2GRMA

Crystal structure of prgx/icf10 complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
315
structure length
315
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGCYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVAIENNPIPEIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for control of conjugation by bacterial pheromone and inhibitor peptides.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PrgX
total genus 121
structure length 315
sequence length 315
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2grmA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2grmA02
4PU7A 4X4CA 1YSEA 2WUSR 1ZZ9A 3KXAA 4YG4A 3ZHMA 3CLCA 2XJ3A 3JXBC 2O4AA 1OCTC 4YG7B 3SCHA 2LYPA 1E3OC 1LCDA 2HINA 4Z5DA 2B5AA 1X57A 3VK0A 2LYRA 4X4IA 1CQTA 1QP4A 4PU8A 3RZZA 3DNVB 4FN3A 3OMTA 4I6RA 2LCVA 2A6CA 4GQMA 2JVLA 1RZRD 4Z59A 1JFTA 3U3WA 1LLIA 2KEJA 1POUA 1Y7YA 4YARA 3JXCL 2LYSA 3KJXA 2XI8A 1PRVA 4F8DA 1WIZA 2BNMA 2PUGA 3L1PA 4YG1A 4Y42A 2IVQA 1PNRA 2O49A 1WH6A 2IVBA 5A7LA 2D5VA 2H8RA 4O8BA 3HZIB 2MQKA 2IV1A 1ZPQA 3QF3A 1DWKA 2PIJA 2PUEA 1LCCA 1SQ8A 1GT0C 1ZAYA 1ZZCA 2L8NA 3D1NI 1BDIA 4JQDA 3CECA 3OQNA 3QQ6A 2GRMA 4Z5HA 2LYQA 4I6TA 1AU7A 2KEIA 3BS3A 2PUBA 2FJRA 2HSGA 4OB4A 3F6WA 2LYKA 2CSFA 3SCGA 2GRLA 1RZRA 2IUOA 1JFSA 1VPWA 3H5TA 1ZZ7A 2O38A 3TRBA 1ZZ6A 1NERA 5K98B 1QQAA 3BD1A 2EBYA 3ZKCA 1ZZBA 2LYJA 1EFAA 4PU4C 1QP7A 1CJGA 1ADRA 3SCFA 2EF8A 1XWRA 1PERL 2PUCA 4I8TA 2KPJA 3GN5A 1LQCA 2EWTA 3UFDA 4X4GA 1R63A 2WIUB 3F52A 4MCTA 2XSDC 1HF0A 4Z5CA 1X2LA 3GN5B 4I6UA 1O4XA 2ICPA 3EUSA 2CROA 3S8QA 2IU7A 1ZS4A 1QP0A 2R1JL 2PUDA 4YBAA 2OR1L 3PXPA 2MEZA 3G7DA 1JWLA 2LYLA 4J1WA 1ZUGA 1B0NA 2PUAA 4FBIA 3LISA 3OQMA 2PUFA 1BDHA 2AXZA 3QYXA 1Y9QA 1IC8A 2AWIA 1DW9A 1R69A 4J1XA 2BJCA 1UXCA 2AXUA 2L49A 4PU3C 2JCGA 4NDWA 3BDNA 1QPZA 3ZHIA 2GZUA 1RIOA 1UXDA 4JCXA 2ICTA 2BNNA 1RZSA 2PE5A 4X4DA 1JH9A 1NEQA 1S7EA 4IWRA 4X4BA 3LFPA 2BNOA 3FMYA 3GBFA 4JCYA 2XIUA 2AW6A 3B7HA 3FYAA 3IVPA 3OP9A 1PRUA 3OQOA 1WH8A 1ZZ8A 3MLFA 3F51A 3KZ3A 1OSLA 2KZ8A 4MCXA 4X4FA 3CROL 2R63A 2OFYA 4Z58A 4X4EA 2AXVA 1PRAA 2PPXA 4IVZA 3QWGA 3R1FA 1QQBA 2XCJA 3FYMA 3JXDL 4IA8A 2AUWA 4GHJA 1WETA 3O9XA 1LMB3 1UTXA 4X4HA 1RPEL 2IVGA 1ZVVA 1L1MA 2KEKA 3G5GA
chains in the Genus database with same CATH superfamily
1BI7B 1OY3D 2X3MA 2OV8A 4LCTA 3PEUB 3ONLA 4RG6A 2MYOA 3T5VA 2VSXE 1WM5A 1JWGA 5AQBA 4L7TA 4CRWA 1JCRA 3PUJA 3CHRA 2YBDA 2PXKA 5ENSD 3SFZA 4U0UA 1LTXA 1QB2A 2IO2C 4ER5A 5EYPF 1KT1A 2I1KA 2XGMA 3UINC 4HBDA 1K8KG 4UWLA 3O48A 2WXIA 3ESKA 3FTZA 4G8KA 5DTQA 2V4HC 5DTMA 1HZ4A 4FP7A 1N4SA 1S70B 1D8DA 2ETAA 4CEMA 1EYHA 3E34A 4J1WA 4FADA 3SFXA 4EBAG 2AXZA 5CEAA 4U04A 4N3CA 2XPIA 3ABME 5FZQA 2R5SA 2KM4A 2XEHA 1P5QA 4HVBA 1XNFA 5ENPD 4KT6B 2KCKA 3GBFA 2VGEA 2AW6A 3FULA 4JL0A 3RIBA 3ZKJA 3LYAA 4GYWA 3UQ3A 2HFZA 1N9AA 5IY5E 1N54A 4FJZA 3FYMA 1Z6TA 2LXLA 4DX7D 1UTXA 3NB2A 1YCSB 3AAAC 5KJKA 3G5GA 2WUSR 4LG6A 3AG1E 2B6CA 3CLCA 3D9KA 4CCAA 3HXEA 4H7XA 3UX4A 3DSTA 2LYPA 5KBAA 2AVPA 4AIFA 3FU6A 2VJ8A 2PXQA 3Q75A 2R05A 4GYYA 3B7TA 3A9YA 2V5FA 4G24A 4IN3B 2MOWA 4B8CB 3ESLA 3L16A 3FUKA 3QF3A 3SX0A 3LY8A 3ULEG 4GU5A 1GT0C 3FDHA 4DI3A 3CQCB 3RJVA 2PUBA 4LNGA 2ZU6B 3WG7E 4XI9A 5LOZA 3MV3B 2WQ6A 2IONA 2BF0X 1N0QA 1IQRA 4U95D 3AU5A 4GZDA 4JA7A 5D0QD 4CDRA 4A63B 4GTQA 2FFHA 4X4GA 2Y4UA 3L9TA 4HOUA 2ICPA 4MBGA 2CROA 1TN6A 2OR1L 2Y0BG 2GRQB 1G3NB 1ZUGA 5KNGA 2PUAA 1E96B 1R69A 2IY0C 2VSOE 3Q15A 4DRXE 4GYOA 3NXHA 4HI8A 1JH9A 4MKTA 3TXNA 5FWQA 3Q49B 3LFPA 3HYMB 2XIUA 4L1BA 5CMYA 1HQ1A 3UTMA 5BV1A 4BTBA 4FC8A 1NP7A 4IA8A 2Y1LE 3MZLB 2VTBA 1HFAA 4HS2A 1NZNA 3L08A 1ZZ9A 3RO3A 2XXAA 5AIJA 3V31A 2NXPA 2C0LA 4L9PA 3FU3A 1QP4A 2XZTG 2GW1A 4I6RA 1OCCE 2ZISA 4YDOA 4XI0A 4M7CA 2BNMA 2XHEA 3CHQA 5J08A 2WMNA 3MEJA 4ATGA 4O8BA 1JCSA 2M63A 3QJZA 1OUVA 4JHRA 2WXJA 1VDYA 4O1PA 5AQ9A 2ZIRA 2LUHA 1QYMA 4Z5HA 5FQ7A 4RSYA 2EILE 3ASOE 4UI9K 2QFCA 2UWJG 4WNDA 2EBYA 1Y6IA 3FUHA 5B1BE 4HB5A 5H7PA 4GPKA 3TAXA 5BXOA 3L13A 2OOEA 4APOA 2H6GA 2IU7A 2PUDA 2QZAA 4YBAA 1O1TA 4PS3A 1JWLA 4ER0A 3JYSA 1Y9QA 3TXMA 2AWIA 4OVVA 3DWLG 3AU4A 2L49A 1E7UA 3HIZA 4HORA 2ICTA 1Y8MA 2L0IA 3SF4A 5CERB 2BNOA 3FYAA 4ABNA 3RRNB 4UI9C 3PDNA 3P2BA 2KZ8A 1NFIE 1Z5SC 3PRZA 2ETBA 4WNFA 3JCKC 3QB2A 2V8SE 4NQ0A 2ETCA 1EF1C 4FULA 1L1MA 4J8DA 3E33A 4ER7A 3JQ0A 3LPZA 2XJ3A 2HM8A 4HOSA 5G04C 3X2QE 4DE8A 4PU8A 3RZZA 1AP7A 4GTOA 4DJAA 1JFTA 3ZYQA 2AJAA 4JW1A 4GB9A 4N3AA 5JJTA 4Z68A 3PE3A 2RD0A 1SW6A 5EIDA 3ASHA 4HRMB 4FJYA 4AEZC 2WB2A 2KEIA 4G1TA 3EU5A 2PXLA 2HSGA 3F6WA 3RAUA 2F8YA 2CHWA 1ZZ7A 2J4DA 5CECB 3MKQA 2L9BA 2DBAA 5GAHi 1SZ9A 2QYJA 4LEUA 3EUSA 3FTVA 1ZS4A 3I4RB 3FH7A 3FUEA 2XRZA 1KLXA 4HOTA 1B0NA 2YNQA 3ZYKA 1ZB1A 4DK5A 2UY1A 4BY6A 4GTPA 4AOFA 1DCQA 1RIOA 1RZSA 4BWRA 1NEQA 1S7EA 4AM9A 3ZHEB 3FWVA 4BETA 2GRRB 4Q96A 2CFZA 5ENTD 4GA1A 5FTPA 4U7EB 3HVEA 3V79K 2XGSA 2PM7A 2LXMA 3RRUA 1IYGA 1TJCA 3O9XA 3Q4AB 3IEGA 2O4AA 4MS6A 4JXTA 3TWQA 4E85A 1CQTA 3PNTB 4O1OA 2X6KA 4ZHBA 3TGOA 1RZRD 3MV2B 1TNBA 2PUGA 3HXDA 2EIME 4AVXA 3FTXA 2D5VA 2KZTB 2WXOA 3HZIB 3D9JA 3NZUA 3ZGQA 4AP2A 5AJLA 3CR3A 3R9AB 3LQXA 1BDIA 3QQ6A 1MHQA 3DSSA 3BG1B 5CCMA 2LYQA 3MX3A 1HG5A 2FJRA 3OAWA 4I2WA 3SCGA 3RO2A 4AJWA 3CVXA 2EIKE 3NAWA 3Q79A 1FT1A 3ZFWA 5AJDA 1ZZBA 3CHSA 1EFAA 4HRNA 1UJKA 2WIUB 1HF0A 1X2LA 1QNFA 4DLOA 3S7FA 3MA5A 3AJIA 2EQXA 3J5PA 3PXPA 1V54E 3GYZA 3TG5A 3OQMA 2UY1B 1BD8A 4I17A 4J8EA 3QKYA 1UXCA 1L5JA 2WXFA 4ACKA 1UW4B 1HU3A 4JCXA 2BNNA 4GZ6A 2VGXA 3U4TA 4MRUA 5JHAA 2Y69E 5D0OD 4HNAD 4OBMA 1UN8A 2VGYA 4GAAA 3DBSA 3EHMA 3CROL 1OCRE 3I4GA 3ML8A 3SFYA 5A23A 4DE9A 2OEWA 1PY1A 3C3RA 2WQHA 3R1FA 4GTTA 3Q47B 2BEDA 4G8LA 5BW8C 3CKCA 4A1SA 5LFAA 3Q5MA 3A9XA 1K1AA 3VWSA 1AWCB 3DRAA 3W9FA 3R9MA 3DXMG 1LLIA 2JVLA 3NOCD 3U9WA 5FT9A 5FJYA 2OEVA 1O5MA 5DRTA 1E7VA 5CHEE 4EBAA 1DWKA 1WAO1 3QC1A 2PUEA 3S7DA 4HLEA 4UWGA 2L8NA 3V2XA 5FQ6A 2CG2A 3EHRA 3BQOA 3DM5A 4YVOA 3ZXPA 2J4BA 3ASFA 3CGHA 3N71A 1IQUA 4W9RA 3BS3A 3C5RA 2LYKA 4GZ3A 4BX9A 4EZJA 5D66A 4A55A 2XEEA 5KJNA 3VLEA 3BD1A 3TWWA 3IHVA 2WXPA 2JEKA 4CZ2D 3CHMA 3UM3A 4I8TA 4OAUC 4XEIG 3EIQC 4O6FA 3QK0A 3LVQE 4KZ0A 1OWOA 4UWHA 3A9ZA 4GTRA 5ANLA 2OVFA 1QQEA 4B94A 2GZUA 1KZOA 2HO1A 2IFUA 1OWPA 3OXLA 3DPDA 4MLPA 3AS5A 4JCYA 1IHGA 2P58C 2DZNA 4B0ZA 3ZVVA 2R17C 4DI4A 3L6AA 4I43A 3CVUA 3LKUA 3Q7FA 1SZAA 2IQCA 1PC2A 2FEZA 4J8YA 2VTBB 3RSEG 1EPUA 3GZDA 4UQYA 1ZVVA 3BU8A 1FT2A 1OT8A 