8D A;  1AOJ A;  3G4S A;  1U8R A;  4NOY A;  2RJF A;  3CEY A;  2H3E B;  2LQK A;  1YIT T;  5GAN d;  1G8X A;  3JB9 I;  3EGX A;  1D1C A;  2RQV A;  3EHQ A;  1AWJ A;  1UTI A;  1U1S A;  2JS2 A;  4JPB W;  2HQE A;  4GBQ A;  1M3B A;  3OYY A;  2QGG A;  3M55 A;  4RCC A;  3CCM Q;  3HTR A;  1NJI R;  2COY A;  1PHT A;  1RAD B;  3M54 A;  2X4Y A;  2KRS A;  4BE1 A;  2QQ9 A;  2JNG A;  3C94 A;  1EZZ B;  2P0P A;  1YWP A;  1ZSZ C;  5A0G A;  2B8A A;  3OW2 A;  5I21 A;  2DF6 A;  1X6O A;  2ATC B;  1SHF A;  4ZGE B;  1FMV A;  1QCF A;  4Z88 A;  3P8D A;  5AYF A;  5GAM d;  2PVG B;  1Q86 R;  1M8M A;  5ECA A;  1D0X A;  4JDS A;  2YRV A;  2LJ1 A;  1OUL A;  7AT1 B;  4M7A C;  1KD1 R;  1MNE A;  3CC7 A;  2K5I A;  4M7A E;  2QQR A;  1DJ7 B;  5GAO m;  3LYI A;  4C92 F;  3M58 A;  2A0F B;  4F04 B;  2BE9 B;  1I07 A;  2DM1 A;  2QK0 A;  2VVK A;  4XTY A;  5LJ5 d;  2V1R A;  4D8K A;  3L2Q A;  1GFD A;  2DJZ A;  1YI2 Q;  1U3O A;  1S72 T;  4M7A B;  2HKQ B;  3M4Y A;  2K5L A;  3CCV T;  4BDZ A;  2EYQ A;  2XDD A;  3M0S A;  2GBQ A;  4JS4 A;  1YJW Q;  2YXY A;  3EH1 A;  2E41 A;  1YCY A;  2DER A;  3CD6 Q;  4R0K A;  1WNL A;  4GLK A;  2EAY A;  4KGV B;  2KAF A;  5C6S A;  1OI1 A;  4A4E A;  4F7U E;  5IHK A;  1VQN T;  1UJ0 A;  2GTO A;  5I2S A;  4F7U G;  2LX9 A;  1YJ9 Q;  3CPF A;  5IT9 E;  5FRO A;  1D0Y A;  1M30 A;  4IUU A;  2XDP A;  1MMG A;  1JO8 A;  3TEE A;  2ZPF B;  1G3W A;  5GAM j;  2MOX A;  4RTU A;  2HZY A;  4FT2 A;  1YJW A;  3E1S A;  5CKE A;  3RKW A;  3CC4 A;  4E7K A;  1FX7 A;  1ZUY A;  2BUD A;  3X26 B;  1RI9 A;  1VQP Q;  3JCM h;  2HMA A;  3CME T;  4LD9 K;  3F70 A;  2QA4 Q;  3MP8 A;  1PRM C;  3L42 A;  5KYU A;  2ZPB B;  4Z02 A;  1QWF A;  3KUF A;  2VWF A;  2EGC A;  3JCM J;  2DBM A;  5FU7 B;  5D6W A;  4HVW A;  3QII A;  5FRM A;  1JBM A;  4F16 A;  2KE9 A;  3TSW A;  3WXM B;  1XJW B;  2DZ9 A;  4A4G A;  2RHY A;  1X75 C;  1BU1 A;  5FWC A;  2DVJ A;  2ESW A;  5CVI A;  1D1B A;  2EYZ A;  3QBY A;  2NUT B;  1RUW A;  1WXB A;  5GAO l;  3G6E Q;  2A3L A;  5IHI A;  2VXF A;  1B07 A;  4KRT A;  1KC8 C;  3EAE A;  4RG2 A;  4UC4 A;  1VQ5 Q;  3A8O B;  3OYN A;  3J7A F;  2QAS A;  1MND A;  5DM7 R;  4HCB