2GRCA

1.5 a structure of bromodomain from human brg1 protein, a central atpase of swi/snf remodeling complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
121
structure length
121
Chain Sequence
b'EKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable global transcription activator SNF2L4
publication title Structural ramification for acetyl-lysine recognition by the bromodomain of human BRG1 protein, a central ATPase of the SWI/SNF remodeling complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 47
structure length 121
sequence length 121
ec nomenclature ec 3.6.1.-:
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2grcA00
3MQMA 5C7NA 4KV1A 5CUBA 4TZ8A 5TB6A 5CTLA 4MR5A 5EU1A 4IR5A 5HRXA 5I40A 4N4GA 2I8NA 4PCEA 5I29A 2DWWA 3U5KA 4NRCA 5D3RA 4QYLA 4UIYA 4A9MA 5FE9A 5G4RA 5I89A 4CURA 5D25A 4QR4A 3P1EA 4NUDA 3UVXA 4BJXA 4UIVA 5G4SA 2OSSA 5L96A 2D9EA 4XYAA 5A81A 4QBMA 5CQ6A 4HXLA 5DKCA 5FFWA 2MJVB 3P1FA 4UYDA 4NR8A 4LC2A 5L8TA 5FE4A 1N72A 5CU8A 4LR6A 5HQ5A 3Q2EA 5FG4A 5HQ6A 4QB3A 4QSUA 3U5PA 4CLBA 5DW1A 5HELA 5E73A 4UYGA 2FSAA 2DKWA 4MR6A 5D3SA 5DYXA 5E3GA 4UYEA 2DVRA 4UIUA 4Q0NA 5CS8A 3LQIA 5L99A 4KV4A 5E74A 4YYKA 4QEWA 3G0JA 4CFKA 5EK9A 3U5MA 3JVJA 5A5QA 3JVKA 4NS5A 2N9GA 5A82A 1E6IA 4TQNA 5F62A 4C67A 4HBXA 5D3PA 4IOQA 5CUCA 3RCWA 5CUDA 5E9VA 5F1HA 5CY9A 5A5PA 3ONIA 4Q0OA 5AD3A 4OGJA 5C8GA 2DVSA 5CFWA 4YAXA 5CGPA 3MB4A 1WUGA 4O74A 4PY6A 4A9FA 4XY9A 5LJ1A 5II2A 4UYFA 4KCXA 4BHWA 2DVQA 5I80A 4QSWA 5EICA 5FH8A 4Z1QA 4RVRA 5CQ4A 4QEVA 4A9LA 4ZC9A 5I1QA 4CUSA 4TS8A 3JVLA 4NYVA 5HCLA 5LKXA 1X0JA 4YADA 5ENFA 4QR5A 4YYDA 5ENBA 5EP7A 4YH4A 5E3DA 4UYHA 5AMEA 5CPEA 5EWHA 3JVMA 4TT4A 3UV2A 5HM0A 5BT4A 4O77A 4IOOA 4QR3A 5FDZA 4OGIA 5LKUA 5KTWA 2YW5A 3K2JA 5DFCA 5HFRA 3O33A 4LDFA 4A9OA 4XUBA 4O7AA 5F63A 5EPSA 2LSPB 3U5LA 4YYJA 5FH6A 2RNWA 5CUAA 4IORA 2RI7A 2YEKA 4MEOA 3SVFA 4QC3A 3DAIA 4QSQA 3P1CA 4N4IA 5DY7A 5KTXA 3LQJA 2YELA 5LVRA 4UIWA 5J0DA 2G4AA 4O76A 5LUUA 4HXKA 5FG5A 4QUUA 4LZ2A 5F1LA 4A9JA 4HXPA 3D7CA 3AADA 5CUEA 5E9IA 5C85A 4NXJA 5ENHA 3UV5A 4NR9A 5A85A 5I83A 4MEPA 4MEQA 5IIDA 4UYFB 2L84A 4C66A 4LYWA 5H1VA 3MUKA 4O71A 5D3LA 5HLSA 2R10A 5EM3A 5D3JA 4TT6A 5CZGA 5F36A 4QC1A 2F6NA 4CL9A 5IBNA 4DONA 4YK0A 3DWYA 4HBYA 3QZTA 5CQTA 4UITA 4LZRA 5CQ7A 4CUQA 4Z93A 4TU4A 1EQFA 5E7DA 4J0RA 2R0VA 5JI8A 5C4QA 5DW2A 5IGMA 4NR4A 4J1PA 5HJCA 3MB3A 3LXJA 3UW9A 4O78A 5FE8A 2E3KA 5DX4A 5II1A 3O35A 4UIZA 5EWDA 3IU6A 5H85A 5L97A 3LJWA 2RNYA 3O36A 4HXRA 4LYSA 5EPBA 5BT5A 5CP5A 5EWVA 4QUTA 4QNSA 5L8UA 5ENJA 3UV4A 5KU3A 1ZS5A 4ALGA 4NUCA 4TTEA 4XUAA 4Z6HA 2R0YA 5D7XA 5I7YA 4HXOA 5DYCA 5TCMA 3UVDA 5ENCA 4YBTA 5FBXA 4YYHA 4N4HA 3SVHA 2D82A 3UVWA 4YBSA 5CQ5A 4PCIA 4MR4A 2YYNA 4O72A 5IGLA 5EQ1A 1WUMA 4OUFA 5E9LA 4A9HA 4Z6IA 5AMFA 2DVVA 2F6JA 3U5OA 4YY4A 2RNXA 4GPJA 5IGNA 4O7EA 5A5RA 4CUPA 3I3JA 5ETBA 2OUOA 5F61A 5E9YA 4ALHA 4TT2A 4QEUA 5EVAA 1JSPB 5HEMA 4BW3A 5FE2A 5EISA 4O7FA 2H60A 2WP2A 4LYIA 5D3HA 5AD2A 4YC9A 5F5ZA 4Z1SA 4TZ2A 2YEMA 5LJ0A 3HMEA 4LRGA 4NR5A 4QSXA 5IGKA 3MXFA 4YYMA 4YY6A 3HMHA 4HBWA 2RO1A 3O37A 5FE0A 5EWCA 5KTUA 5FFVA 5C87A 1F68A 5D0CA 3NXBA 4X2IA 3IU5A 5CQ3A 5HENA 5E0RA 4YYNA 4MR3A 4N4FA 2GRCA 5LKZA 5FE3A 4CUTA 5LVQA 5KO4A 2L5EA 4F3IA 4O7BA 4WIVA 5LJ2A 2OO1A 5A83A 4NRBA 3FKMX 4ZQLA 4NYXA 5A7CA 4XY8A 5A5OA 4WHUA 4QY4A 4O75A 4J3IA 5D26A 2NXBA 4CFLA 4CUUA 4MENA 3ZYUA 5I7XA 4J0SA 4YABA 4QSPA 5E9MA 5EWWA 5FE1A 5CRZA 4HXMA 4A9NA 5F25A 4ZW1A 5H1TA 5EGUA 5FG6A 4Y03A 4IR4A 5FB0A 5F2PA 4IR6A 4IR3A 5D24A 5DKHA 5D3NA 4LZSA 5DYUA 