2GRMA

Crystal structure of prgx/icf10 complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
315
structure length
315
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGCYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVAIENNPIPEIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PrgX
publication title Molecular basis for control of conjugation by bacterial pheromone and inhibitor peptides.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
total genus 121
structure length 315
sequence length 315
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2grmA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2grmA02
2O49A 1UXDA 3L1PA 4MCXA 1S7EA 1ZZ9A 2WIUB 4GQMA 2GZUA 4MCTA 3LISA 1QP7A 4I6UA 1XWRA 4YG1A 3FMYA 4OB4A 2R1JL 2OFYA 4Z5HA 3BDNA 1LCDA 1QQBA 1X57A 4J1WA 2JVLA 3O9XA 2BNMA 4X4FA 2KEKA 1BDHA 4IWRA 2PUAA 2LYPA 3DNVB 1O4XA 2LYRA 2L49A 2XCJA 1RPEL 2O4AA 3QYXA 2HSGA 1PRUA 1ZZ6A 2OR1L 2BNNA 2B5AA 2GRMA 3KZ3A 1LQCA 3QQ6A 3R1FA 3SCHA 4FBIA 1LCCA 3CROL 2HINA 2WUSR 1VPWA 1JH9A 3OQMA 1RZRD 1NERA 2MEZA 4I8TA 3IVPA 3F52A 1ZS4A 3FYMA 2IUOA 2IVQA 4X4GA 3OQNA 3CLCA 1NEQA 3JXBC 2PUBA 1IC8A 2D5VA 4F8DA 4X4CA 2LYJA 3QF3A 3LFPA 1ZZCA 2CROA 1X2LA 1WETA 1UTXA 3PXPA 3BS3A 4Z58A 1RZSA 2A6CA 2XSDC 3TRBA 1PNRA 4X4DA 2PUEA 3EUSA 4I6RA 5K98B 2L8NA 3OP9A 2KEJA 2KPJA 2EWTA 3RZZA 3SCFA 2JCGA 3F51A 1ZUGA 2ICTA 3JXCL 2XIUA 1JFSA 1QP4A 3GBFA 2PUCA 1SQ8A 4PU3C 1EFAA 2PIJA 2GRLA 2AUWA 2KEIA 3QWGA 2ICPA 1UXCA 1L1MA 1B0NA 1OCTC 4Z59A 2PE5A 1DW9A 3F6WA 4X4BA 4PU7A 1E3OC 1PERL 2KZ8A 2AWIA 4O8BA 4NDWA 1PRAA 4Z5CA 2BJCA 1ZZBA 2LYKA 2CSFA 2O38A 4PU4C 1OSLA 1AU7A 2PUFA 1YSEA 2LYLA 2PPXA 4GHJA 3KXAA 4X4IA 2PUGA 4JCYA 2AXUA 3OMTA 2AXVA 4JQDA 3MLFA 4X4HA 3D1NI 1QP0A 1ZVVA 3ZHIA 1QQAA 1ZPQA 4I6TA 3ZKCA 2MQKA 1ZAYA 1Y9QA 3G7DA 1CQTA 4YG4A 1GT0C 3KJXA 3H5TA 2H8RA 2IVGA 2R63A 1R69A 4IA8A 2BNOA 4Z5DA 3JXDL 1QPZA 1ZZ8A 4YG7B 1WIZA 1WH6A 3VK0A 3G5GA 1BDIA 4J1XA 2FJRA 4PU8A 3OQOA 1RIOA 1Y7YA 1R63A 4YBAA 3FYAA 1ZZ7A 5A7LA 4IVZA 2IVBA 2LCVA 3GN5A 1RZRA 3UFDA 1DWKA 3GN5B 1PRVA 1JFTA 4FN3A 1ADRA 2LYSA 2XJ3A 1POUA 2IU7A 1HF0A 2PUDA 2AXZA 1LLIA 3BD1A 2EF8A 3S8QA 1WH8A 2LYQA 3CECA 3U3WA 2IV1A 3B7HA 3HZIB 3ZHMA 4JCXA 2EBYA 2XI8A 1JWLA 4YARA 4X4EA 1CJGA 4Y42A 1LMB3 2AW6A 3SCGA