A;  4WF2 A;  3I5R A;  1LNX A;  4Y92 A;  2EJ9 A;  2VUB A;  1WZO A;  4N4I A;  3MCA B;  3EG3 A;  2MAM A;  2R5A A;  1JJ2 P;  3A8G B;  2E4H A;  2DKG A;  4XU3 A;  1VQO A;  3ULR B;  3OW2 S;  2KYB A;  4M7D D;  4LXC A;  1QLY A;  4AG1 C;  5KH6 A;  4ORZ A;  5KE2 A;  1KG1 A;  3OYG A;  3LH5 A;  5IXB A;  1H3H A;  3VS5 A;  1KSW A;  5GMK i;  4J7F A;  3UDC A;  3EGU A;  1VQM A;  4VUB A;  5LJ3 d;  1YIJ Q;  3X28 B;  5KE3 A;  2L0A A;  1VQ7 T;  2O9S A;  1WFW A;  2VYT A;  2CZ7 B;  2MMP A;  1M1K R;  4OML A;  4ZN3 A;  3DLM A;  3V8K A;  2ED0 A;  1WHM A;  1BB9 A;  1UGR B;  2P0K A;  3MET A;  1WX6 A;  3FC3 A;  4C8Q A;  2DMO A;  2F69 A;  3GOX A;  1OOT A;  1CKB A;  3CCQ Q;  5GAN f;  1SG5 A;  5CIU A;  5LJ5 j;  2K4Y A;  4L5G A;  4ZN1 A;  4LDX A;  3GPL A;  2HL3 A;  3VJP A;  5CK9 A;  4FSS A;  2OTL T;  3HPW A;  1K8A R;  1K73 R;  4M75 C;  4QVD A;  4MML A;  4ZNX A;  4M78 F;  2FG0 A;  4GLM A;  1N27 A;  1PM3 A;  1TOV A;  5GAO n;  2KT1 A;  1K73 C;  1ABO A;  2HDA A;  1H8K A;  2J6K A;  1NYF A;  4OB1 B;  1VQO Q;  2NYS A;  4Z8A A;  2EYW A;  5J39 A;  2JM8 A;  2ZGW A;  4BUG A;  1C6V X;  5FU6 C;  1VYV A;  3OYA A;  2WSE E;  1VQM Q;  2HSE B;  1VQ8 T;  4ZGD B;  4ELY C;  4LNP A;  1ZSZ A;  3MKD A;  3NTH A;  3RNJ A;  4A53 A;  4PNO A;  2CP5 A;  2K5F A;  2GCX A;  5IAY A;  5HK0 A;  3RDV A;  1N9R A;  5GMK j;  3HSB A;  5CO7 A;  3OW2 P;  3CCJ T;  2JTE A;  4BI3 A;  2DFU A;  1PD0 A;  3H0F A;  3J81 E;  2IVW A;  2LDM A;  3VKI A;  2BKD N;  3LWH A;  2BZ8 A;  5C0M A;  1YHQ T;  3G6E T;  4QVZ A;  1I8F A;  1RLP C;  5CCA A;  3REA B;  3PTA A;  3ASK A;  3JCM b;  2BIV A;  2GNC A;  2RF0 A;  2A36 A;  5GAO r;  3NGP A;  1YFN A;  2DL4 A;  3JB9 G;  4DOW A;  1H64 1;  4M7A G;  1RAI B;  2CZ0 B;  1PKT A;  1NJI U;  2DIQ A;  4ZGJ B;  3CCS T;  4N4G A;  4Q5W A;  2D9T A;  1N6A A;  1GBQ A;  4B6M A;  1ZUU A;  4M7D G;  1Q82 C;  4QKU A;  2LJ3 A;  2XI9 A;  1WI7 A;  3CPW S;  8AT1 B;  4BI4 A;  2KBT A;  3CC4 Q;  2MWP A;  5CKH A;  3SD4 A;  2K2M A;  4C8Q G;  2QEX T;  4MZT A;  4RMO A;  2QQA A;  1UEC A;  4L59 A;  2XIC A;  4C8Q E;  1VQ6 A;  2NUZ A;  3I56 T;  1BI3 A;  4EIK A;  2J6F A;  2DYI A;  4CC3 A;  2RQT A;  1KIK A;  4RTY A;  2OTL Q;  1GL5 A;  3HRS A;  4J9B A;  2AZV A;  1NEB A;  3SFM A;  3T9N A;  1NG2 A;  1OX9 A;  1IZ6 A;  2COZ A;  2EKH A;  4RTX A;  2XG8 D;  1YJN Q;  3OSV A;  4C8Q B;  4PL6 A;  2V8I A;  2YUQ A;  4QQD A;  4PK4 A;  1B3Q A; 