5CQ8A 2L85A 3U5NA 5A5SA 4NUEA 5ENIA 5FFYA 2E7NA 3QZSA 2YQDA 5L98A 2R0SA 5CUGA 5I86A 5JWMA 4QZSA 5FB1A 5EV9A 5HRVA 5HRWA 4YYIA 4E96A 4TYLA 5IG6A 5KHMA 5DFBA 4NRAA 5HQ7A 3HMFA 5LKTA 3QZVA 3O34A 5H1UA 5FE6A 5F3AA 4A9IA 4NR7A 4QSTA 4BW2A 3G0LA 5COIA 2YDWA 2WP1A 4BW4A 2KTBB 5CQAA 3S92A 5DKDA 5F60A 5DFDA 5ACYA 4YBMA 4HXSA 5FH7A 5A5NA 1JM4B 4NQNA 5HFQA 4QSSA 4WHWA 3MULA 2RS9B 4A9KA 5EPRA 2I7KA 4BW1A 3P1DA 5DBMA 5ENGA 3UVYA 2DATA 5DYAA 4NR6A 4UIXA 3AQAA 4AKNA 5BT3A 3S91A 3U5JA 4PTBA 5FE7A 5ETDA 4FLPA 2RFJA 3LQHA 4PKLA 4QSRA 5D3TA 4NYWA 3TLPA 4YYGA 4QYDA 4QSVA 5E9KA 3GG3A 3SVGA 3P5OA 4YATA 4HXNA 5ENEA 4N3WA 5DLZA 4O7CA 5CRMA 5FE5A 2E7OA 5DLXA 5EA1A 5K29A 4TU6A 4A9EA 4HBVA 5EI4A 4O70A 4NQMA 3Q2FA 4PS5A 5I88A 5C89A 4YH3A
chains in the Genus database with same CATH superfamily
3MQMA 5C7NA 4KV1A 5CUBA 4TZ8A 5TB6A 5CTLA 4MR5A 5EU1A 4IR5A 5HRXA 5I40A 4N4GA 2I8NA 4PCEA 5I29A 2DWWA 3U5KA 4NRCA 5D3RA 4QYLA 4UIYA 4A9MA 5FE9A 5G4RA 5I89A 4CURA 5D25A 4QR4A 3P1EA 4NUDA 3UVXA 4BJXA 4UIVA 5G4SA 2OSSA 5L96A 2D9EA 4XYAA 5A81A 4QBMA 5CQ6A 4HXLA 5DKCA 5FFWA 2MJVB 3P1FA 4UYDA 2EJNA 4LC2A 4NR8A 5L8TA 5FE4A 1N72A 5CU8A 4LR6A 5HQ5A 3Q2EA 5FG4A 5HQ6A 4QB3A 4QSUA 3U5PA 4CLBA 5DW1A 5HELA 5E73A 4UYGA 2FSAA 2DKWA 4MR6A 5D3SA 5DYXA 4AKIA 5E3GA 4UYEA 2DVRA 4UIUA 4Q0NA 5CS8A 3LQIA 5L99A 4KV4A 5E74A 4YYKA 4QEWA 3G0JA 4CFKA 5EK9A 3U5MA 3JVJA 5A5QA 3JVKA 4NS5A 2N9GA 5A82A 1E6IA 4TQNA 5F62A 4C67A 4HBXA 5D3PA 3ERRA 4IOQA 5CUCA 3RCWA 5CUDA 5E9VA 5F1HA 5CY9A 5A5PA 3ONIA 4Q0OA 5AD3A 4OGJA 5C8GA 2DVSA 5CFWA 4YAXA 5CGPA 3MB4A 1WUGA 4O74A 4PY6A 4A9FA 4XY9A 5LJ1A 5II2A 4UYFA 4KCXA 4BHWA 2DVQA 5I80A 4QSWA 5EICA 5FH8A 4Z1QA 4RVRA 5CQ4A 4QEVA 4A9LA 4ZC9A 5I1QA 4CUSA 4TS8A 3JVLA 4NYVA 5HCLA 5LKXA 1X0JA 4YADA 5ENFA 4QR5A 4YYDA 5ENBA 5EP7A 4YH4A 5E3DA 4UYHA 5AMEA 5CPEA 5EWHA 3JVMA 4TT4A 3UV2A 5HM0A 4AKGA 5BT4A 4O77A 4IOOA 4QR3A 5FDZA 4OGIA 5LKUA 5KTWA 2YW5A 3K2JA 5DFCA 5HFRA 3O33A 4LDFA 4A9OA 4XUBA 4O7AA 5F63A 5EPSA 2LSPB 3U5LA 4YYJA 5FH6A 2RNWA 5CUAA 4IORA 2RI7A 2YEKA 4MEOA 3SVFA 4QC3A 3DAIA 4QSQA 3P1CA 4N4IA 5DY7A 5KTXA 3LQJA 2YELA 5LVRA 4UIWA 5J0DA 2G4AA 4O76A 5LUUA 4HXKA 5FG5A 4QUUA 4LZ2A 5F1LA 4A9JA 4HXPA 3D7CA 3AADA 5CUEA 5E9IA 5C85A 4NXJA 5ENHA 3UV5A 4NR9A 5A85A 5I83A 4MEPA 4MEQA 5IIDA 4UYFB 2L84A 4C66A 4LYWA 5H1VA 3MUKA 4O71A 5D3LA 5HLSA 2R10A 5EM3A 5D3JA 4TT6A 5CZGA 5F36A 4QC1A 2F6NA 4CL9A 5IBNA 4DONA 4AI6A 4YK0A 3DWYA 3D1BA 4HBYA 3QZTA 5CQTA 4UITA 4LZRA 5CQ7A 4CUQA 4Z93A 4TU4A 1EQFA 5E7DA 4J0RA 2R0VA 5JI8A 5C4QA 5DW2A 5IGMA 4NR4A 4J1PA 5HJCA 3MB3A 3LXJA 3UW9A 4O78A 5FE8A 2E3KA 5DX4A 5II1A 3O35A 4UIZA 5EWDA 3IU6A 5H85A 5L97A 3LJWA 2RNYA 3O36A 4HXRA 4LYSA 5EPBA 5BT5A 5CP5A 5EWVA 4QUTA 4QNSA 5L8UA 5ENJA 3UV4A 5KU3A 1ZS5A 4ALGA 4NUCA 4TTEA 4XUAA 4Z6HA 2R0YA 5D7XA 5I7YA 4HXOA 5DYCA 5TCMA 3UVDA 5ENCA 4YBTA 5FBXA 4YYHA 4N4HA 3SVHA 2D82A 3UVWA 4YBSA 5CQ5A 4PCIA 4MR4A 2YYNA 4O72A 5IGLA 5EQ1A 1WUMA 4OUFA 5E9LA 4A9HA 4Z6IA 5AMFA 2DVVA 2F6JA 3U5OA 4YY4A 2RNXA 4GPJA 5IGNA 4O7EA 5A5RA 4CUPA 3I3JA 5ETBA 2OUOA 5F61A 5E9YA 4ALHA 4TT2A 4QEUA 5EVAA 1JSPB 5HEMA 4BW3A 5FE2A 5EISA 4O7FA 2H60A 2WP2A 4LYIA 5D3HA 5AD2A 4YC9A 5F5ZA 4Z1SA 4TZ2A 2YEMA 5LJ0A 3HMEA 4LRGA 4NR5A 4QSXA 5IGKA 3MXFA 4YYMA 4YY6A 3HMHA 4HBWA 2RO1A 3O37A 5FE0A 5EWCA 5KTUA 5FFVA 5C87A 1F68A 5D0CA 3NXBA 4X2IA 3IU5A 5CQ3A 5HENA 5E0RA 4YYNA 4MR3A 4N4FA 2GRCA 5LKZA 5FE3A 4CUTA 5LVQA 5KO4A 2L5EA 4F3IA 4O7BA 4WIVA 5LJ2A 2OO1A 5A83A 4NRBA 3FKMX 4ZQLA 4NYXA 5A7CA 4XY8A 5A5OA 4WHUA 4QY4A 4O75A 4J3IA 5D26A 2NXBA 4CFLA 4CUUA 