chains in the Genus database with same CATH superfamily
1A17A 2DIWA 2E0IA 3E30A 2FBNA 3CVQA 2WXRA 4I43A 3SFXA 1AWCB 2VTBA 2V5FA 3LVQE 3JYSA 4HNAD 2KBXA 3PS6A 3MKRA 4C9BB 2JVLA 1EDUA 2XCJA 4J7WA 4DE9A 3Q78A 4HQDA 3EDTB 3UX4A 4EBAA 4GTMA 3KZ3A 4ZFHA 5LOZA 4FBIA 2WXGA 2GRRB 3R9MA 2X3MA 2IUOA 3TELA 4U8HA 1IC8A 3T5XA 2LYJA 2KZTB 1UJJA 1ZU2A 5LP0A 3E32A 3PDNA 2XGSA 2XPIA 5A7DB 4ILHB 3QC1A 3VLDA 2EWTA 2MXDA 4GTOA 3IV0A 1WM5A 2GRLA 3ZYMA 4CRWA 1DNPA 4HB5A 3LPZA 4R7LA 4N3CA 4N2QA 2PL2A 4UWHA 2WXLA 1JCSA 2O38A 1OWMA 3FH5A 3VLFA 3Q49B 5BV0A 1S70B 5EYLA 2VGEA 2J7UA 3ZKCA 3M9LA 1TN8A 5JJ6A 2IVGA 3ZPJA 1HXIA 2WMOA 3EHQA 3AJIA 4IRUA 4KYOB 4F1PA 2E2EA 1EPUA 4ABNA 3CHSA 3S7JA 3FUIA 1NI1A 2ZU6B 2VJ8A 3QFIA 1HX8A 1UOHA 4LUNU 4RG6A 2XXPA 4CGVA 2AW6A 4MCXA 5D2MC 3FFLA 4F1SA 3LJNA 4HORA 3CKCA 5HS0A 4TV3A 4KZCA 4YG1A 5DTMA 4IULA 1LCDA 5FZQA 1SVXA 3IHVA 4GPKA 2OOEA 4DPRA 4APFA 1O4XA 4A1SA 5FWQA 5CECB 1Y6IA 2B5AA 3QQ6A 3IHYA 3CVNA 2QYUA 3OQMA 3AU4A 1KPSB 3FH8A 1NEQA 4X4CA 4C0MA 3LY7A 3LFPA 2YQ8A 1HZ4A 4I1OB 2PM7A 2CHWA 4FLHA 4U0SA 3TWTA 3IXEA 2EIKE 3I4GA 3UKRG 5BUZA 1JFSA 4JXTA 1QP4A 3ENEA 3Q9NC 1N9AA 1BI8B 3OTNA 3ASHA 4EHMA 1X81A 3ABME 3ONKA 4BEPA 2XXAA 1ZZBA 2CSFA 1AU7A 3CVWA 1YSEA 4GYWA 4LSZE 2I1KA 2EINE 1NA0A 4TRQA 1TJFA 3AG2E 1TNOA 2YHCA 3I3NA 3SHFA 1H2UA 4G1TA 2XZDG 4LERA 3DSXA 3ZFWA 5DSXA 5M72A 3G5GA 3TFLA 1JUQA 2LLVA 2LCVA 3CHMA 2HO1A 3PE3A 3ZU7B 1JFTA 4UI9C 1NW3A 1WY6A 4ILGA 1ZB1A 2PXEA 2WXMA 4OVVA 5JHAA 3ZHMA 2L0IA 2XPYA 1HG2A 3CK8A 3CSFA 3SCGA 2O49A 4HOUA 2GZUA 2LXLA 1N95A 3DSVA 4XI9A 4JZYA 4RVBA 1IQUA 4DRXE 3I5PA 1Z3XA 2OCCE 4IWRA 3DSSA 4HRNA 5FQ4A 2V3CC 3FUJA 4I6GA 3QWWA 4BTBA 2WUSR 2V8SE 1RZRD 4ANUA 4GZDA 3OQNA 3CHOA 5EX0A 4L7TA 1JCQA 1BPOA 3ZVVA 1TJCA 2V4LA 3FWVA 2VEOA 1HO8A 3G2VA 2NC9A 5EKQD 3I4RB 4DE8A 3JXCL 4GMLA 3ZEFA 2P9LG 1LD8A 3UQ3A 2M4HA 3T5VA 4O60A 1ELKA 1H0AA 1E3OC 1L5JA 2AWIA 5ENOD 1HU3A 4Z5CA 2BJCA 1JWGA 2QYJA 3FU5A 1NA3A 