2L6JA 1YSEA 3CVPA 3QOXA 1E8YA 4JHJA 5BT1A 3DPYA 4XX5A 5HRYA 4YDYA 3DNVB 5HKPA 4AY6A 4A3TA 2M4HA 2KEJA 1WDYA 1Z3YA 2XI8A 1WIZA 4U8VD 4Y42A 2IVBA 4GMLA 1NI1A 2WXKA 2YHCA 4RG9A 2LSUA 2P9PG 4JA9A 4G25A 4J0UA 4JQDA 2VQ2A 2QC9A 3EDTB 3KEZA 3OXFA 4PS7A 2DZOA 4OB4A 4F1PA 3HXFA 3GZ1A 1Z3XA 4B8AA 2LLWA 1TJFA 3BG0B 2A5EA 4B93B 3UPVA 1H19A 2VSNA 2P9LG 1ADRA 5EX3A 3ASDA 2HYZA 2PXEA 4MCTA 3F52A 3PH0C 2WXQA 4ME2A 4XE0A 2JLBA 3PE4A 3MEKA 1TNOA 2ZGGA 3D9HA 3URZA 2LYLA 4ANXA 3FH8A 3VLFA 5FZSA 2HE0A 2A4ZA 1DW9A 3NOGD 1SQMA 4ANVA 4BERA 5DIZA 1UXDA 4K03A 2PXFA 2J09A 3TWRA 2BTDA 4EKIA 5EILA 4ILHB 4QFVA 4ATZD 2VGXB 3E4BA 3OP9A 3QAQA 4HRLA 4K5BA 3CVWA 4L23A 2V5QC 5CRVA 3ULQA 3CIAA 1OCOE 2BKGA 3EIJA 3PZDA 2R59A 3RU0A 3UT8A 4JD2G 1H6KA 3OXGA 3CVVA 5FZRA 2AUWA 1OWMA 4CT0A 1LMB3 4V3IA 3ZYLA 1LF8A 3TWXA 3KXAA 3C3QA 3E30A 3PZ4A 3G2WA 3IV0A 2MRIA 4D10C 3CHPA 4Z5DA 4LUNU 2CHZA 3S2AA 2J8SD 4Z59A 1MX2A 2LYSA 3B7UX 3CV0A 2IVQA 1PNRA 3FEXA 3ME5A 2WXGA 1OXJA 3ZU7B 4WWPA 3GZDC 1TEZA 2MQKA 4EQFA 4EZIA 4XKBA 3AG2E 2E2EA 4AV7A 5C2YA 1OCZE 3CECA 3QARA 1JCQA 2YINA 4YDWA 4I6TA 1H6PA 1HO8A 3O4ZA 2ZGDA 3APFA 5AARA 2I1JA 3SGHA 3NDBB 5ENNA 2F8XK 1LD8A 1RZRA 2IUOA 4HLLA 3H5TA 3DEOA 3MKQB 4WWOA 4KBQA 4HFGA 3QWVA 3S7BA 4U8HA 4AY5A 1OWNA 1R63A 1N4QA 2HCSA 4I6UA 1O4XA 3LVRE 3R09A 3J5QB 2Y3AA 4DUIA 5A6CA 2WXRA 1QPZA 3BDNA 3G2TA 1YA0A 1Q2ZA 5HQ8A 3SO8A 3GZ2A 3FUMA 2WXLA 1YYHA 3IVPA 3SNXA 2P9SG 4GA2A 4MCXA 3LJ3A 5G55A 2CHXA 2H6HA 1H2TC 3G2VA 3Q7AA 2X6IA 2QY7A 2IEJA 3PZ3A 5EIBE 4GZCA 3B95A 5JJ7A 1OCTC 3Q9UC 2DYSE 1MX4A 1X57A 2LYRA 4WNEA 4GQMA 4FHJA 3RRMB 4CGWA 2L0TB 4LERA 4G11A 1ELWA 1S64A 3L1PA 3U64A 3ZYMA 3UIPC 3PREA 1QBQA 2KCVA 1HF8A 4IYPA 2PXTA 4CDMA 3CVLA 3OQNA 1K1BA 3FUJA 3ZN3A 4JZYA 4HI9A 1KPSB 4U63A 1HE8A 2EINE 3SBTB 3FUFA 1NERA 4I1AA 3JUIA 3M9LA 5DTRA 1N0RA 3UWPA 4GTVA 2IOLA 3D9IA 4FA6A 2KPJA 3FTWA 2XSDC 4I1MA 3B13A 4GPMA 2R1JL 3SR4A 1BLXB 4TV3A 3ISMC 2LO6A 4N5CA 5BV0A 2J9QA 5CEDB 4RVBA 3FTSA 4Y6CA 5C1DA 2L1PA 1QZ2A 1N94A 1KT0A 3W9GA 5T4YA 2PXUA 1HX8A 4U0SA 4TUUA 2XQ0A 1GW6A 2IO3C 3PE5A 2XCBA 3KZ3A 3KSQA 4Z58A 1RW2A 4RLYA 3GUUA 3PZ2A 2J07A 2XXPA 1WETA 3VLDA 2IVGA 2LSVA 5AENA 2FI7A 1N11A 4R7LA 3UT4A 1LCDA 4NURA 4U8YD 3VK0A 4N2SA 5LX8A 3OMTA 3K9IA 2XCCA 4NRHB 2V4LA 2X6JA 1H0AA 1INZA 3D3MA 1ELRA 1K3ZD 2IOSA 2P9KG 2P2CP 4UQZA 5AQ7A 1LCCA 1ZZCA 4KZCA 2P9IG 4I9CA 2I9CA 3MJWA 2GRMA 2R2LA 2V3CC 3Q9NC 5M72A 1X81A 4YNDA 2MXDA 2XPZA 3Q78A 3CK9A 4GMJA 5HS0A 4ANUA 4ILGA 1ZZ6A 3KAEA 5K98B 2A5UA 5KCMA 3C3OA 4TRQA 2PM6A 5B3SE 2LNIA 3UIOC 2YHEA 2PUCA 1ELKA 3PS6A 2OCCE 1MFQC 2HR2A 4I9EA 3D9OA 2XXQA 3S8QA 1QP0A 3RK6A 2F37A 5KJLA 3LCAA 5T3RA 3OKZA 3BUAA 4EECA 1U3CA 3HXBA 4NACA 4J1XA 3E32A 4APFA 4BX8A 4HQDA 1MX6A 4NDWA 2ZXWE 3UUXA 4U07A 1NA3A 4I6JA 4RQIA 1HXIA 2FO1E 3UM2A 2BKKB 5CCLA 4IWRA 3LY9A 4Q69A 3T8MA 4TXRA 4A3VA 5G04J 2ILRA 3QOUA 2FULA 5B1AE 5DSXA 2OFYA 2ODRD 3EUVA 2XCJA 2I6HA 3LDZA 2KXPC 4X4HA 5GAGi 3PUKA 5KWDA 2LLVA 3KS2A 5KNHD 3ZXSA 5FQ4A 3SCHA 4UQXA 3IHYA 1UG3A 4TXPA 2GRNB 3ONKA 4YDEA 1QZXA 3TWTA 5CMWA 4DX1A 2VYIA 5E75A 3ZW3A 2VEOA 3G2SA 3JQ1A 3MKRA 5ENOD 4DX2A 2J08A 2J49A 1WY6A 3AS4A 3FTYA 3FHEA 3FEYA 2PIJA 2GGFA 3D9LA 2WVIA 3DSUA 4JC8A 2WXHA 4ER3A 1BI8B 5EDSA 1BU9A 3ZPXA 5E76A 3I5PA 2PXVA 3B7BA 2XENA 4BSZB 4KXKB 3AS8A 2LYJA 3NZSA 4PU4C 3FUDA 1E8ZA 2Q7FA 2FBNA 3FU5A 4Z5CA 3GN5B 4JPSA 3TG4A 4P29A 4LSZE 3HXCA 3G7DA 2JABA 3CEQA 4FBIA 3LISA 2NC9A 4L2YA 5EKQD 1O1RA 3QWWA 4EQZA 1IC8A 4N39A 4KMOA 2JCGA 3KEAA 4BT9A 5JA4D 2FO7A 3ZHEA 2IJGX 4EK9A 2BUGA 2RFMA 1WG0A 1EDUA 2HCNA 3ABKE 2PQRA 4PS8A 3UI2A 1OSLA 5AYWD 3FY4A 4X4EA 4IVZA 2XS1A 1QQBA 3CVYA 2NYJA 3APCA 4LRZA 3MYVA 2C2LA 3SQVA 4PU7A 4X4CA 3HDXA 3WXXA 1D8EA 4XZ4A 1U2VG 4BFRA 4C9BB 4CGVA 4F6RD 3QDNA 2A6CA 4UI9J 3ZUVB 3CQGB 2KZTA 4GCOA 3L22A 2X6FA 3L54A 1WH6A 2H8RA 4C0EA 4ER6A 3QOWA 1N95A 1UN9A 1AU7A 5LCWJ 1IXVA 5EN5D 2IU1A 4JHKA 3R7QA 5BPPA 5EYLA 4U0ZA 4XIFA 3SCFA 1PERL 1UOHA 4DX5D 2EWTA 2Y4TA 4AXHA 2H6IA 3EU9A 3SHFA 2MEZA 2YQ8A 3JXJA 3FFLA 4PUCA 2PUFA 4GCNA 3ZIMA 2AXUA 4IRUA 4PU3C 4OVUA 3G0TA 4F7AA 1XGWA 3SD5A 1E90A 4X4BA 3B7HA 2OVBA 1N4RA 1S63A 1NL4A 1A17A 4BESA 3MLFA 3T8KA 4OYSA 4XKCA 4CYMD 5CBNA 2R63A 2AXVA 3GZCA 3QWGA 3QWPA 2F0YA 1DNPA 2KCLA 3JXDL 4GMRA 4BEPA 3JXBC 4YG7B 3ULYA 1FPPA 2H6FA 4X4IA 4UUCA 4FN3A 2LCVA 4QQIA 3CK8A 3KJXA 4F8DA 3FP3A 2XRYA 2VSYA 3UXGA 4YG1A 4ZFHA 2XEVA 2XS8A 5A7LA 2WPVA 4JEHA 5LP0A 2R02A 3NBNB 4EZKA 4CDNA 1SQ8A 3D9MA 2DYRE 3AG3E 3UT7A 1DC2A 5AAOA 3KL4A 4PH4B 2PXPA 5FIOA 2GRLA 5KJMA 1VPWA 1JFSA 2O38A 3TRBA 5FINA 2RKKA 3CVQA 1CJGA 3B7RL 5CRUA 1E8WA 3OWQA 4GA0A 4I6GA 5EX0A 3LS8A 3UFDA 5JMND 4K5AB 1JWFA 4DX6D 1MYOA 1PAQA 4FU3A 4HRAA 1B89A 2CG3A 3MGBA 4H7YA 3UKRG 3SY2A 3L17A 2RG8A 3KSLA 3IBEA 4N2QA 3L82A 3TL5A 5DT2A 4F3VA 1O1SA 3CSFA 2PXBA 4X4DA 4N5QA 4I6EA 3S7JA 4WVLA 3DSXA 3DXKG 4ANWA 1RZ4A 3F51A 4Y6WA 4UWKA 3ABLE 3D9NA 2I2OA 2E0IA 2XZDG 5ENRD 2PQNA 4K5CA 3ZHMA 1S0PA 3UM0A 3SZ7A 1V55E 4G26A 5G05J 5ENQD 1E3OC 2HINA 2KATA 2GRPB 3ASGA 3TEPA 4TXQA 2WMOA 4ILIA 3JXCL 4EPZA 1PRVA 4DPRA 2CFUA 2V0PA 4C0MA 4F1SA 3Q73A 5DBKA 2WM9A 1NW3A 3CHOA 1JPLA 2IV1A 1ZPQA 5ITZF 1TNUA 2EIJE 3SBSA 2R03A 3QFIA 3B7SA 3DEPA 3G2UA 1TNYA 2GROB 2DWZA 2CSFA 1W3BA 3ASNE 3ZKCA 4URKA 1H2UA 5D2MC 3VTXA 3CVNA 1FVHA 1LQCA 2IF4A 4N3BA 1LD7A 3CLJA 4JB8P 3T5XA 1FVFA 2LAIA 4I1OB 3CKBA 3FUIA 4BTAA 5G05C 1HG2A 3CSTA 1UJJA 3ZHIA 2P9NG 3FU0A 3TJPA 3NZLA 2PZIA 1DCEA 3FTUA 5A7DB 1JUQA 2KC7A 4FHKA 3CK7A 1IHBA 3IXEA 3TFLA 4K0RA 1SA4A 5AN8A 1PRUA 2LAHA 3OQOA 3TWVA 1ZZ8A 2PNNA 4J8FA 3VTYA 1DVPA 1N52A 2PPXA 2X38A 3F6QA 3HRAA 5JHBA 1A5EA 4J7WA 1U2ZA 1RPEL 1U3DA 4CT4A 2KEKA 1YMPA 3U66A 3UM1A 5ARFA 1IKND 4G2VA 2PXDA 5ARGA 3LY7A 4KVOA 2X6HA 5BUZA 2C0MA 4KYOB 4M3OA 1H2VC 3U3WA 4YARA 3FUNA 2NSZA 4WUYA 2JQEA 3APDA 4B89A 3LEWA 1HH8A 4A1GA 2KBXA 3QNKA 3I3NA 1MZCA 4TUMA 4JEUA 5J90A 3D1NI 3ML9A 1DULA 1TYQG 4OAVB 1TR4A 3EJNA 4E6HA 2XGOA 1TNZA 1QP7A 1ZU2A 5FQ8A 1XWRA 3KD7A 3GN5A 3MCXA 3T9KA 3NROA 3ZPJA 1TN8A 4BSXA 2RFAA 3PNLB 3QYXA 3NQPA 4GTMA 1TN7A 5T8IA 3UKUG 5CBOA 4IULA 4X8QA 4FLBA 3EHQA 3E37A 2PE5A 4EZLA 3BEEA 4KVMA 3GZSA 4J8SA 2XPYA 1WH8A 2WXMA 3PZ1A 3OTNA 4X4FA 4NIKA 3DSVA 4L2LA 2J7WA 4G23A 4WWNA 2P9UG 2MHKA 5JUWA 5BXUA 1OWLA 5HI7A 4GTSA 4YG4A 4HOQA 3C72A 4HXIA 2B5AA 1KZPA 3GW4A 1MQSA 3JXIA 3P1UA 3ZEFA 4Q2JA 2L6BA 1POUA 1Y7YA 3D9PA 3TWSA 5DRYA 1N4PA 3PEVB 4WAFA 4LNUD 4BT8A 2O49A 4U96D 3TWUA 1ZBPA 1HS6A 4FLHA 4Q94A 3V30A 1MJ0A 5AQAA 4YVQC 4F53A 4WNGA 1ZAYA 4UWFA 3UMVA 2PL2A 1X5BA 3FH5A 4GZ5A 5LCWC 4J6IA 5ANRA 1H6OA 1QQAA 4DLQA 3R7RA 3ENEA 2ONDA 2B0OE 2DCPA 5JJ6A 4EKGA 2EF8A 2WXNA 3LXUX 1NA0A 5BNWA 2QYUA 4JVSA 3PVLA 3ZNGA 3SI5A 4ACLA 1FCHA 1BDHA 3TELA 2WQ7A 4O60A 2BJCA 3NF1A 3HG0D 3V2OA 5G2NA 3IKOB 3C98A 3EHNA 3ZRHA 2FF4A 2LNMA 2DVWA 3JUEA 4I2ZA 1E8XA 4PDXA 3FMYA 1D9SA 4LNBA 1BPOA 1SVXA 4EHMA 2J7UA 4C48B 1PRAA 3HHMA 2DIWA 3HVEB 3AG4E 4GHJA 3RKVA 3DSWA 3LJNA 1SA5A