4MENA 1PUOA 3ZYUA 5I7XA 4J0SA 4YABA 4AKHA 4QSPA 5E9MA 5EWWA 5FE1A 5CRZA 4HXMA 4A9NA 5F25A 4ZW1A 5H1TA 5EGUA 5FG6A 4Y03A 4IR4A 5FB0A 5F2PA 4IR6A 4IR3A 5D24A 5DKHA 5D3NA 4LZSA 5DYUA 5CQ8A 2L85A 3U5NA 5A5SA 4NUEA 5ENIA 5FFYA 2E7NA 3QZSA 2YQDA 5L98A 2R0SA 5CUGA 5I86A 5JWMA 4QZSA 5FB1A 5EV9A 5HRVA 5HRWA 4YYIA 4E96A 4TYLA 5IG6A 5KHMA 5DFBA 4NRAA 5HQ7A 3HMFA 5LKTA 3QZVA 3O34A 5H1UA 5FE6A 5F3AA 4A9IA 4NR7A 4QSTA 4BW2A 3G0LA 5COIA 3VKHA 2YDWA 2WP1A 4BW4A 2KTBB 5CQAA 3S92A 5DKDA 5F60A 5DFDA 5ACYA 4YBMA 4HXSA 5FH7A 5A5NA 1JM4B 4NQNA 5HFQA 4QSSA 4WHWA 3MULA 2RS9B 4A9KA 5EPRA 2I7KA 4BW1A 3P1DA 5DBMA 5ENGA 3UVYA 2DATA 5DYAA 4NR6A 4UIXA 3AQAA 4AKNA 5BT3A 3D1DA 3S91A 3U5JA 4PTBA 5FE7A 5ETDA 4FLPA 1ZKRA 2RFJA 3LQHA 4PKLA 4QSRA 5D3TA 4NYWA 3TLPA 4YYGA 4QYDA 4QSVA 5E9KA 3GG3A 3SVGA 3P5OA 4YATA 3VKGA 4HXNA 5ENEA 4N3WA 5DLZA 4O7CA 5CRMA 5FE5A 2E7OA 5DLXA 5EA1A 5K29A 4TU6A 4A9EA 4HBVA 5EI4A 4O70A 4NQMA 3Q2FA 4PS5A 5I88A 5C89A 4YH3A
chains in the Genus database with same CATH topology
3MQMA 5C7NA 4KV1A 5CUBA 4TZ8A 5TB6A 5CTLA 4MR5A 5EU1A 4IR5A 5HRXA 5I40A 4N4GA 2I8NA 4PCEA 5I29A 2DWWA 3U5KA 4NRCA 5D3RA 4QYLA 4UIYA 4A9MA 5FE9A 5G4RA 5I89A 4CURA 5D25A 4QR4A 3P1EA 4NUDA 3UVXA 4BJXA 4UIVA 5G4SA 2OSSA 5L96A 2D9EA 4XYAA 5A81A 4QBMA 5CQ6A 4HXLA 5DKCA 5FFWA 2MJVB 3P1FA 4UYDA 4NR8A 4LC2A 5L8TA 5FE4A 1N72A 5CU8A 4LR6A 5HQ5A 3Q2EA 5FG4A 5HQ6A 4QB3A 4QSUA 3U5PA 4CLBA 5DW1A 5HELA 5E73A 4UYGA 2FSAA 2DKWA 4MR6A 5D3SA 5DYXA 5E3GA 4UYEA 2DVRA 4UIUA 4Q0NA 5CS8A 3LQIA 5L99A 4KV4A 5E74A 4YYKA 4QEWA 3G0JA 4CFKA 5EK9A 3U5MA 3JVJA 5A5QA 3JVKA 4NS5A 2N9GA 5A82A 1E6IA 4TQNA 5F62A 4C67A 4HBXA 5D3PA 4IOQA 5CUCA 3RCWA 5CUDA 5E9VA 5F1HA 5CY9A 5A5PA 3ONIA 4Q0OA 5AD3A 4OGJA 5C8GA 2DVSA 5CFWA 4YAXA 5CGPA 3MB4A 1WUGA 4O74A 4PY6A 4A9FA 4XY9A 5LJ1A 5II2A 4UYFA 4KCXA 4BHWA 2DVQA 5I80A 4QSWA 5EICA 5FH8A 4Z1QA 4RVRA 5CQ4A 4QEVA 4A9LA 4ZC9A 5I1QA 4CUSA 4TS8A 3JVLA 4NYVA 5HCLA 5LKXA 1X0JA 4YADA 5ENFA 4QR5A 4YYDA 5ENBA 5EP7A 4YH4A 5E3DA 4UYHA 5AMEA 5CPEA 5EWHA 3JVMA 4TT4A 3UV2A 5HM0A 5BT4A 4O77A 4IOOA 4QR3A 5FDZA 4OGIA 5LKUA 5KTWA 2YW5A 3K2JA 5DFCA 5HFRA 3O33A 4LDFA 4A9OA 4XUBA 4O7AA 5F63A 5EPSA 2LSPB 3U5LA 4YYJA 5FH6A 2RNWA 5CUAA 4IORA 2RI7A 2YEKA 4MEOA 3SVFA 4QC3A 3DAIA 4QSQA 3P1CA 4N4IA 5DY7A 5KTXA 3LQJA 2YELA 5LVRA 4UIWA 5J0DA 2G4AA 4O76A 5LUUA 4HXKA 5FG5A 4QUUA 4LZ2A 5F1LA 4A9JA 4HXPA 3D7CA 3AADA 5CUEA 5E9IA 5C85A 4NXJA 5ENHA 3UV5A 4NR9A 5A85A 5I83A 4MEPA 4MEQA 5IIDA 4UYFB 2L84A 4C66A 4LYWA 5H1VA 3MUKA 4O71A 5D3LA 5HLSA 2R10A 5EM3A 5D3JA 4TT6A 5CZGA 5F36A 4QC1A 2F6NA 4CL9A 5IBNA 4DONA 4YK0A 3DWYA 4HBYA 3QZTA 5CQTA 4UITA 4LZRA 5CQ7A 4CUQA 4Z93A 4TU4A 1EQFA 5E7DA 4J0RA 2R0VA 5JI8A 5C4QA 5DW2A 5IGMA 4NR4A 4J1PA 5HJCA 3MB3A 3LXJA 3UW9A 4O78A 5FE8A 2E3KA 5DX4A 5II1A 3O35A 4UIZA 5EWDA 3IU6A 5H85A 5L97A 3LJWA 2RNYA 3O36A 4HXRA 4LYSA 5EPBA 5BT5A 5CP5A 5EWVA 4QUTA 4QNSA 5L8UA 5ENJA 3UV4A 5KU3A 1ZS5A 4ALGA 4NUCA 4TTEA 4XUAA 4Z6HA 2R0YA 5D7XA 5I7YA 4HXOA 5DYCA 5TCMA 3UVDA 5ENCA 4YBTA 5FBXA 4YYHA 4N4HA 3SVHA 2D82A 3UVWA 4YBSA 5CQ5A 4PCIA 4MR4A 2YYNA 4O72A 5IGLA 5EQ1A 1WUMA 4OUFA 5E9LA 4A9HA 4Z6IA 5AMFA 2DVVA 2F6JA 3U5OA 4YY4A 2RNXA 4GPJA 5IGNA 4O7EA 5A5RA 4CUPA 3I3JA 5ETBA 2OUOA 5F61A 5E9YA 4ALHA 4TT2A 4QEUA 5EVAA 1JSPB 5HEMA 4BW3A 5FE2A 5EISA 4O7FA 2H60A 2WP2A 4LYIA 5D3HA 5AD2A 4YC9A 5F5ZA 4Z1SA 4TZ2A 2YEMA 5LJ0A 3HMEA 4LRGA 4NR5A 4QSXA 5IGKA 3MXFA 4YYMA 4YY6A 3HMHA 4HBWA 2RO1A 3O37A 5FE0A 5EWCA 5KTUA 5FFVA 5C87A 1F68A 5D0CA 3NXBA 4X2IA 3IU5A 5CQ3A 5HENA 5E0RA 4YYNA 4MR3A 4N4FA 2GRCA 