4W9RA 4GTSA 2UWJG 3OXLA 4WWNA 1Z5SC 2FO7A 3PUJA 1ZPQA 1LD7A 2XS1A 3T9KA 2RKKA 2WXPA 4NURA 3C3RA 3AS5A 4YVQC 1R69A 3ZPXA 4DJAA 4MLPA 4YG7B 5CEAA 4JA9A 1OXJA 3OKZA 3PZ3A 2XQ0A 5GAGi 5ARGA 3AS8A 4K0RA 4EZKA 1H6KA 4FN3A 4J8DA 3U4TA 4ANXA 3B7HA 1N0RA 5KJKA 4DX1A 3KSQA 1LMB3 1H6PA 1ZZ9A 4GAAA 3LISA 4U07A 3S7FA 4H7XA 3ZHEB 5DBKA 3NOGD 4AEZC 3GZ2A 3B7TA 4KBQA 1V54E 2OR1L 4HVBA 4JEHA 4JB8P 2XEEA 1FPPA 4BERA 2VGYA 3L17A 4YDWA 3FUMA 1TN6A 3ZGQA 3A9XA 2XXQA 4BWRA 4N3BA 2X6KA 5FZSA 4AJWA 5LFAA 1HS6A 4PDXA 4AM9A 4D10C 4EBAG 3FDHA 4GCOA 3CK9A 2PQRA 4GMRA 3A9YA 2PXLA 4DX7D 3R7RA 3FTWA 2IONA 3UT4A 4GTTA 4UQXA 2AXUA 4K5BA 3MLFA 4NACA 4I6TA 4ACLA 2PXUA 3FU6A 1IHBA 3KJXA 2J9QA 2GRPB 4WNGA 1WIZA 4I2ZA 4HOSA 4UWLA 2L1PA 1ZZ7A 2C0MA 4JHKA 3R7QA 1SQMA 2ETAA 3MZLB 1HF0A 4LRZA 3B7UX 1QNFA 3D9PA 2J4DA 1RZ4A 4B89A 4GMJA 3Q15A 2MOWA 3EU5A 3RIBA 3EIJA 2BKKB 4HRAA 4U63A 2R2LA 4ER5A 2XS8A 1RW2A 4G2VA 2WQHA 4P29A 3DNVB 1YCSB 3DXMG 4KVMA 3PVLA 1OWNA 3R1FA 3PEUB 3ME5A 4HI9A 1NERA 4BSXA 2WVIA 4UUCA 2D5VA 3V79K 4M3OA 3UWPA 1FT1A 4K5CA 2R05A 2FF4A 3MX3A 2OEWA 3RJVA 2IOLA 2OVBA 4I6JA 2ZGDA 4ATZD 2PXPA 3RZZA 1D8EA 4G8LA 2F0YA 3QWGA 5G55A 4OYSA 3ISMC 1DW9A 3MEJA 1PERL 3FEXA 4NDWA 3E34A 1HQ1A 2R17C 4MKTA 2ONDA 2PPXA 3HVEB 3KXAA 4JCYA 4JL0A 3BUAA 3JCKC 1QZXA 3VLEA 4X4HA 4AY5A 1D8DA 2R02A 5C1DA 3S7BA 3G2SA 3ULEG 2H8RA 3UI2A 2KM4A 3RRUA 2LO6A 3FTYA 3UXGA 4ER3A 4UI9J 2KATA 3SFZA 1R63A 3FYAA 4OVUA 5A7LA 3ZNGA 1WG0A 1N94A 1PRVA 2XJ3A 1N0QA 3ZYLA 3URZA 3GZDA 3DWLG 3FTZA 4A63B 5J90A 3BD1A 4GZ5A 2LNMA 4YARA 3ASNE 5BXOA 1N11A 1UXDA 3FH7A 4WNEA 1XWRA 5AIJA 2BEDA 2NSZA 3NAWA 3P1UA 4I2WA 5CRVA 4TXQA 4F6RD 4FHJA 2BNMA 1BDHA 3APFA 4L9PA 3MGBA 4XKCA 2O4AA 2B6CA 1TR4A 1PRUA 2GRMA 1LQCA 1VPWA 4V3IA 3EHNA 2PXBA 3F52A 3QOWA 3UIOC 1X5BA 5B3SE 2BKGA 2V5QC 4X4DA 4GB9A 3MYVA 2C2LA 5AJDA 3AS4A 3EUVA 1OWLA 2JCGA 3CVUA 3EU9A 3GUUA 2PUCA 5CMWA 2WQ6A 1IQRA 5BXUA 1L1MA 1SA5A 5AQAA 2FO1E 2WXKA 4X4BA 4KZ0A 2DYSE 2XGOA 5B1AE 2RFMA 4FJYA 3ULYA 4GHJA 2XZTG 5FJYA 2WXHA 2PUGA 4ACKA 3ESKA 5ARFA 4JQDA 4DX5D 2XPZA 3ZHIA 4G26A 1SZ9A 4EZIA 1TNYA 2ZIRA 5LX8A 