chains in the Genus database with same CATH topology
4GZCA 5JJ7A 3JXBC 2O4AA 1OCTC 4YG7B 4MS6A 4JXTA 2X3MA 4E85A 1X57A 1CQTA 2LYRA 4X4IA 2OV8A 4LCTA 4WNEA 3PNTB 3PEUB 2X6KA 3ONLA 4FN3A 4RG6A 3T5VA 2VSXE 3TGOA 1WM5A 2LCVA 1JWGA 4GQMA 1RZRD 3MV2B 4FHJA 3RRMB 4L7TA 4CRWA 4CGWA 2L0TB 3CK8A 3KJXA 4F8DA 3FP3A 4LERA 2PUGA 1ELWA 3PUJA 2XRYA 2VSYA 3CHRA 4G11A 3L1PA 4YG1A 3U64A 3ZYMA 3SFZA 4AVXA 3FTXA 4U0UA 2XEVA 2D5VA 2KZTB 5A7LA 2WXOA 2WPVA 2KCVA 1HF8A 3PREA 4JEHA 3HZIB 3D9JA 3NZUA 5LP0A 3ZGQA 4IYPA 4AP2A 5AJLA 4EZKA 3CR3A 4CDNA 1SQ8A 3R9AB 1BDIA 3CVLA 3D9MA 3OQNA 4CDMA 3QQ6A 1MHQA 3BG1B 5CCMA 2LYQA 3FUJA 3ZN3A 3MX3A 4JZYA 1HG5A 1KT1A 3UT7A 2I1KA 2FJRA 4PH4B 2XGMA 3OAWA 4I2WA 3SCGA 2GRLA 5KJMA 1VPWA 1JFSA 4U63A 4UWLA 3O48A 2WXIA 3RO2A 2O38A 3TRBA 4AJWA 1HE8A 3SBTB 3ESKA 3FUFA 1NERA 3CVXA 3FTZA 3JUIA 4I1AA 3ZFWA 5AJDA 1ZZBA 3CHSA 1EFAA 1HZ4A 3CVQA 1CJGA 2IOLA 3B7RL 3D9IA 4FA6A 1E8WA 4FP7A 4GA0A 2KPJA 4I6GA 5EX0A 1UJKA 3LS8A 3FTWA 3UFDA 2WIUB 2XSDC 1HF0A 1X2LA 1JWFA 4I1MA 1QNFA 3B13A 1PAQA 4FU3A 4CEMA 3S7FA 4DLOA 2R1JL 1EYHA 3MA5A 2EQXA 4TV3A 1B89A 3PXPA 2CG3A 3MGBA 3GYZA 4J1WA 4H7YA 4FADA 3TG5A 2LO6A 3OQMA 3L17A 2UY1B 4N5CA 4EBAG 2AXZA 2RG8A 4I17A 4J8EA 2J9QA 5BV0A 3IBEA 3QKYA 4N2QA 4RVBA 3FTSA 4U04A 3TL5A 4N3CA 2XPIA 1UXCA 1L5JA 4Y6CA 5C1DA 5FZQA 4F3VA 2R5SA 2KM4A 2WXFA 1QZ2A 1UW4B 4ACKA 1HU3A 3CSFA 4JCXA 1P5QA 2BNNA 1KT0A 1XNFA 4HVBA 4X4DA 4GZ6A 2VGXA 4KT6B 4I6EA 5T4YA 3U4TA 4MRUA 3S7JA 5JHAA 2KCKA 5D0OD 1HX8A 3GBFA 2AW6A 4U0SA 4TUUA 2XQ0A 3FULA 1GW6A 4JL0A 4ANWA 3VLFA 1UN8A 3F51A 3KZ3A 2XCBA 2VGYA 4Y6WA 4UWKA 3DBSA 3EHMA 4GAAA 3CROL 3LYAA 4GYWA 3I4GA 4Z58A 3RIBA 3UQ3A 3ML8A 5A23A 3D9NA 1PY1A 2I2OA 2WQHA 2E0IA 3R1FA 2J07A 1N54A 4FJZA 3Q47B 5BW8C 3FYMA 1Z6TA 1WETA 3CKCA 3VLDA 4A1SA 1UTXA 2PQNA 2IVGA 5LFAA 2LSVA 5KJKA 3G5GA 3ZHMA 1S0PA 2WUSR 3SZ7A 3Q5MA 3CLCA 3D9KA 4CCAA 5AENA 2FI7A 4G26A 4H7XA 5G05J 4R7LA 3UT4A 2LYPA 1E3OC 3UX4A 1LCDA 4NURA 2AVPA 2HINA 4AIFA 2KATA 3ASGA 3FU6A 3VK0A 2VJ8A 4N2SA 5LX8A 3OMTA 2WMOA 3K9IA 1LLIA 2JVLA 2XCCA 4ILIA 4GYYA 4NRHB 3U9WA 3B7TA 3JXCL 4EPZA 2V4LA 5FT9A 1PRVA 5FJYA 2X6JA 2CFUA 4DPRA 2V0PA 4C0MA 4F1SA 2V5FA 4G24A 4IN3B 1H0AA 1INZA 2MOWA 4B8CB 3ESLA 5DBKA 2WM9A 3D3MA 1ELRA 2IOSA 3L16A 3CHOA 1JPLA 1E7VA 5CHEE 2IV1A 1ZPQA 3QF3A 3FUKA 1DWKA 1WAO1 3QC1A 4UQZA 3LY8A 4EBAA 2PUEA 4GU5A 1LCCA 3S7DA 4HLEA 1GT0C 3SBSA 1ZZCA 2L8NA 3B7SA 4KZCA 4UWGA 3FDHA 2CG2A 2I9CA 3MJWA 2GRMA 4I9CA 4YVOA 2J4BA 3ASFA 3CGHA 3N71A 1IQUA 4W9RA 4DI3A 3BS3A 5M72A 3G2UA 3CQCB 4YNDA 3RJVA 2XPZA 2PUBA 3CK9A 4GMJA 4ANUA 2ZU6B 2LYKA 4XI9A 5LOZA 4GZ3A 3MV3B 2CSFA 4ILGA 4BX9A 1W3BA 4EZJA 4A55A 2WQ6A 1ZZ6A 2IONA 2BF0X 3KAEA 5K98B 2A5UA 5KCMA 5KJNA 1IQRA 3VLEA 3BD1A 3AU5A 4GZDA 3ZKCA 4JA7A 4TRQA 5D0QD 4CDRA 2PM6A 3IHVA 4URKA 2LNIA 2WXPA 1H2UA 2YHEA 2JEKA 2PUCA 3CHMA 3VTXA 1ELKA 4I8TA 1FVHA 3CVNA 3PS6A 2HR2A 1LQCA 2IF4A 4N3BA 3EIQC 4X4GA 4O6FA 2Y4UA 3CLJA 4I9EA 3D9OA 4HOUA 2ICPA 3QK0A 2CROA 3S8QA 1QP0A 3LVQE 3T5XA 4KZ0A 2OR1L 1OWOA 1FVFA 3RK6A 4UWHA 2LAIA 1ZUGA 5KJLA 2PUAA 3LCAA 4I1OB 5T3RA 3CKBA 4EECA 3FUIA 1U3CA 1E96B 4BTAA 4NACA 1R69A 4J1XA 5G05C 2VSOE 1HG2A 3CSTA 4APFA 4BX8A 1UJJA 5ANLA 4NDWA 2OVFA 3Q15A 3ZHIA 1QQEA 3FU0A 4U07A 3TJPA 3UUXA 4B94A 1NA3A 4I6JA 2PZIA 2GZUA 4GYOA 3FTUA 5A7DB 1HXIA 1JUQA 2HO1A 2IFUA 1JH9A 4MKTA 1OWPA 2KC7A 4FHKA 3TXNA 3OXLA 3DPDA 4MLPA 3CK7A 4IWRA 5CCLA 3LY9A 5FWQA 4Q69A 3Q49B 3LFPA 3AS5A 3T8MA 3HYMB 4JCYA 2XIUA 1IHGA 2P58C 4K0RA 5G04J 2ILRA 3QOUA 4L1BA 4A3VA 2FULA 5CMYA 1PRUA 2LAHA 3OQOA 1ZZ8A 3ZVVA 4J8FA 2R17C 4DI4A 3L6AA 4I43A 2OFYA 3VTYA 5BV1A 3CVUA 1DVPA 3LKUA 1N52A 4BTBA 2PPXA 2X38A 4FC8A 1SZAA 2IQCA 2XCJA 1NP7A 5JHBA 1PC2A 2FEZA 2I6HA 2VTBB 3LDZA 4IA8A 1EPUA 4UQYA 3MZLB 4X4HA 1RPEL 1ZVVA 2VTBA 1HFAA 1U3DA 1NZNA 3PUKA 4HS2A 2KEKA 4CT4A 3U66A 3L08A 2L6JA 1YSEA 1ZZ9A 5ARFA 3KS2A 3CVPA 3RO3A 1E8YA 4JHJA 3ZXSA 5AIJA 5FQ4A 3SCHA 4UQXA 2NXPA 5BT1A 4XX5A 3IHYA 4G2VA 2C0LA 1UG3A 3LY7A 5ARGA 3FU3A 1QP4A 4KVOA 2GW1A 2X6HA 2C0MA 4KYOB 3DNVB 5BUZA 3ONKA 4I6RA 4AY6A 4M3OA 5CMWA 1H2VC 3U3WA 4A3TA 2KEJA 4YARA 1Z3YA 2XI8A 2VYIA 3FUNA 2NSZA 1WIZA 2BNMA 4WUYA 4XI0A 5E75A 2XHEA 3APDA 3CHQA 3LEWA 4B89A 3ZW3A 4Y42A 3G2SA 3JQ1A 3MKRA 1HH8A 2J08A 4A1GA 5J08A 2WMNA 2IVBA 2J49A 1WY6A 3AS4A 4GMLA 4O8BA 4ATGA 2M63A 3FTYA 3QNKA 2WXKA 3QJZA 1OUVA 3I3NA 3FHEA 3FEYA 2WXJA 1VDYA 2PIJA 4JHRA 2GGFA 2YHCA 4RG9A 2LSUA 4JEUA 3D9LA 4JA9A 5J90A 4G25A 4J0UA 2WVIA 3D1NI 4JQDA 2VQ2A 3EDTB 3ML9A 4JC8A 4Z5HA 2WXHA 3KEZA 5FQ7A 3OXFA 4PS7A 4RSYA 4OB4A 3GZ1A 5EDSA 1Z3XA 4UI9K 5E76A 4B8AA 2QFCA 1TJFA 2UWJG 3EJNA 3I5PA 3BG0B 4WNDA 3UPVA 4E6HA 1H19A 2EBYA 2VSNA 2XGOA 4KXKB 1Y6IA 2LYJA 3AS8A 3FUHA 3NZSA 4PU4C 1QP7A 1ZU2A 3FUDA 1ADRA 1E8ZA 2Q7FA 2FBNA 3FU5A 1XWRA 5FQ8A 4GPKA 5EX3A 3TAXA 3KD7A 3GN5A 3ASDA 2HYZA 3MCXA 3L13A 4MCTA 3F52A 2OOEA 3ZPJA 4APOA 3PH0C 2WXQA 4Z5CA 3GN5B 4ME2A 2JLBA 4JPSA 4XE0A 3TG4A 2IU7A 4P29A 3PE4A 2PUDA 3MEKA 4YBAA 4PS3A 3URZA 3G7DA 1JWLA 2LYLA 4BSXA 4ANXA 3CEQA 3FH8A 4FBIA 3LISA 2NC9A 3PNLB 3JYSA 4L2YA 5EKQD 5FZSA 3QYXA 2A4ZA 3NQPA 1Y9QA 1IC8A 3QWWA 3TXMA 5T8IA 2AWIA 1DW9A 4N39A 4OVVA 3AU4A 4IULA 2L49A 1E7UA 1SQMA 3HIZA 4FLBA 4KMOA 4ANVA 2JCGA 4BT9A 5DIZA 1UXDA 4HORA 2ICTA 1Y8MA 2PE5A 2L0IA 2FO7A 2J09A 4K03A 4EZLA 3ZHEA 2BTDA 3BEEA 4KVMA 3SF4A 2IJGX 3GZSA 2BUGA 4ILHB 4J8SA 2BNOA 4QFVA 2VGXB 1EDUA 3FYAA 3E4BA 3OP9A 3QAQA 2XPYA 3RRNB 4ABNA 3CVWA 4L23A 4UI9C 3ULQA 3PDNA 1WH8A 2PQRA 3P2BA 4PS8A 3CIAA 3RU0A 2WXMA 1OSLA 3EIJA 2R59A 3FY4A 3OTNA 2KZ8A 3PZDA 4X4FA 5AYWD 3UT8A 4X4EA 4L2LA 4G23A 1H6KA 3OXGA 3PRZA 4WWNA 4IVZA 4WNFA 2MHKA 1QQBA 3JCKC 3QB2A 3CVYA 2V8SE 4NQ0A 3CVVA 3APCA 1OWLA 5HI7A 5FZRA 1EF1C 2AUWA 1OWMA 4LRZA 4CT0A 1LMB3 3MYVA 4FULA 4V3IA 2C2LA 3ZYLA 1L1MA 1LF8A 4PU7A 4X4CA 3KXAA 4YG4A 4J8DA 3JQ0A 4HOQA 3LPZA 3HDXA 2XJ3A 3G2WA 3IV0A 3WXXA 2MRIA 2HM8A 4XZ4A 4D10C 4HOSA 3CHPA 5G04C 4Z5DA 2B5AA 