5LKZA 5FE3A 4CUTA 5LVQA 5KO4A 2L5EA 4F3IA 4O7BA 4WIVA 5LJ2A 2OO1A 5A83A 4NRBA 3FKMX 4ZQLA 4NYXA 5A7CA 4XY8A 5A5OA 4WHUA 4QY4A 4O75A 4J3IA 5D26A 2NXBA 4CFLA 4CUUA 4MENA 3ZYUA 5I7XA 4J0SA 4YABA 4QSPA 5E9MA 5EWWA 5FE1A 5CRZA 4HXMA 4A9NA 5F25A 4ZW1A 5H1TA 5EGUA 5FG6A 4Y03A 4IR4A 5FB0A 5F2PA 4IR6A 4IR3A 5D24A 5DKHA 5D3NA 4LZSA 5DYUA 5CQ8A 2L85A 3U5NA 5A5SA 4NUEA 5ENIA 5FFYA 2E7NA 3QZSA 2YQDA 5L98A 2R0SA 5CUGA 5I86A 5JWMA 4QZSA 5FB1A 5EV9A 5HRVA 5HRWA 4YYIA 4E96A 4TYLA 5IG6A 5KHMA 5DFBA 4NRAA 5HQ7A 3HMFA 5LKTA 3QZVA 3O34A 5H1UA 5FE6A 5F3AA 4A9IA 4NR7A 4QSTA 4BW2A 3G0LA 5COIA 2YDWA 2WP1A 4BW4A 2KTBB 5CQAA 3S92A 5DKDA 5F60A 5DFDA 5ACYA 4YBMA 4HXSA 5FH7A 5A5NA 1JM4B 4NQNA 5HFQA 4QSSA 4WHWA 3MULA 2RS9B 4A9KA 5EPRA 2I7KA 4BW1A 3P1DA 5DBMA 5ENGA 3UVYA 2DATA 5DYAA 4NR6A 4UIXA 3AQAA 4AKNA 5BT3A 3S91A 3U5JA 4PTBA 5FE7A 5ETDA 4FLPA 2RFJA 3LQHA 4PKLA 4QSRA 5D3TA 4NYWA 3TLPA 4YYGA 4QYDA 4QSVA 5E9KA 3GG3A 3SVGA 3P5OA 4YATA 4HXNA 5ENEA 4N3WA 5DLZA 4O7CA 5CRMA 5FE5A 2E7OA 5DLXA 5EA1A 5K29A 4TU6A 4A9EA 4HBVA 5EI4A 4O70A 4NQMA 3Q2FA 4PS5A 5I88A 5C89A 4YH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQM A;  5C7N A;  4KV1 A;  5CUB A;  4TZ8 A;  5TB6 A;  5CTL A;  4MR5 A;  5EU1 A;  4IR5 A;  5HRX A;  5I40 A;  4N4G A;  2I8N A;  4PCE A;  5I29 A;  2DWW A;  3U5K A;  4NRC A;  5D3R A;  4QYL A;  4UIY A;  4A9M A;  5FE9 A;  5G4R A;  5I89 A;  4CUR A;  5D25 A;  4QR4 A;  3P1E A;  4NUD A;  3UVX A;  4BJX A;  4UIV A;  5G4S A;  2OSS A;  5L96 A;  2D9E A;  4XYA A;  5A81 A;  4QBM A;  5CQ6 A;  4HXL A;  5DKC A;  5FFW A;  2MJV B;  3P1F A;  4UYD A;  4NR8 A;  4LC2 A;  5L8T A;  5FE4 A;  1N72 A;  5CU8 A;  4LR6 A;  5HQ5 A;  3Q2E A;  5FG4 A;  5HQ6 A;  4QB3 A;  4QSU A;  3U5P A;  4CLB A;  5DW1 A;  5HEL A;  5E73 A;  4UYG A;  2FSA A;  2DKW A;  4MR6 A;  5D3S A;  5DYX A;  5E3G A;  4UYE A;  2DVR A;  4UIU A;  4Q0N A;  5CS8 A;  3LQI A;  5L99 A;  4KV4 A;  5E74 A;  4YYK A;  4QEW A;  3G0J A;  4CFK A;  5EK9 A;  3U5M A;  3JVJ A;  5A5Q A;  3JVK A;  4NS5 A;  2N9G A;  5A82 A;  1E6I A;  4TQN A;  5F62 A;  4C67 A;  4HBX A;  5D3P A;  4IOQ A;  5CUC A;  3RCW A;  5CUD A;  5E9V A;  5F1H A;  5CY9 A;  5A5P A;  3ONI A;  4Q0O A;  5AD3 A;  4OGJ A;  5C8G A;  2DVS A;  5CFW A;  4YAX A;  5CGP A;  3MB4 A;  1WUG A;  4O74 A;  4PY6 A;  4A9F A;  4XY9 A;  5LJ1 A;  5II2 A;  4UYF A;  4KCX A;  4BHW A;  2DVQ A;  5I80 A;  4QSW A;  5EIC A;  5FH8 A;  4Z1Q A;  4RVR A;  5CQ4 A;  4QEV A;  4A9L A;  4ZC9 A;  5I1Q A;  4CUS A;  4TS8 A;  3JVL A;  4NYV A;  5HCL A;  5LKX A;  1X0J A;  4YAD A;  5ENF A;  4QR5 A;  4YYD A;  5ENB A;  5EP7 A;  4YH4 A;  5E3D A;  4UYH A;  5AME A;  5CPE A;  5EWH A;  3JVM A;  4TT4 A;  3UV2 A;  5HM0 A;  5BT4 A;  4O77 A;  4IOO A;  4QR3 A;  5FDZ A;  4OGI A;  5LKU A;  5KTW A;  2YW5 A;  3K2J A;  5DFC A;  5HFR A;  3O33 A;  4LDF A;  4A9O A;  4XUB A;  4O7A A;  5F63 A;  5EPS A;  2LSP B;  3U5L A;  4YYJ A;  5FH6 A;  2RNW A;  5CUA A;  4IOR A;  2RI7 A;  2YEK A;  4MEO A;  3SVF A;  4QC3 A;  3DAI A;  4QSQ A;  3P1C A;  4N4I A;  5DY7 A;  5KTX A;  3LQJ A;  2YEL A;  5LVR A;  4UIW A;  5J0D A;  2G4A A;  4O76 A;  5LUU A;  4HXK A;  5FG5 A;  4QUU A;  4LZ2 A;  5F1L A;  4A9J A;  4HXP A;  3D7C A;  3AAD A;  5CUE A;  5E9I A;  5C85 A;  4NXJ A;  5ENH A;  3UV5 A;  4NR9 A;  5A85 A;  5I83 A;  4MEP A;  4MEQ A;  5IID A;  4UYF B;  2L84 A;  4C66 A;  4LYW A;  5H1V A;  3MUK A;  4O71 A;  5D3L A;  5HLS A;  2R10 A;  5EM3 A;  5D3J A;  4TT6 A;  5CZG A;  5F36 A;  4QC1 A;  2F6N A;  4CL9 A;  5IBN A;  4DON A;  4YK0 A;  3DWY A;  4HBY A;  3QZT A;  5CQT