#chains in the Genus database with same CATH homology
 1U1S A;  2FB7 A;  1Q86 C;  2HQE A;  4M75 F;  4EMK A;  3HRT A;  3V7C A;  4E7I A;  1UGP B;  3OYY A;  3QHS A;  3M55 A;  3MEU A;  4MZP A;  2P0Q A;  2K57 A;  3FDR A;  4KUL A;  1XQH A;  2VV5 A;  4RCC A;  4M77 C;  3CCR A;  2G3R A;  2XHC A;  3G7Z A;  3M54 A;  1VQ7 A;  2X4Y A;  4OF1 A;  3GIB A;  3V7R A;  2DTH A;  1P92 A;  4C8Q D;  1IRE B;  4BE1 A;  2D6F A;  4M78 G;  4XTW A;  2E12 A;  2QQ9 A;  1JJ2 A;  2JNG A;  3C94 A;  5LJ3 j;  4DOV A;  1YI2 A;  2P0P A;  3OYL A;  2QA4 T;  1FWZ A;  5GAN 6;  2R5M A;  2HQX A;  4CRI A;  4M7A A;  5GAM g;  1NZ9 A;  2L89 A;  3H8Z A;  3MEA A;  4M78 D;  3JAM E;  1KQS S;  2RI5 A;  5A0G A;  2DK3 A;  3CD6 A;  2XK0 A;  3QYG B;  2B8A A;  3OW2 A;  1D3B A;  3Q1J A;  4M77 A;  5I21 A;  4EMG A;  3CCJ A;  1X6O A;  2QEX A;  1YJN A;  2ZPG B;  3FRN A;  1KHI A;  4ZGE B;  2CYZ B;  2CZ1 B;  1S72 A;  3P8D A;  5AYF A;  3RMS A;  1TH7 A;  3X20 B;  3E9F A;  5GAM d;  2PVG B;  2HNI A;  3R6O A;  3QZ9 B;  4M75 G;  3I56 A;  4XTV A;  4M78 B;  4JDS A;  2OTL A;  2YRV A;  2DXT A;  3M4G A;  4MZM A;  5CKF A;  4C92 D;  1Q81 U;  2QTX A;  4XU1 A;  3CCR T;  1JB0 E;  5GAN 5;  2OAU A;  4E7H A;  4M7A C;  3CC7 A;  3VV0 A;  2PU9 B;  3GF5 A;  2FL7 A;  4ME7 A;  1HK9 A;  2M16 A;  2K5I A;  2EIF A;  2RJD A;  3QKJ A;  3P8H A;  3X25 B;  5KCO A;  3JCM e;  3OYF A;  2QQR A;  2GFU A;  3E9G A;  4M7A E;  3GNG A;  4BAC A;  4JLG A;  1K9M U;  2LQ8 A;  1R8O B;  5GAM f;  1DJ7 B;  3JCM d;  5GAO m;  4LDY A;  3G71 A;  3LYI A;  4C92 F;  1YIT A;  3M58 A;  1XNI A;  3S3M A;  3DB3 A;  3LWI A;  1YJW T;  2QXF A;  1WGS A;  2RA2 A;  2O4X A;  2FHD A;  3QZ5 B;  3M9Q A;  4QVC A;  3L2U A;  3CD6 T;  3HFO A;  5LJ5 d;  4II1 A;  4XTY A;  4C92 B;  5DY9 A;  4C0D B;  2HBP A;  3L2Q A;  3OYM A;  2HAX A;  2DJZ A;  3JB9 J;  3PT9 A;  2IG0 A;  2L3R A;  4IUQ A;  4X9D A;  1S72 T;  4M7A B;  3M4Y