4HXIA 4LUNU 2CHZA 4BFRA 3GW4A 3S2AA 4PU8A 4C9BB 3RZZA 4CGVA 1MQSA 3P1UA 3QDNA 2A6CA 3ZEFA 4Z59A 1JFTA 3ZYQA 4UI9J 4DJAA 1POUA 1Y7YA 3D9PA 4GB9A 4JW1A 2LYSA 4N3AA 3B7UX 2KZTA 3CQGB 3CV0A 4B0ZA 5JJTA 3PEVB 4GCOA 2IVQA 1PNRA 3L22A 4WAFA 2X6FA 3FEXA 2WXGA 2O49A 3L54A 3PE3A 4BT8A 1WH6A 2H8RA 2RD0A 1ZBPA 1HS6A 4FLHA 4Q94A 4WWPA 4C0EA 3ASHA 1TEZA 2MQKA 4EQFA 4YVQC 4F53A 4XKBA 4WNGA 2E2EA 4FJYA 1ZAYA 4AV7A 4UWFA 5C2YA 3UMVA 3CECA 3QARA 2PL2A 4AEZC 2WB2A 2YINA 1X5BA 4I6TA 1AU7A 1UN9A 2KEIA 1HO8A 4G1TA 3O4ZA 5LCWJ 3APFA 3FH5A 2I1JA 2HSGA 3F6WA 3SGHA 4GZ5A 5ENNA 1RZRA 2IU1A 4JHKA 3R7QA 5LCWC 2IUOA 2CHWA 3H5TA 5BPPA 1ZZ7A 2J4DA 4J6IA 5ANRA 4U0ZA 3MKQB 4DLQA 1QQAA 3R7RA 4WWOA 3ENEA 4KBQA 2ONDA 4XIFA 4HFGA 2DCPA 3QWVA 3MKQA 5JJ6A 3SCFA 3S7BA 2EF8A 1PERL 2L9BA 4U8HA 2DBAA 2WXNA 4AY5A 1SZ9A 1OWNA 2EWTA 2Y4TA 1R63A 4LEUA 4AXHA 3LXUX 1NA0A 5BNWA 4I6UA 1O4XA 3EUSA 3FTVA 3LVRE 1ZS4A 4JVSA 3I4RB 3FH7A 3SHFA 3PVLA 2MEZA 2Y3AA 3FUEA 2XRZA 1KLXA 2YQ8A 5A6CA 3FFLA 4PUCA 1B0NA 2PUFA 3SI5A 4HOTA 4ACLA 1FCHA 1BDHA 2YNQA 2WQ7A 3ZYKA 4GCNA 5FQ6A 2BJCA 3NF1A 4DK5A 5G2NA 2AXUA 2UY1A 2WXRA 4IRUA 3ZIMA 4BY6A 4PU3C 1QPZA 3BDNA 3G2TA 3C98A 3EHNA 1YA0A 3IKOB 3ZRHA 4OVUA 4AOFA 2FF4A 5HQ8A 1RIOA 1RZSA 3GZ2A 4I2ZA 4BWRA 4F7AA 1NEQA 1S7EA 1XGWA 3FUMA 1E8XA 1E90A 4PDXA 4X4BA 3SD5A 3FMYA 2WXLA 3B7HA 4AM9A 2OVBA 3ZHEB 3FWVA 3IVPA 1A17A 3SNXA 3MLFA 4Q96A 1BPOA 2CFZA 4OYSA 4XKCA 4GA2A 4GA1A 4MCXA 3LJ3A 2R63A 5FTPA 3HVEA 5G55A 2CHXA 2AXVA 1PRAA 2XGSA 3QWGA 3QWPA 2PM7A 3HHMA 2DIWA 1H2TC 3RRUA 3G2VA 3HVEB 1IYGA 1DNPA 2KCLA 2X6IA 3JXDL 1TJCA 4GHJA 3O9XA 3Q4AB 3RKVA 2QY7A 3IEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PU7 A;  4X4C A;  1YSE A;  2WUS R;  1ZZ9 A;  3KXA A;  4YG4 A;  3ZHM A;  3CLC A;  2XJ3 A;  3JXB C;  2O4A A;  1OCT C;  4YG7 B;  3SCH A;  2LYP A;  1E3O C;  1LCD A;  2HIN A;  4Z5D A;  2B5A A;  1X57 A;  3VK0 A;  2LYR A;  4X4I A;  1CQT A;  1QP4 A;  4PU8 A;  3RZZ A;  3DNV B;  4FN3 A;  3OMT A;  4I6R A;  2LCV A;  2A6C A;  4GQM A;  2JVL A;  1RZR D;  4Z59 A;  1JFT A;  3U3W A;  1LLI A;  2KEJ A;  1POU A;  1Y7Y A;  4YAR A;  3JXC L;  2LYS A;  3KJX A;  2XI8 A;  1PRV A;  4F8D A;  1WIZ A;  2BNM A;  2PUG A;  3L1P A;  4YG1 A;  4Y42 A;  2IVQ A;  1PNR A;  2O49 A;  1WH6 A;  2IVB A;  5A7L A;  2D5V A;  2H8R A;  4O8B A;  3HZI B;  2MQK A;  2IV1 A;  1ZPQ A;  3QF3 A;  1DWK A;  2PIJ A;  2PUE A;  1LCC A;  1SQ8 A;  1GT0 C;  1ZAY A;  1ZZC A;  2L8N A;  3D1N I;  1BDI A;  4JQD A;  3CEC A;  3OQN A;  3QQ6 A;  2GRM A;  4Z5H A;  2LYQ A;  4I6T A;  1AU7 A;  2KEI A;  3BS3 A;  2PUB A;  2FJR A;  2HSG A;  4OB4 A;  3F6W A;  2LYK A;  2CSF A;  3SCG A;  2GRL A;  1RZR A;  2IUO A;  1JFS A;  1VPW A;  3H5T A;  1ZZ7 A;  2O38 A;  3TRB A;  1ZZ6 A;  1NER A;  5K98 B;  1QQA A;  3BD1 A;  2EBY A;  3ZKC A;  1ZZB A;  2LYJ A;  1EFA A;  4PU4 C;  1QP7 A;  1CJG A;  1ADR A;  3SCF A;  2EF8 A;  1XWR A;  1PER L;  2PUC A;  4I8T A;  2KPJ A;  3GN5 A;  1LQC A;  2EWT A;  3UFD A;  4X4G A;  1R63 A;  2WIU B;  3F52 A;  4MCT A;  2XSD C;  1HF0 A;  4Z5C A;  1X2L A;  3GN5 B;  4I6U A;  1O4X A;  2ICP A;  3EUS A;  2CRO A;  3S8Q A;  2IU7 A;  1ZS4 A;  1QP0 A;  2R1J L;  2PUD A;  4YBA A;  2OR1 L;  3PXP A;  2MEZ A;  3G7D A;  1JWL A;  2LYL A;  4J1W A;  1ZUG A;  1B0N A;  2PUA A;  4FBI A;  3LIS A;  3OQM A;  2PUF A;  1BDH A;  2AXZ A;  3QYX A;  1Y9Q A;  1IC8 A;  2AWI A;  1DW9 A;  1R69 A;  4J1X A;  2BJC A;  1UXC A;  2AXU A;  2L49 A;  4PU3 C;  2JCG A;  4NDW A;  3BDN A;  1QPZ A;  3ZHI A;  2GZU A;  1RIO A;  1UXD A;  4JCX A;  2ICT A;  2BNN A;  1RZS A;  2PE5 A;  4X4D A;  1JH9 A;  1NEQ A;  1S7E A;  4IWR A;  4X4B A;  3LFP A;  2BNO A;  3FMY A;  3GBF A;  4JCY A;  2XIU A;  2AW6 A;  3B7H A;  3FYA A;  3IVP A;  3OP9 A;  1PRU A;  3OQO A;  1WH8 A;  1ZZ8 A;  3MLF A;  3F51 A;  3KZ3 A;  1OSL A;  2KZ8 A;  4MCX A;  4X4F A;  3CRO L;  2R63 A;  2OFY A;  4Z58 A;  4X4E A;  2AXV A;  1PRA A;  2PPX A;  4IVZ A;  3QWG A;  3R1F A;  1QQB A;  2XCJ A;  3FYM A;  3JXD L;  4IA8 A;  2AUW A;  4GHJ A;  1WET A;  3O9X A;  1LMB 3;  1UTX A;  4X4H A;  1RPE L;  2IVG A;  1ZVV A;  1L1M A;  2KEK A;  3G5G A; 
#chains in the Genus database with same CATH topology
 1BI7 B;  1OY3 D;  2X3M A;  2OV8 A;  4LCT A;  3PEU B;  3ONL A;  4RG6 A;  2MYO A;  3T5V A;  2VSX E;  1WM5 A;  1JWG A;  5AQB A;  4L7T A;  4CRW A;  1JCR A;  3PUJ A;  3CHR A;  2YBD A;  2PXK A;  5ENS D;  3SFZ A;  4U0U A;  1LTX A;  1QB2 A;  2IO2 C;  4ER5 A;  5EYP F;  1KT1 A;  2I1K A;  2XGM A;  3UIN C;  4HBD A;  1K8K G;  4UWL A;  3O48 A;  2WXI A;  3ESK A;  3FTZ A;  4G8K A;  5DTQ A;  2V4H C;  5DTM A;  1HZ4 A;  4FP7 A;  1N4S A;  1S70 B;  1D8D A;  2ETA A;  4CEM A;  1EYH A;  3E34 A;  4J1W A;  4FAD A;  3SFX A;  4EBA G;  2AXZ A;  5CEA A;  4U04 A;  4N3C A;  2XPI A;  3ABM E;  5FZQ A;  2R5S A;  2KM4 A;  2XEH A;  1P5Q A;  4HVB A;  1XNF A;  5ENP D;  4KT6 B;  2KCK A;  3GBF A;  2VGE A;  2AW6 A;  3FUL A;  4JL0 A;  3RIB A;  3ZKJ A;  3LYA A;  4GYW A;  3UQ3 A;  2HFZ A;  1N9A A;  5IY5 E;  1N54 A;  4FJZ A;  3FYM A;  1Z6T A;  2LXL A;  4DX7 D;  1UTX A;  3NB2 A;  1YCS B;  3AAA C;  5KJK A;  3G5G A;  2WUS R;  4LG6 A;  3AG1 E;  2B6C A;  3CLC A;  3D9K A;  4CCA A;  3HXE A;  4H7X A;  3UX4 A;  3DST A;  2LYP A;  5KBA A;  2AVP A;  4AIF A;  3FU6 A;  2VJ8 A;  2PXQ A;  3Q75 A;  2R05 A;  4GYY A;  3B7T A;  3A9Y A;  2V5F A;  4G24 A;  4IN3 B;  2MOW A;  4B8C B;  3ESL A;  3L16 A;  3FUK A;  3QF3 A;  3SX0 A;  3LY8 A;  3ULE G;  4GU5 A;  1GT0 C;  3FDH A;  4DI3 A;  3CQC B;  3RJV A;  2PUB A;  4LNG A;  2ZU6 B;  3WG7 E;  4XI9 A;  5LOZ A;  3MV3 B;  2WQ6 A;  2ION A;  2BF0 X;  1N0Q A;  1IQR A;  4U95 D;  3AU5 A;  4GZD A;  4JA7 A;  5D0Q D;  4CDR A;  4A63 B;  4GTQ A;  2FFH A;  4X4G A;  2Y4U A;  3L9T A;  4HOU A;  2ICP A;  4MBG A;  2CRO A;  1TN6 A;  2OR1 L;  2Y0B G;  2GRQ B;  1G3N B;  1ZUG A;  5KNG A;  2PUA A;  1E96 B;  1R69 A;  2IY0 C;  2VSO E;  3Q15 A;  4DRX E;  4GYO A;  3NXH A;  4HI8 A;  1JH9 A;  4MKT A;  3TXN A;  5FWQ A;  3Q49 B;  3LFP A;  3HYM B;  2XIU A;  4L1B A;  5CMY A;  1HQ1 A;  3UTM A;  5BV1 A;  4BTB A;  4FC8 A;  1NP7 A;  4IA8 A;  2Y1L E;  3MZL B;  2VTB A;  1HFA A;  4HS2 A;  1NZN A;  3L08 A;  1ZZ9 A;  3RO3 A;  2XXA A;  5AIJ A;  3V31 A;  2NXP A;  2C0L A;  4L9P A;  3FU3 A;  1QP4 A;  2XZT G;  2GW1 A;  4I6R A;  1OCC E;  2ZIS A;  4YDO A;  4XI0 A;  4M7C A;  2BNM A;  2XHE A;  3CHQ A;  5J08 A;  2WMN A;  3MEJ A;  4ATG A;  4O8B