2GR8A

Hia 1022-1098
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
SKRADAGTASALAASQLPQATMPGKSMVAIAGSSYQGQNGLAIGVSRISDNGKVIIRLSGTTNSQGKTGVAAGVGYQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adhesin
publication title Structure of the outer membrane translocator domain of the Haemophilus influenzae Hia trimeric autotransporter.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Membrane protein
total genus 19
structure length 78
sequence length 78
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03895 YadA_anchor YadA-like membrane anchor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.30 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 GSPII I/J protein-like 2gr8A00
3CI0K 2GR8A 2LMEA 3EMOA 5BW0B 2RETA 3CFIA 2GR7A 3CI0I
chains in the Genus database with same CATH superfamily
3UA0A 3UY4A 3N8HA 3Q12A 3UK2A 2IECA 4MUJA 5BW0B 2G2SA 3HL6A 3IMEA 2A53A 3IVCA 1IHOA 3INNA 1MOPA 4MUGA 2X3FA 5G2FA 2I52A 4DDKA 4G5FA 4MUIA 2EJCA 5KWVA 4MULA 2A88A 3CFFL 4EFKA 3IOBA 3CFAL 4BHRA 3AG6A 3COWA 2A52A 1N2JA 3IVXA 3LE8A 4MQ6A 2OGFA 2GR7A 3ISJA 3IUBA 3Q10A 4G5YA 1N2HA 2A7XA 4FZJA 2G3DA 2GW4A 2A50A 3IOCA 4MUNA 3CFHL 1N2GA 4MUEA 1N2BA 3IOEA 1N2OA 4EF6A 3MUEA 3IODA 4DE5A 1N2IA 3IMCA 1UFVA 3AG5A 1N2EA 3COYA 4MUFA 2LMEA 3EMOA 3MXTA 3CFIA 1V8FA 3CI0K 3IVGA 2GR8A 2A86A 2A54A 4IXJA 2A56A 5HG0A 4DDHA 3IUEA 4MUHA 2RETA 3COZA 4DDMA 5EXCA 2A84A 2G5ZA 3COVA 3IMGA 3QTTA 4MUKA 3LF4A 2G16A 3CI0I
chains in the Genus database with same CATH topology
3CI0K 3CI0J 2GR8A 2LMEA 3EMOA 5BW0B 2RETA 3CFIA 2GR7A 3CI0I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CI0 K;  2GR8 A;  2LME A;  3EMO A;  5BW0 B;  2RET A;  3CFI A;  2GR7 A;  3CI0 I; 
#chains in the Genus database with same CATH topology
 3UA0 A;  3UY4 A;  3N8H A;  3Q12 A;  3UK2 A;  2IEC A;  4MUJ A;  5BW0 B;  2G2S A;  3HL6 A;  3IME A;  2A53 A;  3IVC A;  1IHO A;  3INN A;  1MOP A;  4MUG A;  2X3F A;  5G2F A;  2I52 A;  4DDK A;  4G5F A;  4MUI A;  2EJC A;  5KWV A;  4MUL A;  2A88 A;  3CFF L;  4EFK A;  3IOB A;  3CFA L;  4BHR A;  3AG6 A;  3COW A;  2A52 A;  1N2J A;  3IVX A;  3LE8 A;  4MQ6 A;  2OGF A;  2GR7 A;  3ISJ A;  3IUB A;  3Q10 A;  4G5Y A;  1N2H A;  2A7X A;  4FZJ A;  2G3D A;  2GW4 A;  2A50 A;  3IOC A;  4MUN A;  3CFH L;  1N2G A;  4MUE A;  1N2B A;  3IOE A;  1N2O A;  4EF6 A;  3MUE A;  3IOD A;  4DE5 A;  1N2I A;  3IMC A;  1UFV A;  3AG5 A;  1N2E A;  3COY A;  4MUF A;  2LME A;  3EMO A;  3MXT A;  3CFI A;  1V8F A;  3CI0 K;  3IVG A;  2GR8 A;  2A86 A;  2A54 A;  4IXJ A;  2A56 A;  5HG0 A;  4DDH A;  3IUE A;  4MUH A;  2RET A;  3COZ A;  4DDM A;  5EXC A;  2A84 A;  2G5Z A;  3COV A;  3IMG A;  3QTT A;  4MUK A;  3LF4 A;  2G16 A;  3CI0 I; 
#chains in the Genus database with same CATH homology
 3CI0 K;  3CI0 J;  2GR8 A;  2LME A;  3EMO A;  5BW0 B;  2RET A;  3CFI A;  2GR7 A;  3CI0 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...