A;  2C06 A;  3H6Z A;  2K5L A;  2XD0 A;  3JB9 F;  2GQV A;  2DZC A;  2ZPH B;  4RKU E;  4C8Q F;  4OB0 B;  3CCV T;  3OBW A;  3OS0 A;  4BDZ A;  2EYQ A;  1PSF A;  2XDD A;  4PLI A;  3FIF A;  3VUZ A;  5LJ5 f;  3N5B B;  4JS4 A;  4HT8 A;  3CXC A;  3TCJ A;  3QUI A;  3CCM T;  2L5Q A;  4RCB A;  3VYH B;  3JB9 D;  4X9C A;  1AHJ B;  4B9X A;  2E41 A;  1YCY A;  4P5N A;  2DVE A;  1I81 A;  1Q7Y C;  1KD1 U;  1RL2 A;  1WQW A;  3JCM g;  4M7A D;  1FXX A;  3CBM A;  5LJ5 e;  1WNL A;  4FIB A;  3L1A A;  4GLK A;  2JVV A;  2EAY A;  5C6S A;  2KAF A;  1OI1 A;  1QP2 A;  4C0G A;  4A4E A;  3OYD A;  5LJ3 h;  4F7U E;  4EMK C;  1GXI E;  4HT9 A;  2K3X A;  4IUP A;  4R56 A;  1VQN T;  3DLL A;  2RHI A;  4DA4 A;  5I2S A;  1YHQ A;  3OYE A;  3JCM V;  4F7U G;  3G6E A;  2LX9 A;  3CPF A;  1PSE A;  5IT9 E;  1VQ8 A;  5FRO A;  4IUU A;  2LNV A;  1RI0 A;  2XDP A;  2RH2 A;  3MEW A;  2V8J A;  4XU0 A;  2O4X B;  5IN1 A;  1M90 U;  3RES A;  3CCV A;  2QQB A;  4IKF A;  4OB3 B;  3TEE A;  2ZPF B;  5L8R E;  4PJO C;  1G3W A;  4PKC C;  4A54 A;  1OYX A;  3C95 A;  5GAM j;  1O9S A;  3G71 T;  3OYK A;  3QSU A;  2K3Y A;  4FT2 A;  1YJW A;  1MGQ A;  3E1S A;  4E7L A;  5CKE A;  3RKW A;  3CCE T;  3CC4 A;  1X01 A;  4E7K A;  1FX7 A;  3FLG A;  2BUD A;  2EKO A;  3EFR A;  3X26 B;  1N8R U;  2VGN A;  4LDV A;  4J5Y A;  3JCM h;  5A0D A;  3KXT A;  3CME T;  3M5A A;  1NJI C;  4LD9 K;  3F70 A;  3V8L A;  1BI1 A;  3RKX A;  1YI2 T;  1XOV A;  2A7Y A;  2QA4 A;  1U1T A;  3MP8 A;  1LJO A;  2JOY A;  2DAQ A;  2RHX A;  3L42 A;  3SDZ A;  1VQN A;  1WPY A;  2JTF A;  2ZPB B;  4JRI A;  4OP0 A;  5FU6 B;  1K8A C;  4ELZ C;  3PNW C;  4Z02 A;  3CCU A;  3KUF A;  4BI8 B;  1NPR A;  3L2R A;  4M75 E;  3JCM J;  5GMK e;  5FU7 B;  1M1F A;  5DLQ E;  2VC8 A;  5D6W A;  3CCQ T;  3CBO A;  3CXC S;  1YJN T;  3J80 E;  4JUV A;  3QII A;  5FRM A;  1JBM A;  2PQW A;  3WXM B;  2KSS A;  1QVF A;  2DZ9 A;  4BDY A;  4A4G A;  3OY9 A;  1QVF S;  2RHY A;  1VQ6 T;  1X75 C;  5GAN 4;  3FB9 A;  2V8K A;  1KQ2 A;  1WJR A;  3M56 A;  4M77 B;  5CVI A;  3VUB A;  4C92 E;  2YLB A;  1VQ5 A;  3QBY A;  4F7U A;  3I55 A;  4M78 C;  3GNF B;  4JJN K;  1OZ2 A;  2VGM