A;  1JCS A;  2M63 A;  3QJZ A;  1OUV A;  4JHR A;  2WXJ A;  1VDY A;  4O1P A;  5AQ9 A;  2ZIR A;  2LUH A;  1QYM A;  4Z5H A;  5FQ7 A;  4RSY A;  2EIL E;  3ASO E;  4UI9 K;  2QFC A;  2UWJ G;  4WND A;  2EBY A;  1Y6I A;  3FUH A;  5B1B E;  4HB5 A;  5H7P A;  4GPK A;  3TAX A;  5BXO A;  3L13 A;  2OOE A;  4APO A;  2H6G A;  2IU7 A;  2PUD A;  2QZA A;  4YBA A;  1O1T A;  4PS3 A;  1JWL A;  4ER0 A;  3JYS A;  1Y9Q A;  3TXM A;  2AWI A;  4OVV A;  3DWL G;  3AU4 A;  2L49 A;  1E7U A;  3HIZ A;  4HOR A;  2ICT A;  1Y8M A;  2L0I A;  3SF4 A;  5CER B;  2BNO A;  3FYA A;  4ABN A;  3RRN B;  4UI9 C;  3PDN A;  3P2B A;  2KZ8 A;  1NFI E;  1Z5S C;  3PRZ A;  2ETB A;  4WNF A;  3JCK C;  3QB2 A;  2V8S E;  4NQ0 A;  2ETC A;  1EF1 C;  4FUL A;  1L1M A;  4J8D A;  3E33 A;  4ER7 A;  3JQ0 A;  3LPZ A;  2XJ3 A;  2HM8 A;  4HOS A;  5G04 C;  3X2Q E;  4DE8 A;  4PU8 A;  3RZZ A;  1AP7 A;  4GTO A;  4DJA A;  1JFT A;  3ZYQ A;  2AJA A;  4JW1 A;  4GB9 A;  4N3A A;  5JJT A;  4Z68 A;  3PE3 A;  2RD0 A;  1SW6 A;  5EID A;  3ASH A;  4HRM B;  4FJY A;  4AEZ C;  2WB2 A;  2KEI A;  4G1T A;  3EU5 A;  2PXL A;  2HSG A;  3F6W A;  3RAU A;  2F8Y A;  2CHW A;  1ZZ7 A;  2J4D A;  5CEC B;  3MKQ A;  2L9B A;  2DBA A;  5GAH i;  1SZ9 A;  2QYJ A;  4LEU A;  3EUS A;  3FTV A;  1ZS4 A;  3I4R B;  3FH7 A;  3FUE A;  2XRZ A;  1KLX A;  4HOT A;  1B0N A;  2YNQ A;  3ZYK A;  1ZB1 A;  4DK5 A;  2UY1 A;  4BY6 A;  4GTP A;  4AOF A;  1DCQ A;  1RIO A;  1RZS A;  4BWR A;  1NEQ A;  1S7E A;  4AM9 A;  3ZHE B;  3FWV A;  4BET A;  2GRR B;  4Q96 A;  2CFZ A;  5ENT D;  4GA1 A;  5FTP A;  4U7E B;  3HVE A;  3V79 K;  2XGS A;  2PM7 A;  2LXM A;  3RRU A;  1IYG A;  1TJC A;  3O9X A;  3Q4A B;  3IEG A;  2O4A A;  4MS6 A;  4JXT A;  3TWQ A;  4E85 A;  1CQT A;  3PNT B;  4O1O A;  2X6K A;  4ZHB A;  3TGO A;  1RZR D;  3MV2 B;  1TNB A;  2PUG A;  3HXD A;  2EIM E;  4AVX A;  3FTX A;  2D5V A;  2KZT B;  2WXO A;  3HZI B;  3D9J A;  3NZU A;  3ZGQ A;  4AP2 A;  5AJL A;  3CR3 A;  3R9A B;  3LQX A;  1BDI A;  3QQ6 A;  1MHQ A;  3DSS A;  3BG1 B;  5CCM A;  2LYQ A;  3MX3 A;  1HG5 A;  2FJR A;  3OAW A;  4I2W A;  3SCG A;  3RO2 A;  4AJW A;  3CVX A;  2EIK E;  3NAW A;  3Q79 A;  1FT1 A;  3ZFW A;  5AJD A;  1ZZB A;  3CHS A;  1EFA A;  4HRN A;  1UJK A;  2WIU B;  1HF0 A;  1X2L A;  1QNF A;  4DLO A;  3S7F A;  3MA5 A;  3AJI A;  2EQX A;  3J5P A;  3PXP A;  1V54 E;  3GYZ A;  3TG5 A;  3OQM A;  2UY1 B;  1BD8 A;  4I17 A;  4J8E A;  3QKY A;  1UXC A;  1L5J A;  2WXF A;  4ACK A;  1UW4 B;  1HU3 A;  4JCX A;  2BNN A;  4GZ6 A;  2VGX A;  3U4T A;  4MRU A;  5JHA A;  2Y69 E;  5D0O D;  4HNA D;  4OBM A;  1UN8 A;  2VGY A;  4GAA A;  3DBS A;  3EHM A;  3CRO L;  1OCR E;  3I4G A;  3ML8 A;  3SFY A;  5A23 A;  4DE9 A;  2OEW A;  1PY1 A;  3C3R A;  2WQH A;  3R1F A;  4GTT A;  3Q47 B;  2BED A;  4G8L A;  5BW8 C;  3CKC A;  4A1S A;  5LFA A;  3Q5M A;  3A9X A;  1K1A A;  3VWS A;  1AWC B;  3DRA A;  3W9F A;  3R9M A;  3DXM G;  1LLI A;  2JVL A;  3NOC D;  3U9W A;  5FT9 A;  5FJY A;  2OEV A;  1O5M A;  5DRT A;  1E7V A;  5CHE E;  4EBA A;  1DWK A;  1WAO 1;  3QC1 A;  2PUE A;  3S7D A;  4HLE A;  4UWG A;  2L8N A;  3V2X A;  5FQ6 A;  2CG2 A;  3EHR A;  3BQO A;  3DM5 A;  4YVO A;  3ZXP A;  2J4B A;  3ASF A;  3CGH A;  3N71 A;  1IQU A;  4W9R A;  3BS3 A;  3C5R A;  2LYK A;  4GZ3 A;  4BX9 A;  4EZJ A;  5D66 A;  4A55 A;  2XEE A;  5KJN A;  3VLE A;  3BD1 A;  3TWW A;  3IHV A;  2WXP A;  2JEK A;  4CZ2 D;  3CHM A;  3UM3 A;  4I8T A;  4OAU C;  4XEI G;  3EIQ C;  4O6F A;  3QK0 A;  3LVQ E;  4KZ0 A;  1OWO A;  4UWH A;  3A9Z A;  4GTR A;  5ANL A;  2OVF A;  1QQE A;  4B94 A;  2GZU A;  1KZO A;  2HO1 A;  2IFU A;  1OWP A;  3OXL A;  3DPD A;  4MLP A;  3AS5 A;  4JCY A;  1IHG A;  2P58 C;  2DZN A;  4B0Z A;  3ZVV A;  2R17 C;  4DI4 A;  3L6A A;  4I43 A;  3CVU A;  3LKU A;  3Q7F A;  1SZA A;  2IQC A;  1PC2 A;  2FEZ A;  4J8Y A;  2VTB B;  3RSE G;  1EPU A;  3GZD A;  4UQY A;  1ZVV A;  3BU8 A;  1FT2 A;  1OT8 A;  2L6J A;  1YSE A;  3CVP A;  3QOX A;  1E8Y A;  4JHJ A;  5BT1 A;  3DPY A;  4XX5 A;  5HRY A;  4YDY A;  3DNV B;  5HKP A;  4AY6 A;  4A3T A;  2M4H A;  2KEJ A;  1WDY A;  1Z3Y A;  2XI8 A;  1WIZ A;  4U8V D;  4Y42 A;  2IVB A;  4GML A;  1NI1 A;  2WXK A;  2YHC A;  4RG9 A;  2LSU A;  2P9P G;  4JA9 A;  4G25 A;  4J0U A;  4JQD A;  2VQ2 A;  2QC9 A;  3EDT B;  3KEZ A;  3OXF A;  4PS7 A;  2DZO A;  4OB4 A;  4F1P A;  3HXF A;  3GZ1 A;  1Z3X A;  4B8A A;  2LLW A;  1TJF A;  3BG0 B;  2A5E A;  4B93 B;  3UPV A;  1H19 A;  2VSN A;  2P9L G;  1ADR A;  5EX3 A;  3ASD A;  2HYZ A;  2PXE A;  4MCT A;  3F52 A;  3PH0 C;  2WXQ A;  4ME2 A;  4XE0 A;  2JLB A;  3PE4 A;  3MEK A;  1TNO A;  2ZGG A;  3D9H A;  3URZ A;  2LYL A;  4ANX A;  3FH8 A;  3VLF A;  5FZS A;  2HE0 A;  2A4Z A;  1DW9 A;  3NOG D;  1SQM A;  4ANV A;  4BER A;  5DIZ A;  1UXD A;  4K03 A;  2PXF A;  2J09 A;  3TWR A;  2BTD A;  4EKI A;  5EIL A;  4ILH B;  4QFV A;  4ATZ D;  2VGX B;  3E4B A;  3OP9 A;  3QAQ A;  4HRL A;  4K5B A;  3CVW A;  4L23 A;  2V5Q C;  5CRV A;  3ULQ A;  3CIA A;  1OCO E;  2BKG A;  3EIJ A;  3PZD A;  2R59 A;  3RU0 A;  3UT8 A;  4JD2 G;  1H6K A;  3OXG A;  3CVV A;  5FZR A;  2AUW A;  1OWM A;  4CT0 A;  1LMB 3;  4V3I A;  3ZYL A;  1LF8 A;  3TWX A;  3KXA A;  3C3Q A;  3E30 A;  3PZ4 A;  3G2W A;  3IV0 A;  2MRI A;  4D10 C;  3CHP A;  4Z5D A;  4LUN U;  2CHZ A;  3S2A A;  2J8S D;  4Z59 A;  1MX2 A;  2LYS A;  3B7U X;  3CV0 A;  2IVQ A;  1PNR A;  3FEX A;  3ME5 A;  2WXG A;  1OXJ A;  3ZU7 B;  4WWP A;  3GZD C;  1TEZ A;  2MQK A;  4EQF A;  4EZI A;  4XKB A;  3AG2 E;  2E2E A;  4AV7 A;  5C2Y A;  1OCZ E;  3CEC A;  3QAR A;  1JCQ A;  2YIN A;  4YDW A;  4I6T A;  1H6P A;  1HO8 A;  3O4Z A;  2ZGD A;  3APF A;  5AAR A;  2I1J A;  3SGH A;  3NDB B;  5ENN A;  2F8X K;  1LD8 A;  1RZR A;  2IUO A;  4HLL A;  3H5T A;  3DEO A;  3MKQ B;  4WWO A;  4KBQ A;  4HFG A;  3QWV A;  3S7B A;  4U8H A;  4AY5 A;  1OWN A;  1R63 A;  1N4Q A;  2HCS A;  4I6U A;  1O4X A;  3LVR E;  3R09 A;  3J5Q B;  2Y3A A;  4DUI A;  5A6C A;  2WXR A;  1QPZ A;  3BDN A;  3G2T A;  1YA0 A;  1Q2Z A;  5HQ8 A;  3SO8 A;  3GZ2 A;  3FUM A;  2WXL A;  1YYH A;  3IVP A;  3SNX A;  2P9S G;  4GA2 A;  4MCX A;  3LJ3 A;  5G55 A;  2CHX A;  2H6H A;  1H2T C;  3G2V A;  3Q7A A;  2X6I A;  2QY7 A;  2IEJ A;  3PZ3 A;  5EIB E;  4GZC A;  3B95 A;  5JJ7 A;  1OCT C;  3Q9U C;  2DYS E;  1MX4 A;  1X57 A;  2LYR A;  4WNE A;  4GQM A;  4FHJ A;  3RRM B;  4CGW A;  2L0T B;  4LER A;  4G11 A;  1ELW A;  1S64 A;  3L1P A;  3U64 A;  3ZYM