A;  4UIT A;  4LZR A;  5CQ7 A;  4CUQ A;  4Z93 A;  4TU4 A;  1EQF A;  5E7D A;  4J0R A;  2R0V A;  5JI8 A;  5C4Q A;  5DW2 A;  5IGM A;  4NR4 A;  4J1P A;  5HJC A;  3MB3 A;  3LXJ A;  3UW9 A;  4O78 A;  5FE8 A;  2E3K A;  5DX4 A;  5II1 A;  3O35 A;  4UIZ A;  5EWD A;  3IU6 A;  5H85 A;  5L97 A;  3LJW A;  2RNY A;  3O36 A;  4HXR A;  4LYS A;  5EPB A;  5BT5 A;  5CP5 A;  5EWV A;  4QUT A;  4QNS A;  5L8U A;  5ENJ A;  3UV4 A;  5KU3 A;  1ZS5 A;  4ALG A;  4NUC A;  4TTE A;  4XUA A;  4Z6H A;  2R0Y A;  5D7X A;  5I7Y A;  4HXO A;  5DYC A;  5TCM A;  3UVD A;  5ENC A;  4YBT A;  5FBX A;  4YYH A;  4N4H A;  3SVH A;  2D82 A;  3UVW A;  4YBS A;  5CQ5 A;  4PCI A;  4MR4 A;  2YYN A;  4O72 A;  5IGL A;  5EQ1 A;  1WUM A;  4OUF A;  5E9L A;  4A9H A;  4Z6I A;  5AMF A;  2DVV A;  2F6J A;  3U5O A;  4YY4 A;  2RNX A;  4GPJ A;  5IGN A;  4O7E A;  5A5R A;  4CUP A;  3I3J A;  5ETB A;  2OUO A;  5F61 A;  5E9Y A;  4ALH A;  4TT2 A;  4QEU A;  5EVA A;  1JSP B;  5HEM A;  4BW3 A;  5FE2 A;  5EIS A;  4O7F A;  2H60 A;  2WP2 A;  4LYI A;  5D3H A;  5AD2 A;  4YC9 A;  5F5Z A;  4Z1S A;  4TZ2 A;  2YEM A;  5LJ0 A;  3HME A;  4LRG A;  4NR5 A;  4QSX A;  5IGK A;  3MXF A;  4YYM A;  4YY6 A;  3HMH A;  4HBW A;  2RO1 A;  3O37 A;  5FE0 A;  5EWC A;  5KTU A;  5FFV A;  5C87 A;  1F68 A;  5D0C A;  3NXB A;  4X2I A;  3IU5 A;  5CQ3 A;  5HEN A;  5E0R A;  4YYN A;  4MR3 A;  4N4F A;  2GRC A;  5LKZ A;  5FE3 A;  4CUT A;  5LVQ A;  5KO4 A;  2L5E A;  4F3I A;  4O7B A;  4WIV A;  5LJ2 A;  2OO1 A;  5A83 A;  4NRB A;  3FKM X;  4ZQL A;  4NYX A;  5A7C A;  4XY8 A;  5A5O A;  4WHU A;  4QY4 A;  4O75 A;  4J3I A;  5D26 A;  2NXB A;  4CFL A;  4CUU A;  4MEN A;  3ZYU A;  5I7X A;  4J0S A;  4YAB A;  4QSP A;  5E9M A;  5EWW A;  5FE1 A;  5CRZ A;  4HXM A;  4A9N A;  5F25 A;  4ZW1 A;  5H1T A;  5EGU A;  5FG6 A;  4Y03 A;  4IR4 A;  5FB0 A;  5F2P A;  4IR6 A;  4IR3 A;  5D24 A;  5DKH A;  5D3N A;  4LZS A;  5DYU A;  5CQ8 A;  2L85 A;  3U5N A;  5A5S A;  4NUE A;  5ENI A;  5FFY A;  2E7N A;  3QZS A;  2YQD A;  5L98 A;  2R0S A;  5CUG A;  5I86 A;  5JWM A;  4QZS A;  5FB1 A;  5EV9 A;  5HRV A;  5HRW A;  4YYI A;  4E96 A;  4TYL A;  5IG6 A;  5KHM A;  5DFB A;  4NRA A;  5HQ7 A;  3HMF A;  5LKT A;  3QZV A;  3O34 A;  5H1U A;  5FE6 A;  5F3A A;  4A9I A;  4NR7 A;  4QST A;  4BW2 A;  3G0L A;  5COI A;  2YDW A;  2WP1 A;  4BW4 A;  2KTB B;  5CQA A;  3S92 A;  5DKD A;  5F60 A;  5DFD A;  5ACY A;  4YBM A;  4HXS A;  5FH7 A;  5A5N A;  1JM4 B;  4NQN A;  5HFQ A;  4QSS A;  4WHW A;  3MUL A;  2RS9 B;  4A9K A;  5EPR A;  2I7K A;  4BW1 A;  3P1D A;  5DBM A;  5ENG A;  3UVY A;  2DAT A;  5DYA A;  4NR6 A;  4UIX A;  3AQA A;  4AKN A;  5BT3 A;  3S91 A;  3U5J A;  4PTB A;  5FE7 A;  5ETD A;  4FLP A;  2RFJ A;  3LQH A;  4PKL A;  4QSR A;  5D3T A;  4NYW A;  3TLP A;  4YYG A;  4QYD A;  4QSV A;  5E9K A;  3GG3 A;  3SVG A;  3P5O A;  4YAT A;  4HXN A;  5ENE A;  4N3W A;  5DLZ A;  4O7C A;  5CRM A;  5FE5 A;  2E7O A;  5DLX A;  5EA1 A;  5K29 A;  4TU6 A;  4A9E A;  4HBV A;  5EI4 A;  4O70 A;  4NQM A;  3Q2F A;  4PS5 A;  5I88 A;  5C89 A;  4YH3 A; 
#chains in the Genus database with same CATH topology