A;  2X4J A;  2D0Q B;  4M75 B;  3CCS A;  2E1H A;  3O8V A;  4PLL A;  1ZQ1 A;  3LH0 A;  4FSX A;  4HKE A;  2DD5 A;  5GAN 2;  5GAO l;  4KUI A;  4Y28 E;  5HK3 A;  1M1K U;  2A3L A;  3RIR A;  2VXF A;  3INZ A;  1G3S A;  3S3O A;  1KC8 C;  3EAE A;  4RG2 A;  4BY6 B;  3CC2 T;  1BIB A;  2NLU A;  2M1H A;  4UC4 A;  1KQ1 A;  1D3B B;  3A8O B;  4BD3 A;  4M77 D;  3OYN A;  4M7D C;  5J3B A;  3J7A F;  2DXC A;  4DQ2 A;  3PGG A;  5DM7 R;  3LX7 A;  2LTO A;  4HCB A;  4CI0 C;  2DEQ A;  4QQG A;  4KUD K;  4M75 D;  2E6Z A;  2EQM A;  4M77 G;  4WF2 A;  2DIG A;  1LNX A;  3LLR A;  4J6W A;  3UT1 A;  4C0F A;  3MP1 A;  5GAN j;  2RI2 A;  1VQL T;  2RM4 A;  2F5K A;  2EJ9 A;  2VUB A;  4NS5 A;  4C8Q C;  3LGF A;  4C92 G;  3HFN A;  1B34 B;  4N4I A;  5CQX A;  1BI0 A;  3MCA B;  3CME A;  4OB2 B;  2MAM A;  2RK2 A;  1XTD A;  4XK8 E;  5DLO A;  2R5A A;  2CZ6 B;  3A5Z B;  3UWN A;  1M90 C;  3A8G B;  3WVE B;  2WSF E;  5GAO q;  5A0L A;  2DKG A;  2E5Q A;  2KDS A;  4J83 A;  3DB4 A;  2DXU A;  3JCM X;  3CBP A;  3OMG A;  4XU3 A;  3URG A;  3OYH A;  1M1K C;  2RI3 A;  3C12 A;  1UGQ B;  2EJF A;  2JN0 A;  3BDL A;  3G4S T;  1M4Z A;  2PVO B;  4L6V 5;  3PMI A;  2DO3 A;  2KQW A;  3OW2 S;  1MHN A;  1VQO A;  5D6X A;  3RUX A;  1Y96 B;  4JRK A;  4M7D D;  2ZCF B;  2ZPI B;  3QXE B;  4N0A A;  3JSC A;  2MF2 A;  4JS5 A;  1KQS A;  4XU2 A;  4C92 A;  1QVP A;  4LD6 A;  4M77 F;  3SB2 A;  1ZBX A;  5KH6 A;  3MHX A;  4IUR A;  4XTU A;  3OYI A;  5KE2 A;  3M57 A;  1KG1 A;  3OYG A;  1M5Q 1;  2DD4 A;  4A4H A;  4C5H A;  2I2L A;  3PIO A;  5FU7 C;  4EDU A;  2WAC A;  4N4H A;  5GMK i;  5GAN h;  4J7F A;  3UDC A;  2OTJ A;  5GAO p;  2R57 A;  3M53 A;  4C5I A;  1Y07 A;  1VQM A;  4M7D B;  4VUB A;  5LJ3 d;  4XTZ A;  3SWN C;  2PUK B;  3X28 B;  5KE3 A;  1VQ7 T;  1NPP A;  1NE8 A;  4JLI A;  1YJ9 A;  1QW1 A;  4F7U B;  2VYT A;  5J26 A;  1VQK T;  1BIA A;  1VUB A;  2CZ7 B;  2MMP A;  4YTL A;  5LJ5 h;  3OYJ A;  4PJO E;  3KBG A;  4FT4 A;  4ZN3 A;  4M75 A;  2EQJ A;  3DLM A;  5I2M A;  4C5G A;  4BE2 A;  3V8K A;  2LC4 A;  4KBM B;  4F7U F;  4EPC A;  4J6X A;  1K9M C;  2DTI A;  4HA8 A;  1UGR B;  2P0K A;  3CC4 T;  2XDB A;  2X4X