A;  3UIP C;  3PRE A;  1QBQ A;  2KCV A;  1HF8 A;  4IYP A;  2PXT A;  4CDM A;  3CVL A;  3OQN A;  1K1B A;  3FUJ A;  3ZN3 A;  4JZY A;  4HI9 A;  1KPS B;  4U63 A;  1HE8 A;  2EIN E;  3SBT B;  3FUF A;  1NER A;  4I1A A;  3JUI A;  3M9L A;  5DTR A;  1N0R A;  3UWP A;  4GTV A;  2IOL A;  3D9I A;  4FA6 A;  2KPJ A;  3FTW A;  2XSD C;  4I1M A;  3B13 A;  4GPM A;  2R1J L;  3SR4 A;  1BLX B;  4TV3 A;  3ISM C;  2LO6 A;  4N5C A;  5BV0 A;  2J9Q A;  5CED B;  4RVB A;  3FTS A;  4Y6C A;  5C1D A;  2L1P A;  1QZ2 A;  1N94 A;  1KT0 A;  3W9G A;  5T4Y A;  2PXU A;  1HX8 A;  4U0S A;  4TUU A;  2XQ0 A;  1GW6 A;  2IO3 C;  3PE5 A;  2XCB A;  3KZ3 A;  3KSQ A;  4Z58 A;  1RW2 A;  4RLY A;  3GUU A;  3PZ2 A;  2J07 A;  2XXP A;  1WET A;  3VLD A;  2IVG A;  2LSV A;  5AEN A;  2FI7 A;  1N11 A;  4R7L A;  3UT4 A;  1LCD A;  4NUR A;  4U8Y D;  3VK0 A;  4N2S A;  5LX8 A;  3OMT A;  3K9I A;  2XCC A;  4NRH B;  2V4L A;  2X6J A;  1H0A A;  1INZ A;  3D3M A;  1ELR A;  1K3Z D;  2IOS A;  2P9K G;  2P2C P;  4UQZ A;  5AQ7 A;  1LCC A;  1ZZC A;  4KZC A;  2P9I G;  4I9C A;  2I9C A;  3MJW A;  2GRM A;  2R2L A;  2V3C C;  3Q9N C;  5M72 A;  1X81 A;  4YND A;  2MXD A;  2XPZ A;  3Q78 A;  3CK9 A;  4GMJ A;  5HS0 A;  4ANU A;  4ILG A;  1ZZ6 A;  3KAE A;  5K98 B;  2A5U A;  5KCM A;  3C3O A;  4TRQ A;  2PM6 A;  5B3S E;  2LNI A;  3UIO C;  2YHE A;  2PUC A;  1ELK A;  3PS6 A;  2OCC E;  1MFQ C;  2HR2 A;  4I9E A;  3D9O A;  2XXQ A;  3S8Q A;  1QP0 A;  3RK6 A;  2F37 A;  5KJL A;  3LCA A;  5T3R A;  3OKZ A;  3BUA A;  4EEC A;  1U3C A;  3HXB A;  4NAC A;  4J1X A;  3E32 A;  4APF A;  4BX8 A;  4HQD A;  1MX6 A;  4NDW A;  2ZXW E;  3UUX A;  4U07 A;  1NA3 A;  4I6J A;  4RQI A;  1HXI A;  2FO1 E;  3UM2 A;  2BKK B;  5CCL A;  4IWR A;  3LY9 A;  4Q69 A;  3T8M A;  4TXR A;  4A3V A;  5G04 J;  2ILR A;  3QOU A;  2FUL A;  5B1A E;  5DSX A;  2OFY A;  2ODR D;  3EUV A;  2XCJ A;  2I6H A;  3LDZ A;  2KXP C;  4X4H A;  5GAG i;  3PUK A;  5KWD A;  2LLV A;  3KS2 A;  5KNH D;  3ZXS A;  5FQ4 A;  3SCH A;  4UQX A;  3IHY A;  1UG3 A;  4TXP A;  2GRN B;  3ONK A;  4YDE A;  1QZX A;  3TWT A;  5CMW A;  4DX1 A;  2VYI A;  5E75 A;  3ZW3 A;  2VEO A;  3G2S A;  3JQ1 A;  3MKR A;  5ENO D;  4DX2 A;  2J08 A;  2J49 A;  1WY6 A;  3AS4 A;  3FTY A;  3FHE A;  3FEY A;  2PIJ A;  2GGF A;  3D9L A;  2WVI A;  3DSU A;  4JC8 A;  2WXH A;  4ER3 A;  1BI8 B;  5EDS A;  1BU9 A;  3ZPX A;  5E76 A;  3I5P A;  2PXV A;  3B7B A;  2XEN A;  4BSZ B;  4KXK B;  3AS8 A;  2LYJ A;  3NZS A;  4PU4 C;  3FUD A;  1E8Z A;  2Q7F A;  2FBN A;  3FU5 A;  4Z5C A;  3GN5 B;  4JPS A;  3TG4 A;  4P29 A;  4LSZ E;  3HXC A;  3G7D A;  2JAB A;  3CEQ A;  4FBI A;  3LIS A;  2NC9 A;  4L2Y A;  5EKQ D;  1O1R A;  3QWW A;  4EQZ A;  1IC8 A;  4N39 A;  4KMO A;  2JCG A;  3KEA A;  4BT9 A;  5JA4 D;  2FO7 A;  3ZHE A;  2IJG X;  4EK9 A;  2BUG A;  2RFM A;  1WG0 A;  1EDU A;  2HCN A;  3ABK E;  2PQR A;  4PS8 A;  3UI2 A;  1OSL A;  5AYW D;  3FY4 A;  4X4E A;  4IVZ A;  2XS1 A;  1QQB A;  3CVY A;  2NYJ A;  3APC A;  4LRZ A;  3MYV A;  2C2L A;  3SQV A;  4PU7 A;  4X4C A;  3HDX A;  3WXX A;  1D8E A;  4XZ4 A;  1U2V G;  4BFR A;  4C9B B;  4CGV A;  4F6R D;  3QDN A;  2A6C A;  4UI9 J;  3ZUV B;  3CQG B;  2KZT A;  4GCO A;  3L22 A;  2X6F A;  3L54 A;  1WH6 A;  2H8R A;  4C0E A;  4ER6 A;  3QOW A;  1N95 A;  1UN9 A;  1AU7 A;  5LCW J;  1IXV A;  5EN5 D;  2IU1 A;  4JHK A;  3R7Q A;  5BPP A;  5EYL A;  4U0Z A;  4XIF A;  3SCF A;  1PER L;  1UOH A;  4DX5 D;  2EWT A;  2Y4T A;  4AXH A;  2H6I A;  3EU9 A;  3SHF A;  2MEZ A;  2YQ8 A;  3JXJ A;  3FFL A;  4PUC A;  2PUF A;  4GCN A;  3ZIM A;  2AXU A;  4IRU A;  4PU3 C;  4OVU A;  3G0T A;  4F7A A;  1XGW A;  3SD5 A;  1E90 A;  4X4B A;  3B7H A;  2OVB A;  1N4R A;  1S63 A;  1NL4 A;  1A17 A;  4BES A;  3MLF A;  3T8K A;  4OYS A;  4XKC A;  4CYM D;  5CBN A;  2R63 A;  2AXV A;  3GZC A;  3QWG A;  3QWP A;  2F0Y A;  1DNP A;  2KCL A;  3JXD L;  4GMR A;  4BEP A;  3JXB C;  4YG7 B;  3ULY A;  1FPP A;  2H6F A;  4X4I A;  4UUC A;  4FN3 A;  2LCV A;  4QQI A;  3CK8 A;  3KJX A;  4F8D A;  3FP3 A;  2XRY A;  2VSY A;  3UXG A;  4YG1 A;  4ZFH A;  2XEV A;  2XS8 A;  5A7L A;  2WPV A;  4JEH A;  5LP0 A;  2R02 A;  3NBN B;  4EZK A;  4CDN A;  1SQ8 A;  3D9M A;  2DYR E;  3AG3 E;  3UT7 A;  1DC2 A;  5AAO A;  3KL4 A;  4PH4 B;  2PXP A;  5FIO A;  2GRL A;  5KJM A;  1VPW A;  1JFS A;  2O38 A;  3TRB A;  5FIN A;  2RKK A;  3CVQ A;  1CJG A;  3B7R L;  5CRU A;  1E8W A;  3OWQ A;  4GA0 A;  4I6G A;  5EX0 A;  3LS8 A;  3UFD A;  5JMN D;  4K5A B;  1JWF A;  4DX6 D;  1MYO A;  1PAQ A;  4FU3 A;  4HRA A;  1B89 A;  2CG3 A;  3MGB A;  4H7Y A;  3UKR G;  3SY2 A;  3L17 A;  2RG8 A;  3KSL A;  3IBE A;  4N2Q A;  3L82 A;  3TL5 A;  5DT2 A;  4F3V A;  1O1S A;  3CSF A;  2PXB A;  4X4D A;  4N5Q A;  4I6E A;  3S7J A;  4WVL A;  3DSX A;  3DXK G;  4ANW A;  1RZ4 A;  3F51 A;  4Y6W A;  4UWK A;  3ABL E;  3D9N A;  2I2O A;  2E0I A;  2XZD G;  5ENR D;  2PQN A;  4K5C A;  3ZHM A;  1S0P A;  3UM0 A;  3SZ7 A;  1V55 E;  4G26 A;  5G05 J;  5ENQ D;  1E3O C;  2HIN A;  2KAT A;  2GRP B;  3ASG A;  3TEP A;  4TXQ A;  2WMO A;  4ILI A;  3JXC L;  4EPZ A;  1PRV A;  4DPR A;  2CFU A;  2V0P A;  4C0M A;  4F1S A;  3Q73 A;  5DBK A;  2WM9 A;  1NW3 A;  3CHO A;  1JPL A;  2IV1 A;  1ZPQ A;  5ITZ F;  1TNU A;  2EIJ E;  3SBS A;  2R03 A;  3QFI A;  3B7S A;  3DEP A;  3G2U A;  1TNY A;  2GRO B;  2DWZ A;  2CSF A;  1W3B A;  3ASN E;  3ZKC A;  4URK A;  1H2U A;  5D2M C;  3VTX A;  3CVN A;  1FVH A;  1LQC A;  2IF4 A;  4N3B A;  1LD7 A;  3CLJ A;  4JB8 P;  3T5X A;  1FVF A;  2LAI A;  4I1O B;  3CKB A;  3FUI A;  4BTA A;  5G05 C;  1HG2 A;  3CST A;  1UJJ A;  3ZHI A;  2P9N G;  3FU0 A;  3TJP A;  3NZL A;  2PZI A;  1DCE A;  3FTU A;  5A7D B;  1JUQ A;  2KC7 A;  4FHK A;  3CK7 A;  1IHB A;  3IXE A;  3TFL A;  4K0R A;  1SA4 A;  5AN8 A;  1PRU A;  2LAH A;  3OQO A;  3TWV A;  1ZZ8 A;  2PNN A;  4J8F A;  3VTY A;  1DVP A;  1N52 A;  2PPX A;  2X38 A;  3F6Q A;  3HRA A;  5JHB A;  1A5E A;  4J7W A;  1U2Z A;  1RPE L;  1U3D A;  4CT4 A;  2KEK A;  1YMP A;  3U66 A;  3UM1 A;  5ARF A;  1IKN D;  4G2V A;  2PXD A;  5ARG A;  3LY7 A;  4KVO A;  2X6H A;  5BUZ A;  2C0M A;  4KYO B;  4M3O A;  1H2V C;  3U3W A;  4YAR A;  3FUN A;  2NSZ A;  4WUY A;  2JQE A;  3APD A;  4B89 A;  3LEW A;  1HH8 A;  4A1G A;  2KBX A;  3QNK A;  3I3N A;  1MZC A;  4TUM A;  4JEU A;  5J90 A;  3D1N I;  3ML9 A;  1DUL A;  1TYQ G;  4OAV B;  1TR4 A;  3EJN A;  4E6H A;  2XGO A;  1TNZ A;  1QP7 A;  1ZU2 A;  5FQ8 A;  1XWR