 3MQM A;  5C7N A;  4KV1 A;  5CUB A;  4TZ8 A;  5TB6 A;  5CTL A;  4MR5 A;  5EU1 A;  4IR5 A;  5HRX A;  5I40 A;  4N4G A;  2I8N A;  4PCE A;  5I29 A;  2DWW A;  3U5K A;  4NRC A;  5D3R A;  4QYL A;  4UIY A;  4A9M A;  5FE9 A;  5G4R A;  5I89 A;  4CUR A;  5D25 A;  4QR4 A;  3P1E A;  4NUD A;  3UVX A;  4BJX A;  4UIV A;  5G4S A;  2OSS A;  5L96 A;  2D9E A;  4XYA A;  5A81 A;  4QBM A;  5CQ6 A;  4HXL A;  5DKC A;  5FFW A;  2MJV B;  3P1F A;  4UYD A;  2EJN A;  4LC2 A;  4NR8 A;  5L8T A;  5FE4 A;  1N72 A;  5CU8 A;  4LR6 A;  5HQ5 A;  3Q2E A;  5FG4 A;  5HQ6 A;  4QB3 A;  4QSU A;  3U5P A;  4CLB A;  5DW1 A;  5HEL A;  5E73 A;  4UYG A;  2FSA A;  2DKW A;  4MR6 A;  5D3S A;  5DYX A;  4AKI A;  5E3G A;  4UYE A;  2DVR A;  4UIU A;  4Q0N A;  5CS8 A;  3LQI A;  5L99 A;  4KV4 A;  5E74 A;  4YYK A;  4QEW A;  3G0J A;  4CFK A;  5EK9 A;  3U5M A;  3JVJ A;  5A5Q A;  3JVK A;  4NS5 A;  2N9G A;  5A82 A;  1E6I A;  4TQN A;  5F62 A;  4C67 A;  4HBX A;  5D3P A;  3ERR A;  4IOQ A;  5CUC A;  3RCW A;  5CUD A;  5E9V A;  5F1H A;  5CY9 A;  5A5P A;  3ONI A;  4Q0O A;  5AD3 A;  4OGJ A;  5C8G A;  2DVS A;  5CFW A;  4YAX A;  5CGP A;  3MB4 A;  1WUG A;  4O74 A;  4PY6 A;  4A9F A;  4XY9 A;  5LJ1 A;  5II2 A;  4UYF A;  4KCX A;  4BHW A;  2DVQ A;  5I80 A;  4QSW A;  5EIC A;  5FH8 A;  4Z1Q A;  4RVR A;  5CQ4 A;  4QEV A;  4A9L A;  4ZC9 A;  5I1Q A;  4CUS A;  4TS8 A;  3JVL A;  4NYV A;  5HCL A;  5LKX A;  1X0J A;  4YAD A;  5ENF A;  4QR5 A;  4YYD A;  5ENB A;  5EP7 A;  4YH4 A;  5E3D A;  4UYH A;  5AME A;  5CPE A;  5EWH A;  3JVM A;  4TT4 A;  3UV2 A;  5HM0 A;  4AKG A;  5BT4 A;  4O77 A;  4IOO A;  4QR3 A;  5FDZ A;  4OGI A;  5LKU A;  5KTW A;  2YW5 A;  3K2J A;  5DFC A;  5HFR A;  3O33 A;  4LDF A;  4A9O A;  4XUB A;  4O7A A;  5F63 A;  5EPS A;  2LSP B;  3U5L A;  4YYJ A;  5FH6 A;  2RNW A;  5CUA A;  4IOR A;  2RI7 A;  2YEK A;  4MEO A;  3SVF A;  4QC3 A;  3DAI A;  4QSQ A;  3P1C A;  4N4I A;  5DY7 A;  5KTX A;  3LQJ A;  2YEL A;  5LVR A;  4UIW A;  5J0D A;  2G4A A;  4O76 A;  5LUU A;  4HXK A;  5FG5 A;  4QUU A;  4LZ2 A;  5F1L A;  4A9J A;  4HXP A;  3D7C A;  3AAD A;  5CUE A;  5E9I A;  5C85 A;  4NXJ A;  5ENH A;  3UV5 A;  4NR9 A;  5A85 A;  5I83 A;  4MEP A;  4MEQ A;  5IID A;  4UYF B;  2L84 A;  4C66 A;  4LYW A;  5H1V A;  3MUK A;  4O71 A;  5D3L A;  5HLS A;  2R10 A;  5EM3 A;  5D3J A;  4TT6 A;  5CZG A;  5F36 A;  4QC1 A;  2F6N A;  4CL9 A;  5IBN A;  4DON A;  4AI6 A;  4YK0 A;  3DWY A;  3D1B A;  4HBY A;  3QZT A;  5CQT A;  4UIT A;  4LZR A;  5CQ7 A;  4CUQ A;  4Z93 A;  4TU4 A;  1EQF A;  5E7D A;  4J0R A;  2R0V A;  5JI8 A;  5C4Q A;  5DW2 A;  5IGM A;  4NR4 A;  4J1P A;  5HJC A;  3MB3 A;  3LXJ A;  3UW9 A;  4O78 A;  5FE8 A;  2E3K A;  5DX4 A;  5II1 A;  3O35 A;  4UIZ A;  5EWD A;  3IU6 A;  5H85 A;  5L97 A;  3LJW A;  2RNY A;  3O36 A;  4HXR A;  4LYS A;  5EPB A;  5BT5 A;  5CP5 A;  5EWV A;  4QUT A;  4QNS A;  5L8U A;  5ENJ A;  3UV4 A;  5KU3 A;  1ZS5 A;  4ALG A;  4NUC A;  4TTE A;  4XUA A;  4Z6H A;  2R0Y A;  5D7X A;  5I7Y A;  4HXO A;  5DYC A;  5TCM A;  3UVD A;  5ENC A;  4YBT A;  5FBX A;  4YYH A;  4N4H A;  3SVH A;  2D82 A;  3UVW A;  4YBS A;  5CQ5 A;  4PCI A;  4MR4 A;  2YYN A;  4O72 A;  5IGL A;  5EQ1 A;  1WUM A;  4OUF A;  5E9L A;  4A9H A;  4Z6I A;  5AMF A;  2DVV A;  2F6J A;  3U5O A;  4YY4 A;  2RNX A;  4GPJ A;  5IGN A;  4O7E A;  5A5R A;  4CUP A;  3I3J A;  5ETB A;  2OUO A;  5F61 A;  5E9Y A;  4ALH A;  4TT2 A;  4QEU A;  5EVA A;  1JSP B;  5HEM A;  4BW3 A;  5FE2 A;  5EIS A;  4O7F A;  2H60 A;  2WP2 A;  4LYI A;  5D3H A;  5AD2 A;  4YC9 A;  5F5Z A;  4Z1S A;  4TZ2 A;  2YEM A;  5LJ0 A;  3HME A;  4LRG A;  4NR5 A;  4QSX A;  5IGK A;  3MXF A;  4YYM A;  4YY6 A;  3HMH A;  4HBW A;  2RO1 A;  3O37 A;  5FE0 A;  5EWC A;  5KTU A;  5FFV A;  5C87 A;  1F68 A;  5D0C A;  3NXB A;  4X2I A;  3IU5 A;  5CQ3 A;  5HEN A;  5E0R A;  4YYN A;  4MR3 A;  4N4F A;  2GRC A;  5LKZ A;  5FE3 A;  4CUT A;  5LVQ A;  5KO4 A;  2L5E A;  4F3I A;  4O7B A;  4WIV A;  5LJ2 A;  2OO1 A;  5A83 A;  4NRB A;  3FKM X;  4ZQL A;  4NYX A;  5A7C A;  