A;  4B9W A;  4KT0 E;  3MET A;  3TRE A;  4J7I A;  5GMK l;  2LVM A;  2KK4 A;  3FC3 A;  4C8Q A;  2FVU A;  2QQS A;  4FU6 A;  1Q81 C;  2F69 A;  2MI6 A;  3GOX A;  2MWO A;  2JZ2 A;  1VQL A;  2RD1 A;  5CIU A;  5GAN f;  5LJ5 j;  2K4Y A;  2EQU A;  2CGH A;  4L5G A;  3JB9 H;  4ZN1 A;  4LDX A;  3OYB A;  2EJG A;  1G3Y A;  3GPL A;  1W4S A;  5LJ3 e;  1VIF A;  2R58 A;  4OVA A;  3VJP A;  5CK9 A;  3FJP A;  1YIJ A;  2OTL T;  2LCL A;  3HPW A;  3E19 A;  3OMC A;  2E64 A;  3HP9 A;  4M75 C;  1B34 A;  1VQM T;  1VQP T;  4QVD A;  5HKC A;  2KY9 A;  1Y7X A;  4MML A;  4J6Y A;  3CC7 T;  2M0O A;  3CCQ A;  4J8O A;  4M78 F;  3CCM A;  2YLC A;  5GMK m;  1W2B S;  1VQO T;  3QYH B;  2AHJ B;  1N27 A;  3AHU A;  1VQK A;  5GAO n;  5CQY A;  3CPW A;  3OYC A;  3OSS C;  4XTX A;  5LJ5 g;  5GAN 3;  2ZPE B;  1N8R C;  2LT1 A;  1ZHI A;  4EMK B;  3OS5 A;  1K8A U;  2ZZD A;  1H3Z A;  2RHZ A;  3SWN A;  1VQ9 T;  5FLX E;  1K73 C;  1KHC A;  1Y96 A;  4OGE A;  1VQ5 T;  3PMT A;  1WQ7 A;  4OB1 B;  1WJS A;  4TVR A;  3RKY A;  4RG8 A;  2XID A;  1UGS B;  4M7D F;  2WSC E;  1OZ3 A;  5J39 A;  2EQK A;  2YHT A;  3OA6 A;  2F5T X;  2RO0 A;  4BUG A;  2ZGW A;  3VU3 C;  5GMK h;  3OQ5 A;  4EMH A;  3OBY A;  4A4K A;  1G5V A;  1VQ4 T;  2E10 A;  3HKS A;  5FU6 C;  3GLX A;  4MDW A;  3OYA A;  3S3N A;  4N0A C;  2WSE E;  4C0D C;  1Q82 U;  4M77 E;  1VQ8 T;  3NTI A;  2E6N A;  3HRU A;  4C92 C;  4ZGD B;  3RER A;  3S6W A;  1K73 U;  1EIF A;  2O01 E;  4ELY C;  1YJ9 T;  1JJ2 S;  1HXD A;  1UEB A;  3GP8 A;  3A8H B;  1BKB A;  3NTH A;  3QPH A;  4GY5 A;  4A53 A;  3CCL T;  4M7D A;  4BB7 A;  4PNO A;  4PJO A;  4QW2 A;  4O6J A;  4D6W A;  1QVG S;  4IUV A;  4X34 A;  2K5F A;  2CKK A;  2JUF A;  2GCX A;  2Y90 A;  3M59 A;  3PFS A;  5IAY A;  5HK0 A;  4BY6 C;  5KCH A;  1QP3 A;  1N9R A;  3BFM A;  5GMK j;  3HSB A;  5CO7 A;  5GAN 8;  3CCE A;  1M9S A;  2DXB A;  1BYM A;  4M78 E;  3LGL A;  3NFC A;  5D6Y A;  3CCJ T;  3JCM P;  4M7A F;  2RHU A;  4BI3 A;  4M78 A;  4PJO F;  3LW5 E;  3JCM f;  2E65 A;  4OMF B;  2X35 A;  3C4S A;  3L2V A;  5CKD A;  4ZTJ A;  2EFI A;  3J81 E;  2IVW A;  4FM4 B;  3OS1 A;  4MMK A;  2LDM A;  3VKI A;  2BKD N;  4LDW A;  3LWH A;  4OGC A;  5C0M A;  2E70 A;  1YHQ T;  5LL6 S;  4ATO A;  4M7D E;  3G6E T;  5FRN A;  4NL2 A;  4QVZ A;  3HHT B;  1I8F A;  3ZEH A;  1VQ4 A;  5CCA A;  2PVD B;  2FYK A;  2XKO C;  3P8B B;  3ER0 A;  3PTA A;  4C5E A;  4JRP A;  1VQP A;  3DKM A;  3ASK A;  3SWN B;  3NTK A;  4MDX A;  3JCM Q;  3WVD B;  3JCM b;  3BW1 A;  3RMQ A;  2BIV A;  3CCL A;  1JRI A;  5GAN g;  2KVQ G;  1QVG A;  3FEO A;  2LRQ A;  1G3T A;  5GAO r;  1KC8 U;  5CAI A;  3CMA A;  4PJO G;  4HCZ A;  3TU4 K;  3A8L B;  3JB9 G;  1VQ9 A;  1SSF A;  2RJC A;  1V29 B;  3V8J A;  2OTJ T;  5GAN 7;  4R55 A;  4DOW A;  3I55 T;  1H64 1;  4M7A G;  2CZ0 B;  1NJI U;  3QJY A;  1I4K 1;  2DIQ A;  2LCC A;  4ZGJ B;  3QO3 A;  3CCS T;  3BY7 A;  4FL6 A;  4PJO D;  4N4G A;  4Q5W A;  3PIP A;  2D9T A;  1N6A A;  2QI2 A;  1M1G A;  5M9O A;  3JRZ A;  3JCM c;  3MP6 A;  3X24 B;  2P4T A;  3QDR B;  4O5V A;  1Y71 A;  3MO8 A;  4M7D G;  4ZTF A;  1Q7Y U;  1KD1 C;  3CC2 A;  1VIE A;  3ZFJ A;  3OB9 A;  3HL8 A;  5CR2 A;  1Q82 C;  3BDU A;  1O75 A;  2CS7 A;  3A8M B;  5GAM e;  3CCU T;  4XQ3 A;  2XI9 A;  3V7S A;  3CPW S;  4IUT A;  3L2Z A;  2KMT A;  4BI4 A;  4HCC A;  4E47 A;  2RJE A;  2H3J A;  1N9S A;  4E7J A;  1I5L A;  5GAN e;  2K2V A;  4Y91 A;  4V2S A;  3ZBD A;  2MWP A;  2PUO B;  1W2B A;  5CKH A;  3SD4 A;  4C8Q G;  2QEX T;  4PJO B;  3OS2 A;  3ME9 A;  1Q86 U;  1LOJ A;  2GF7 A;  4MZT A;  5LJ3 f;  2JTM A;  4RMO A;  3EFS A;  4XAX B;  4C0Z A;  2DPP B;  4JRQ A;  1M8V A;  2EWN A;  2QQA A;  5HY6 A;  4L59 A;  2XIC A;  2XU8 A;  3VYG A;  2HD0 A;  4C8Q E;  3MEV A;  5A2Q E;  3L2W A;  1VQ6 A;  4A4F A;  2VXE A;  3CMA T;  1BI2 A;  1WJQ A;  3I56 T;  1BI3 A;  1YIJ T;  2RK1 A;  3JCM W;  2GFA A;  3UPU A;  2RB6 A;  3QG1 A;  5GAM h;  3HRS A;  2LT4 A;  2L8D A;  3SFM A;  2Y4Y A;  3G4S A;  5LJ3 g;  1U8R A;  3T9N A;  4NOY A;  2RJF A;  1IZ6 A;  2X4W A;  5CKB A;  3CEY A;  2DTO A;  2XG8 D;  1YIT T;  2LQK A;  5GAN d;  3OSV A;  4C8Q B;  2QDY B;  4PL6 A;  4QQ6 A;  2V8I A;  4BE0 A;  3JB9 I;  3QJ6 A;  2M9U A;  4QQD A;  2Y4X A;  5EG2 A;  4LDU A;  4NL3 A;  1YBY A;  1UB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...