A;  3KD7 A;  3GN5 A;  3MCX A;  3T9K A;  3NRO A;  3ZPJ A;  1TN8 A;  4BSX A;  2RFA A;  3PNL B;  3QYX A;  3NQP A;  4GTM A;  1TN7 A;  5T8I A;  3UKU G;  5CBO A;  4IUL A;  4X8Q A;  4FLB A;  3EHQ A;  3E37 A;  2PE5 A;  4EZL A;  3BEE A;  4KVM A;  3GZS A;  4J8S A;  2XPY A;  1WH8 A;  2WXM A;  3PZ1 A;  3OTN A;  4X4F A;  4NIK A;  3DSV A;  4L2L A;  2J7W A;  4G23 A;  4WWN A;  2P9U G;  2MHK A;  5JUW A;  5BXU A;  1OWL A;  5HI7 A;  4GTS A;  4YG4 A;  4HOQ A;  3C72 A;  4HXI A;  2B5A A;  1KZP A;  3GW4 A;  1MQS A;  3JXI A;  3P1U A;  3ZEF A;  4Q2J A;  2L6B A;  1POU A;  1Y7Y A;  3D9P A;  3TWS A;  5DRY A;  1N4P A;  3PEV B;  4WAF A;  4LNU D;  4BT8 A;  2O49 A;  4U96 D;  3TWU A;  1ZBP A;  1HS6 A;  4FLH A;  4Q94 A;  3V30 A;  1MJ0 A;  5AQA A;  4YVQ C;  4F53 A;  4WNG A;  1ZAY A;  4UWF A;  3UMV A;  2PL2 A;  1X5B A;  3FH5 A;  4GZ5 A;  5LCW C;  4J6I A;  5ANR A;  1H6O A;  1QQA A;  4DLQ A;  3R7R A;  3ENE A;  2OND A;  2B0O E;  2DCP A;  5JJ6 A;  4EKG A;  2EF8 A;  2WXN A;  3LXU X;  1NA0 A;  5BNW A;  2QYU A;  4JVS A;  3PVL A;  3ZNG A;  3SI5 A;  4ACL A;  1FCH A;  1BDH A;  3TEL A;  2WQ7 A;  4O60 A;  2BJC A;  3NF1 A;  3HG0 D;  3V2O A;  5G2N A;  3IKO B;  3C98 A;  3EHN A;  3ZRH A;  2FF4 A;  2LNM A;  2DVW A;  3JUE A;  4I2Z A;  1E8X A;  4PDX A;  3FMY A;  1D9S A;  4LNB A;  1BPO A;  1SVX A;  4EHM A;  2J7U A;  4C48 B;  1PRA A;  3HHM A;  2DIW A;  3HVE B;  3AG4 E;  4GHJ A;  3RKV A;  3DSW A;  3LJN A;  1SA5 A; 
#chains in the Genus database with same CATH homology
 4GZC A;  5JJ7 A;  3JXB C;  2O4A A;  1OCT C;  4YG7 B;  4MS6 A;  4JXT A;  2X3M A;  4E85 A;  1X57 A;  1CQT A;  2LYR A;  4X4I A;  2OV8 A;  4LCT A;  4WNE A;  3PNT B;  3PEU B;  2X6K A;  3ONL A;  4FN3 A;  4RG6 A;  3T5V A;  2VSX E;  3TGO A;  1WM5 A;  2LCV A;  1JWG A;  4GQM A;  1RZR D;  3MV2 B;  4FHJ A;  3RRM B;  4L7T A;  4CRW A;  4CGW A;  2L0T B;  3CK8 A;  3KJX A;  4F8D A;  3FP3 A;  4LER A;  2PUG A;  1ELW A;  3PUJ A;  2XRY A;  2VSY A;  3CHR A;  4G11 A;  3L1P A;  4YG1 A;  3U64 A;  3ZYM A;  3SFZ A;  4AVX A;  3FTX A;  4U0U A;  2XEV A;  2D5V A;  2KZT B;  5A7L A;  2WXO A;  2WPV A;  2KCV A;  1HF8 A;  3PRE A;  4JEH A;  3HZI B;  3D9J A;  3NZU A;  5LP0 A;  3ZGQ A;  4IYP A;  4AP2 A;  5AJL A;  4EZK A;  3CR3 A;  4CDN A;  1SQ8 A;  3R9A B;  1BDI A;  3CVL A;  3D9M A;  3OQN A;  4CDM A;  3QQ6 A;  1MHQ A;  3BG1 B;  5CCM A;  2LYQ A;  3FUJ A;  3ZN3 A;  3MX3 A;  4JZY A;  1HG5 A;  1KT1 A;  3UT7 A;  2I1K A;  2FJR A;  4PH4 B;  2XGM A;  3OAW A;  4I2W A;  3SCG A;  2GRL A;  5KJM A;  1VPW A;  1JFS A;  4U63 A;  4UWL A;  3O48 A;  2WXI A;  3RO2 A;  2O38 A;  3TRB A;  4AJW A;  1HE8 A;  3SBT B;  3ESK A;  3FUF A;  1NER A;  3CVX A;  3FTZ A;  3JUI A;  4I1A A;  3ZFW A;  5AJD A;  1ZZB A;  3CHS A;  1EFA A;  1HZ4 A;  3CVQ A;  1CJG A;  2IOL A;  3B7R L;  3D9I A;  4FA6 A;  1E8W A;  4FP7 A;  4GA0 A;  2KPJ A;  4I6G A;  5EX0 A;  1UJK A;  3LS8 A;  3FTW A;  3UFD A;  2WIU B;  2XSD C;  1HF0 A;  1X2L A;  1JWF A;  4I1M A;  1QNF A;  3B13 A;  1PAQ A;  4FU3 A;  4CEM A;  3S7F A;  4DLO A;  2R1J L;  1EYH A;  3MA5 A;  2EQX A;  4TV3 A;  1B89 A;  3PXP A;  2CG3 A;  3MGB A;  3GYZ A;  4J1W A;  4H7Y A;  4FAD A;  3TG5 A;  2LO6 A;  3OQM A;  3L17 A;  2UY1 B;  4N5C A;  4EBA G;  2AXZ A;  2RG8 A;  4I17 A;  4J8E A;  2J9Q A;  5BV0 A;  3IBE A;  3QKY A;  4N2Q A;  4RVB A;  3FTS A;  4U04 A;  3TL5 A;  4N3C A;  2XPI A;  1UXC A;  1L5J A;  4Y6C A;  5C1D A;  5FZQ A;  4F3V A;  2R5S A;  2KM4 A;  2WXF A;  1QZ2 A;  1UW4 B;  4ACK A;  1HU3 A;  3CSF A;  4JCX A;  1P5Q A;  2BNN A;  1KT0 A;  1XNF A;  4HVB A;  4X4D A;  4GZ6 A;  2VGX A;  4KT6 B;  4I6E A;  5T4Y A;  3U4T A;  4MRU A;  3S7J A;  5JHA A;  2KCK A;  5D0O D;  1HX8 A;  3GBF A;  2AW6 A;  4U0S A;  4TUU A;  2XQ0 A;  3FUL A;  1GW6 A;  4JL0 A;  4ANW A;  3VLF A;  1UN8 A;  3F51 A;  3KZ3 A;  2XCB A;  2VGY A;  4Y6W A;  4UWK A;  3DBS A;  3EHM A;  4GAA A;  3CRO L;  3LYA A;  4GYW A;  3I4G A;  4Z58 A;  3RIB A;  3UQ3 A;  3ML8 A;  5A23 A;  3D9N A;  1PY1 A;  2I2O A;  2WQH A;  2E0I A;  3R1F A;  2J07 A;  1N54 A;  4FJZ A;  3Q47 B;  5BW8 C;  3FYM A;  1Z6T A;  1WET A;  3CKC A;  3VLD A;  4A1S A;  1UTX A;  2PQN A;  2IVG A;  5LFA A;  2LSV A;  5KJK A;  3G5G A;  3ZHM A;  1S0P A;  2WUS R;  3SZ7 A;  3Q5M A;  3CLC A;  3D9K A;  4CCA A;  5AEN A;  2FI7 A;  4G26 A;  4H7X A;  5G05 J;  4R7L A;  3UT4 A;  2LYP A;  1E3O C;  3UX4 A;  1LCD A;  4NUR A;  2AVP A;  2HIN A;  4AIF A;  2KAT A;  3ASG A;  3FU6 A;  3VK0 A;  2VJ8 A;  4N2S A;  5LX8 A;  3OMT A;  2WMO A;  3K9I A;  1LLI A;  2JVL A;  2XCC A;  4ILI A;  4GYY A;  4NRH B;  3U9W A;  3B7T A;  3JXC L;  4EPZ A;  2V4L A;  5FT9 A;  1PRV A;  5FJY A;  2X6J A;  2CFU A;  4DPR A;  2V0P A;  4C0M A;  4F1S A;  2V5F A;  4G24 A;  4IN3 B;  1H0A A;  1INZ A;  2MOW A;  4B8C B;  3ESL A;  5DBK A;  2WM9 A;  3D3M A;  1ELR A;  2IOS A;  3L16 A;  3CHO A;  1JPL A;  1E7V A;  5CHE E;  2IV1 A;  1ZPQ A;  3QF3 A;  3FUK A;  1DWK A;  1WAO 1;  3QC1 A;  4UQZ A;  3LY8 A;  4EBA A;  2PUE A;  4GU5 A;  1LCC A;  3S7D A;  4HLE A;  1GT0 C;  3SBS A;  1ZZC A;  2L8N A;  3B7S A;  4KZC A;  4UWG A;  3FDH A;  2CG2 A;  2I9C A;  3MJW A;  2GRM A;  4I9C A;  4YVO A;  2J4B A;  3ASF A;  3CGH A;  3N71 A;  1IQU A;  4W9R A;  4DI3 A;  3BS3 A;  5M72 A;  3G2U A;  3CQC B;  4YND A;  3RJV A;  2XPZ A;  2PUB A;  3CK9 A;  4GMJ A;  4ANU A;  2ZU6 B;  2LYK A;  4XI9 A;  5LOZ A;  4GZ3 A;  3MV3 B;  2CSF A;  4ILG A;  4BX9 A;  1W3B A;  4EZJ A;  4A55 A;  2WQ6 A;  1ZZ6 A;  2ION A;  2BF0 X;  3KAE A;  5K98 B;  2A5U A;  5KCM A;  5KJN A;  1IQR A;  3VLE A;  3BD1 A;  3AU5 A;  4GZD A;  3ZKC A;  4JA7 A;  4TRQ A;  5D0Q D;  4CDR A;  2PM6 A;  3IHV A;  4URK A;  2LNI A;  2WXP A;  1H2U A;  2YHE A;  2JEK A;  2PUC A;  3CHM A;  3VTX A;  1ELK A;  4I8T A;  1FVH A;  3CVN A;  3PS6 A;  2HR2 A;  1LQC A;  2IF4 A;  4N3B A;  3EIQ C;  4X4G A;  4O6F A;  2Y4U A;  3CLJ A;  4I9E A;  3D9O A;  4HOU A;  2ICP A;  3QK0 A;  2CRO A;  3S8Q A;  1QP0 A;  3LVQ E;  3T5X A;  4KZ0 A;  2OR1 L;  1OWO A;  1FVF A;  3RK6 A;  4UWH A;  2LAI A;  1ZUG A;  5KJL A;  2PUA A;  3LCA A;  4I1O B;  5T3R A;  3CKB A;  4EEC A;  3FUI A;  1U3C A;  1E96 B;  4BTA A;  4NAC A;  1R69 A;  4J1X A;  5G05 C;  2VSO E;  1HG2 A;  3CST A;  4APF A;  4BX8 A;  1UJJ A;  5ANL A;  4NDW A;  2OVF A;  3Q15 A;  3ZHI A;  1QQE A;  3FU0 A;  4U07 A;  3TJP A;  3UUX A;  4B94 A;  1NA3 A;  4I6J A;  2PZI A;  2GZU A;  4GYO A;  3FTU A;  5A7D B;  1HXI A;  1JUQ A;  2HO1 A;  2IFU A;  1JH9 A;  4MKT A;  1OWP A;  2KC7 A;  4FHK A;  3TXN A;  3OXL A;  3DPD A;  4MLP A;  3CK7 A;  4IWR A;  5CCL A;  3LY9 A;  5FWQ A;  4Q69 A;  3Q49 B;  3LFP A;  3AS5 A;  3T8M A;  3HYM B;  4JCY A;  2XIU A;  1IHG A;  2P58 C;  4K0R A;  5G04 J;  2ILR A;  3QOU A;  4L1B A;  4A3V A;  2FUL A;  5CMY A;  1PRU A;  2LAH A;  3OQO A;  1ZZ8 A;  3ZVV A;  4J8F A;  2R17 C;  4DI4 A;  3L6A A;  4I43 A;  2OFY A;  3VTY A;  5BV1 A;  3CVU A;  1DVP A;  3LKU A;  1N52 A;  4BTB A;  2PPX A;  2X38 A;  4FC8 A;  1SZA A;  2IQC A;  2XCJ A;  1NP7 A;  5JHB A;  1PC2 A;  2FEZ A;  2I6H A;  2VTB B;  3LDZ A;  4IA8 A;  1EPU A;  4UQY A;  3MZL B;  4X4H A;  1RPE L;  1ZVV A;  2VTB A;  1HFA A;  1U3D A;  1NZN A;  3PUK A;  4HS2 A;  2KEK A;  4CT4 A;  3U66 A;  3L08 A;  2L6J A;  1YSE A;  1ZZ9 A;  5ARF A;  3KS2 A;  3CVP A;  3RO3 A;  1E8Y A;  4JHJ A;  3ZXS A;  5AIJ A;  5FQ4 A;  3SCH A;  4UQX A;  2NXP A;  5BT1 A;  4XX5 A;  3IHY A;  4G2V A;  2C0L A;  1UG3 A;  3LY7 A;  5ARG A;  3FU3 A;  1QP4 A;  4KVO A;  2GW1 A;  2X6H A;  2C0M A;  4KYO B;  3DNV B;  5BUZ A;  3ONK A;  4I6R A;  4AY6 A;  4M3O A;  5CMW A;  1H2V C;  3U3W A;  4A3T A;  2KEJ A;  4YAR A;  1Z3Y A;  2XI8 A;  2VYI A;  3FUN A;  2NSZ A;  1WIZ A;  2BNM A;  4WUY A;  4XI0 A;  5E75 A;  2XHE A;  3APD A;  3CHQ A;  3LEW A;  4B89 A;  3ZW3 A;  4Y42 A;  3G2S A;  3JQ1 A;  3MKR A;  1HH8 A;  2J08 A;  4A1G A;  5J08 A;  2WMN A;  2IVB A;  2J49 A;  1WY6 A;  3AS4 A;  4GML A;  4O8B A;  4ATG A;  2M63 A;  3FTY A;  3QNK A;  2WXK A;  3QJZ A;  1OUV A;  3I3N A;  3FHE A;  3FEY A;  2WXJ A;  1VDY A;  2PIJ A;  4JHR A;  2GGF A;  2YHC A;  4RG9 A;  2LSU A;  4JEU A;  3D9L A;  4JA9 A;  5J90 A;  4G25 A;  4J0U A;  2WVI A;  3D1N I;  4JQD A;  2VQ2 A;  3EDT B;  3ML9 A;  4JC8 A;  4Z5H A;  2WXH A;  3KEZ A;  5FQ7 A;  3OXF A;  4PS7 A;  4RSY A;  4OB4 A;  3GZ1 A;  5EDS A;  1Z3X A;  4UI9 K;  5E76 A;  4B8A A;  2QFC A;  1TJF A;  2UWJ G;  3EJN A;  3I5P A;  3BG0 B;  4WND A;  3UPV A;  4E6H A;  1H19 A;  2EBY A;  2VSN A;  2XGO A;  4KXK B;  1Y6I A;  2LYJ A;  3AS8 A;  3FUH A;  3NZS A;  4PU4 C;  1QP7 A;  1ZU2 A;  3FUD A;  1ADR A;  1E8Z A;  2Q7F A;  2FBN A;  3FU5 A;  1XWR A;  5FQ8 A;  4GPK A;  5EX3 A;  3TAX A;  3KD7 A;  3GN5 A;  3ASD A;  2HYZ A;  3MCX A;  3L13 A;  4MCT A;  3F52 A;  2OOE A;  3ZPJ A;  4APO A;  3PH0 C;  2WXQ A;  4Z5C A;  3GN5 B;  4ME2 A;  2JLB A;  4JPS A;  4XE0 A;  3TG4 A;  2IU7 A;  4P29 A;  3PE4 A;  2PUD A;  3MEK A;  4YBA A;  4PS3 A;  3URZ A;  3G7D A;  1JWL A;  2LYL A;  4BSX A;  4ANX A;  3CEQ A;  3FH8 A;  4FBI A;  3LIS A;  2NC9 A;  3PNL B;  3JYS A;  4L2Y A;  5EKQ D;  5FZS A;  3QYX A;  2A4Z A;  3NQP A;  1Y9Q A;  1IC8 A;  3QWW A;  3TXM A;  5T8I A;  2AWI A;  1DW9 A;  4N39 A;  4OVV A;  3AU4 A;  4IUL A;  2L49 A;  1E7U A;  1SQM A;  3HIZ A;  4FLB A;  4KMO A;  4ANV A;  2JCG A;  4BT9 A;  5DIZ A;  1UXD A;  4HOR A;  2ICT A;  1Y8M A;  2PE5 A;  2L0I A;  2FO7 A;  2J09 A;  4K03 A;  4EZL A;  3ZHE A;  2BTD A;  3BEE A;  4KVM A;  3SF4 A;  2IJG X;  3GZS A;  2BUG A;  4ILH B;  4J8S A;  2BNO A;  4QFV A;  2VGX B;  1EDU A;  3FYA A;  3E4B A;  3OP9 A;  3QAQ A;  2XPY A;  3RRN B;  4ABN A;  3CVW A;  4L23 A;  4UI9 C;  3ULQ A;  3PDN A;  1WH8 A;  2PQR A;  3P2B A;  4PS8 A;  3CIA A;  3RU0 A;  2WXM A;  1OSL A;  3EIJ A;  2R59 A;  3FY4 A;  3OTN A;  2KZ8 A;  3PZD A;  4X4F A;  5AYW D;  3UT8 A;  4X4E A;  4L2L A;  4G23 A;  1H6K A;  3OXG A;  3PRZ A;  4WWN A;  4IVZ A;  4WNF A;  2MHK A;  1QQB A;  3JCK C;  3QB2 A;  3CVY A;  2V8S E;  4NQ0 A;  3CVV A;  3APC A;  1OWL A;  5HI7 A;  5FZR A;  1EF1 C;  2AUW A;  1OWM A;  4LRZ A;  4CT0 A;  1LMB 3;  3MYV A;  4FUL A;  4V3I A;  2C2L A;  3ZYL A;  1L1M A;  1LF8 A;  4PU7 A;  4X4C A;  3KXA A;  4YG4 A;  4J8D A;  3JQ0 A;  4HOQ A;  3LPZ A;  3HDX A;  2XJ3 A;  3G2W A;  3IV0 A;  3WXX A;  2MRI A;  2HM8 A;  4XZ4 A;  4D10 C;  4HOS A;  3CHP A;  5G04 C;  4Z5D A;  2B5A A;  4HXI A;  4LUN U;  2CHZ A;  4BFR A;  3GW4 A;  3S2A A;  4PU8 A;  4C9B B;  3RZZ A;  4CGV A;  1MQS A;  3P1U A;  3QDN A;  2A6C A;  3ZEF A;  4Z59 A;  1JFT A;  3ZYQ A;  4UI9 J;  4DJA A;  1POU A;  1Y7Y A;  3D9P A;  4GB9 A;  4JW1 A;  2LYS A;  4N3A A;  3B7U X;  2KZT A;  3CQG B;  3CV0 A;  4B0Z A;  5JJT A;  3PEV B;  4GCO A;  2IVQ A;  1PNR A;  3L22 A;  4WAF A;  2X6F A;  3FEX A;  2WXG A;  2O49 A;  3L54 A;  3PE3 A;  4BT8 A;  1WH6 A;  2H8R A;  2RD0 A;  1ZBP A;  1HS6 A;  4FLH A;  4Q94 A;  4WWP A;  4C0E A;  3ASH A;  1TEZ A;  2MQK A;  4EQF A;  4YVQ C;  4F53 A;  4XKB A;  4WNG A;  2E2E A;  4FJY A;  1ZAY A;  4AV7 A;  4UWF A;  5C2Y A;  3UMV A;  3CEC A;  3QAR A;  2PL2 A;  4AEZ C;  2WB2 A;  2YIN A;  1X5B A;  4I6T A;  1AU7 A;  1UN9 A;  2KEI A;  1HO8 A;  4G1T A;  3O4Z A;  5LCW J;  3APF A;  3FH5 A;  2I1J A;  2HSG A;  3F6W A;  3SGH A;  4GZ5 A;  5ENN A;  1RZR A;  2IU1 A;  4JHK A;  3R7Q A;  5LCW C;  2IUO A;  2CHW A;  3H5T A;  5BPP A;  1ZZ7 A;  2J4D A;  4J6I A;  5ANR A;  4U0Z A;  3MKQ B;  4DLQ A;  1QQA A;  3R7R A;  4WWO A;  3ENE A;  4KBQ A;  2OND A;  4XIF A;  4HFG A;  2DCP A;  3QWV A;  3MKQ A;  5JJ6 A;  3SCF A;  3S7B A;  2EF8 A;  1PER L;  2L9B A;  4U8H A;  2DBA A;  2WXN A;  4AY5 A;  1SZ9 A;  1OWN A;  2EWT A;  2Y4T A;  1R63 A;  4LEU A;  4AXH A;  3LXU X;  1NA0 A;  5BNW A;  4I6U A;  1O4X A;  3EUS A;  3FTV A;  3LVR E;  1ZS4 A;  4JVS A;  3I4R B;  3FH7 A;  3SHF A;  3PVL A;  2MEZ A;  2Y3A A;  3FUE A;  2XRZ A;  1KLX A;  2YQ8 A;  5A6C A;  3FFL A;  4PUC A;  1B0N A;  2PUF A;  3SI5 A;  4HOT A;  4ACL A;  1FCH A;  1BDH A;  2YNQ A;  2WQ7 A;  3ZYK A;  4GCN A;  5FQ6 A;  2BJC A;  3NF1 A;  4DK5 A;  5G2N A;  2AXU A;  2UY1 A;  2WXR A;  4IRU A;  3ZIM A;  4BY6 A;  4PU3 C;  1QPZ A;  3BDN A;  3G2T A;  3C98 A;  3EHN A;  1YA0 A;  3IKO B;  3ZRH A;  4OVU A;  4AOF A;  2FF4 A;  5HQ8 A;  1RIO A;  1RZS A;  3GZ2 A;  4I2Z A;  4BWR A;  4F7A A;  1NEQ A;  1S7E A;  1XGW A;  3FUM A;  1E8X A;  1E90 A;  4PDX A;  4X4B A;  3SD5 A;  3FMY A;  2WXL A;  3B7H A;  4AM9 A;  2OVB A;  3ZHE B;  3FWV A;  3IVP A;  1A17 A;  3SNX A;  3MLF A;  4Q96 A;  1BPO A;  2CFZ A;  4OYS A;  4XKC A;  4GA2 A;  4GA1 A;  4MCX A;  3LJ3 A;  2R63 A;  5FTP A;  3HVE A;  5G55 A;  2CHX A;  2AXV A;  1PRA A;  2XGS A;  3QWG A;  3QWP A;  2PM7 A;  3HHM A;  2DIW A;  1H2T C;  3RRU A;  3G2V A;  3HVE B;  1IYG A;  1DNP A;  2KCL A;  2X6I A;  3JXD L;  1TJC A;  4GHJ A;  3O9X A;  3Q4A B;  3RKV A;  2QY7 A;  3IEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...