4XY8 A;  5A5O A;  4WHU A;  4QY4 A;  4O75 A;  4J3I A;  5D26 A;  2NXB A;  4CFL A;  4CUU A;  4MEN A;  1PUO A;  3ZYU A;  5I7X A;  4J0S A;  4YAB A;  4AKH A;  4QSP A;  5E9M A;  5EWW A;  5FE1 A;  5CRZ A;  4HXM A;  4A9N A;  5F25 A;  4ZW1 A;  5H1T A;  5EGU A;  5FG6 A;  4Y03 A;  4IR4 A;  5FB0 A;  5F2P A;  4IR6 A;  4IR3 A;  5D24 A;  5DKH A;  5D3N A;  4LZS A;  5DYU A;  5CQ8 A;  2L85 A;  3U5N A;  5A5S A;  4NUE A;  5ENI A;  5FFY A;  2E7N A;  3QZS A;  2YQD A;  5L98 A;  2R0S A;  5CUG A;  5I86 A;  5JWM A;  4QZS A;  5FB1 A;  5EV9 A;  5HRV A;  5HRW A;  4YYI A;  4E96 A;  4TYL A;  5IG6 A;  5KHM A;  5DFB A;  4NRA A;  5HQ7 A;  3HMF A;  5LKT A;  3QZV A;  3O34 A;  5H1U A;  5FE6 A;  5F3A A;  4A9I A;  4NR7 A;  4QST A;  4BW2 A;  3G0L A;  5COI A;  3VKH A;  2YDW A;  2WP1 A;  4BW4 A;  2KTB B;  5CQA A;  3S92 A;  5DKD A;  5F60 A;  5DFD A;  5ACY A;  4YBM A;  4HXS A;  5FH7 A;  5A5N A;  1JM4 B;  4NQN A;  5HFQ A;  4QSS A;  4WHW A;  3MUL A;  2RS9 B;  4A9K A;  5EPR A;  2I7K A;  4BW1 A;  3P1D A;  5DBM A;  5ENG A;  3UVY A;  2DAT A;  5DYA A;  4NR6 A;  4UIX A;  3AQA A;  4AKN A;  5BT3 A;  3D1D A;  3S91 A;  3U5J A;  4PTB A;  5FE7 A;  5ETD A;  4FLP A;  1ZKR A;  2RFJ A;  3LQH A;  4PKL A;  4QSR A;  5D3T A;  4NYW A;  3TLP A;  4YYG A;  4QYD A;  4QSV A;  5E9K A;  3GG3 A;  3SVG A;  3P5O A;  4YAT A;  3VKG A;  4HXN A;  5ENE A;  4N3W A;  5DLZ A;  4O7C A;  5CRM A;  5FE5 A;  2E7O A;  5DLX A;  5EA1 A;  5K29 A;  4TU6 A;  4A9E A;  4HBV A;  5EI4 A;  4O70 A;  4NQM A;  3Q2F A;  4PS5 A;  5I88 A;  5C89 A;  4YH3 A; 
#chains in the Genus database with same CATH homology
 3MQM A;  5C7N A;  4KV1 A;  5CUB A;  4TZ8 A;  5TB6 A;  5CTL A;  4MR5 A;  5EU1 A;  4IR5 A;  5HRX A;  5I40 A;  4N4G A;  2I8N A;  4PCE A;  5I29 A;  2DWW A;  3U5K A;  4NRC A;  5D3R A;  4QYL A;  4UIY A;  4A9M A;  5FE9 A;  5G4R A;  5I89 A;  4CUR A;  5D25 A;  4QR4 A;  3P1E A;  4NUD A;  3UVX A;  4BJX A;  4UIV A;  5G4S A;  2OSS A;  5L96 A;  2D9E A;  4XYA A;  5A81 A;  4QBM A;  5CQ6 A;  4HXL A;  5DKC A;  5FFW A;  2MJV B;  3P1F A;  4UYD A;  4NR8 A;  4LC2 A;  5L8T A;  5FE4 A;  1N72 A;  5CU8 A;  4LR6 A;  5HQ5 A;  3Q2E A;  5FG4 A;  5HQ6 A;  4QB3 A;  4QSU A;  3U5P A;  4CLB A;  5DW1 A;  5HEL A;  5E73 A;  4UYG A;  2FSA A;  2DKW A;  4MR6 A;  5D3S A;  5DYX A;  5E3G A;  4UYE A;  2DVR A;  4UIU A;  4Q0N A;  5CS8 A;  3LQI A;  5L99 A;  4KV4 A;  5E74 A;  4YYK A;  4QEW A;  3G0J A;  4CFK A;  5EK9 A;  3U5M A;  3JVJ A;  5A5Q A;  3JVK A;  4NS5 A;  2N9G A;  5A82 A;  1E6I A;  4TQN A;  5F62 A;  4C67 A;  4HBX A;  5D3P A;  4IOQ A;  5CUC A;  3RCW A;  5CUD A;  5E9V A;  5F1H A;  5CY9 A;  5A5P A;  3ONI A;  4Q0O A;  5AD3 A;  4OGJ A;  5C8G A;  2DVS A;  5CFW A;  4YAX A;  5CGP A;  3MB4 A;  1WUG A;  4O74 A;  4PY6 A;  4A9F A;  4XY9 A;  5LJ1 A;  5II2 A;  4UYF A;  4KCX A;  4BHW A;  2DVQ A;  5I80 A;  4QSW A;  5EIC A;  5FH8 A;  4Z1Q A;  4RVR A;  5CQ4 A;  4QEV A;  4A9L A;  4ZC9 A;  5I1Q A;  4CUS A;  4TS8 A;  3JVL A;  4NYV A;  5HCL A;  5LKX A;  1X0J A;  4YAD A;  5ENF A;  4QR5 A;  4YYD A;  5ENB A;  5EP7 A;  4YH4 A;  5E3D A;  4UYH A;  5AME A;  5CPE A;  5EWH A;  3JVM A;  4TT4 A;  3UV2 A;  5HM0 A;  5BT4 A;  4O77 A;  4IOO A;  4QR3 A;  5FDZ A;  4OGI A;  5LKU A;  5KTW A;  2YW5 A;  3K2J A;  5DFC A;  5HFR A;  3O33 A;  4LDF A;  4A9O A;  4XUB A;  4O7A A;  5F63 A;  5EPS A;  2LSP B;  3U5L A;  4YYJ A;  5FH6 A;  2RNW A;  5CUA A;  4IOR A;  2RI7 A;  2YEK A;  4MEO A;  3SVF A;  4QC3 A;  3DAI A;  4QSQ A;  3P1C A;  4N4I A;  5DY7 A;  5KTX A;  3LQJ A;  2YEL A;  5LVR A;  4UIW A;  5J0D A;  2G4A A;  4O76 A;  5LUU A;  4HXK A;  5FG5 A;  4QUU A;  4LZ2 A;  5F1L A;  4A9J A;  4HXP A;  3D7C A;  3AAD A;  5CUE A;  5E9I A;  5C85 A;  4NXJ A;  5ENH A;  3UV5 A;  4NR9 A;  5A85 A;  5I83 A;  4MEP A;  4MEQ A;  5IID A;  4UYF B;  2L84 A;  4C66 A;  4LYW A;  5H1V A;  3MUK A;  4O71 A;  5D3L A;  5HLS A;  2R10 A;  5EM3 A;  5D3J A;  4TT6 A;  5CZG A;  5F36 A;  4QC1 A;  2F6N A;  4CL9 A;  5IBN A;  4DON A;  4YK0 A;  3DWY A;  4HBY A;  3QZT A;  5CQT A;  4UIT A;  4LZR A;  5CQ7 A;  4CUQ A;  4Z93 A;  4TU4 A;  1EQF A;  5E7D A;  4J0R A;  2R0V A;  5JI8 A;  5C4Q A;  5DW2 A;  5IGM A;  4NR4 A;  4J1P A;  5HJC A;  3MB3 A;  3LXJ A;  3UW9 A;  4O78 A;  5FE8 A;  2E3K A;  5DX4 A;  5II1 A;  3O35 A;  4UIZ A;  5EWD A;  3IU6 A;  5H85 A;  5L97 A;  3LJW A;  2RNY A;  3O36 A;  4HXR A;  4LYS A;  5EPB A;  5BT5 A;  5CP5 A;  5EWV A;  4QUT A;  4QNS A;  5L8U A;  5ENJ A;  3UV4 A;  5KU3 A;  1ZS5 A;  4ALG A;  4NUC A;  4TTE A;  4XUA A;  4Z6H A;  2R0Y A;  5D7X A;  5I7Y A;  4HXO A;  5DYC A;  5TCM A;  3UVD A;  5ENC A;  4YBT A;  5FBX A;  4YYH A;  4N4H A;  3SVH A;  2D82 A;  3UVW A;  4YBS A;  5CQ5 A;  4PCI A;  4MR4 A;  2YYN A;  4O72 A;  5IGL A;  5EQ1 A;  1WUM A;  4OUF A;  5E9L A;  4A9H A;  4Z6I A;  5AMF A;  2DVV A;  2F6J A;  3U5O A;  4YY4 A;  2RNX A;  4GPJ A;  5IGN A;  4O7E A;  5A5R A;  4CUP A;  3I3J A;  5ETB A;  2OUO A;  5F61 A;  5E9Y A;  4ALH A;  4TT2 A;  4QEU A;  5EVA A;  1JSP B;  5HEM A;  4BW3 A;  5FE2 A;  5EIS A;  4O7F A;  2H60 A;  2WP2 A;  4LYI A;  5D3H A;  5AD2 A;  4YC9 A;  5F5Z A;  4Z1S A;  4TZ2 A;  2YEM A;  5LJ0 A;  3HME A;  4LRG A;  4NR5 A;  4QSX A;  5IGK A;  3MXF A;  4YYM A;  4YY6 A;  3HMH A;  4HBW A;  2RO1 A;  3O37 A;  5FE0 A;  5EWC A;  5KTU A;  5FFV A;  5C87 A;  1F68 A;  5D0C A;  3NXB A;  4X2I A;  3IU5 A;  5CQ3 A;  5HEN A;  5E0R A;  4YYN A;  4MR3 A;  4N4F A;  2GRC A;  5LKZ A;  5FE3 A;  4CUT A;  5LVQ A;  5KO4 A;  2L5E A;  4F3I A;  4O7B A;  4WIV A;  5LJ2 A;  2OO1 A;  5A83 A;  4NRB A;  3FKM X;  4ZQL A;  4NYX A;  5A7C A;  4XY8 A;  5A5O A;  4WHU A;  4QY4 A;  4O75 A;  4J3I A;  5D26 A;  2NXB A;  4CFL A;  4CUU A;  4MEN A;  3ZYU A;  5I7X A;  4J0S A;  4YAB A;  4QSP A;  5E9M A;  5EWW A;  5FE1 A;  5CRZ A;  4HXM A;  4A9N A;  5F25 A;  4ZW1 A;  5H1T A;  5EGU A;  5FG6 A;  4Y03 A;  4IR4 A;  5FB0 A;  5F2P A;  4IR6 A;  4IR3 A;  5D24 A;  5DKH A;  5D3N A;  4LZS A;  5DYU A;  5CQ8 A;  2L85 A;  3U5N A;  5A5S A;  4NUE A;  5ENI A;  5FFY A;  2E7N A;  3QZS A;  2YQD A;  5L98 A;  2R0S A;  5CUG A;  5I86 A;  5JWM A;  4QZS A;  5FB1 A;  5EV9 A;  5HRV A;  5HRW A;  4YYI A;  4E96 A;  4TYL A;  5IG6 A;  5KHM A;  5DFB A;  4NRA A;  5HQ7 A;  3HMF A;  5LKT A;  3QZV A;  3O34 A;  5H1U A;  5FE6 A;  5F3A A;  4A9I A;  4NR7 A;  4QST A;  4BW2 A;  3G0L A;  5COI A;  2YDW A;  2WP1 A;  4BW4 A;  2KTB B;  5CQA A;  3S92 A;  5DKD A;  5F60 A;  5DFD A;  5ACY A;  4YBM A;  4HXS A;  5FH7 A;  5A5N A;  1JM4 B;  4NQN A;  5HFQ A;  4QSS A;  4WHW A;  3MUL A;  2RS9 B;  4A9K A;  5EPR A;  2I7K A;  4BW1 A;  3P1D A;  5DBM A;  5ENG A;  3UVY A;  2DAT A;  5DYA A;  4NR6 A;  4UIX A;  3AQA A;  4AKN A;  5BT3 A;  3S91 A;  3U5J A;  4PTB A;  5FE7 A;  5ETD A;  4FLP A;  2RFJ A;  3LQH A;  4PKL A;  4QSR A;  5D3T A;  4NYW A;  3TLP A;  4YYG A;  4QYD A;  4QSV A;  5E9K A;  3GG3 A;  3SVG A;  3P5O A;  4YAT A;  4HXN A;  5ENE A;  4N3W A;  5DLZ A;  4O7C A;  5CRM A;  5FE5 A;  2E7O A;  5DLX A;  5EA1 A;  5K29 A;  4TU6 A;  4A9E A;  4HBV A;  5EI4 A;  4O70 A;  4NQM A;  3Q2F A;  4PS5 A;  5I88 A;  5C89 A;  4YH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...