1RIOA 3AG1E 3U66A 3OXGA 3UFDA 3KAEA 3GN5B 2UY1B 3UIPC 4EKGA 1TNZA 1BU9A 3CECA 4LNUD 4JHJA 1HF8A 2P9UG 4BX9A 3ASOE 3MKQB 3ZUVB 1NZNA 3EHRA 5CRUA 5CERB 3C72A 1X57A 3GYZA 4RSYA 1DCQA 4UWKA 1RPEL 5CCMA 1OY3D 4HBDA 2DCPA 1LCCA 4GU5A 2HINA 3VTXA 2YBDA 3C3OA 3CHQA 4XI0A 2IVQA 1O1TA 2PUBA 4CYMD 4BY6A 4EECA 2XEHA 4U04A 4F8DA 4XE0A 3BU8A 3HXFA 2V4HC 3PXPA 3HYMB 3P2BA 3BS3A 4N5QA 2GGFA 2PUEA 3SZ7A 2LLWA 4I1MA 5ITZF 4A55A 4U8VD 5AQ7A 1MZCA 1E90A 3SCFA 3RRNB 4QFVA 5JA4D 3L54A 4IN3B 4J0UA 4B8AA 1E8YA 1K1BA 3L08A 1O5MA 2PE5A 3JXJA 2KZ8A 4N5CA 2PXFA 1IKND 5KJLA 5AYWD 2PUFA 2PNNA 4H7YA 1U3DA 4JHRA 3SO8A 3UM1A 3JXIA 1MX6A 1GT0C 2JABA 5BPPA 2H6FA 4GA0A 3AG4E 2JLBA 3HXDA 3ZHEA 1BDIA 3HDXA 3QOUA 4BSZB 3LKUA 4IVZA 3VWSA 4UWGA 4RQIA 1K3ZD 4GTQA 3FY4A 2IU7A 2IU1A 4PS8A 1NP7A 3KEZA 1Z3YA 2EBYA 1VDYA 3LQXA 4U0UA 3J5PA 1O1SA 2WIUB 3TWQA 3FUHA 2RFAA 3BDNA 4CDRA 1QQBA 3QWVA 1BD8A 4G23A 5KCMA 4OAUC 2VTBB 3UTMA 3FUKA 4X4FA 4G25A 2CFUA 3D9MA 3GZSA 1WAO1 2WQ7A 1U2ZA 5KNGA 4KT6B 3CHPA 1QB2A 2RG8A 1WDYA 3NF1A 5HQ8A 3DPYA 3IVPA 2KCKA 3FULA 5FQ6A 3TEPA 3SNXA 4ER0A 2XENA 5AQBA 3FTVA 2QC9A 2X6HA 4EK9A 3CVLA 3ABKE 2FFHA 4FJZA 4E6HA 3CVYA 2V0PA 3LEWA 5CMYA 5DTRA 5FINA 3APCA 3Q47B 4M7CA 3F6WA 1UG3A 2WXIA 3QAQA 4GYYA 2WXNA 3QWPA 3ZIMA 4CDMA 4A1GA 5T4YA 3DSWA 4EZJA 5FT9A 3D9KA 3GZCA 1QP0A 1FVFA 2CG3A 2A4ZA 3QB2A 3ZN3A 1Y9QA 3NDBB 3ZKJA 5CBNA 1S63A 4PUCA 3EIQC 1OCOE 1UJKA 3SY2A 3CQCB 2AVPA 2LAIA 3C98A 5IY5E 2WM9A 2AXZA 3S2AA 3S8QA 2EF8A 3MV2B 1IYGA 3D3MA 4NIKA 3APDA 4XZ4A 5ANRA 5D0QD 1KT1A 1JPLA 1SW6A 3FHEA 2NXPA 1QP7A 2PXDA 5G2NA 2IEJA 1N4PA 4Z5HA 2DZOA 3ZYKA 2I1JA 3KS2A 4GZCA 2X6IA 4JVSA 3U9WA 3G0TA 5ENQD 4OBMA 3ZW3A 2CG2A 1DULA 3Q7FA 1ZZ6A 1PY1A 4AV7A 3R9AB 4LG6A 5AENA 1UW4B 4X4GA 5HKPA 4B8CB 2M63A 3Q73A 4KXKB 3L22A 4J8FA 3RSEG 4PS3A 4DI4A 3O4ZA 3UUXA 2FEZA 3HRAA 1KLXA 4KVOA 3UKUG 3CIAA 3B7SA 3TWRA 4HXIA 4GZ6A 3KL4A 5HI7A 4U8YD 4FLBA 1N54A 3QOXA 1B89A 3J5QB 5JJ7A 1OCCE 4GA1A 5ENSD 3X2QE 1ZVVA 4JEUA 3FUFA 4ILIA 2MQKA 1ZAYA 2WPVA 5B1BE 4AVXA 1MX2A 4YG4A 5EDSA 3DPDA 4TXRA 3PE4A 1N4QA 1UN9A 3VK0A 1BI7B 3PEVB 3TWUA 3BEEA 3HXEA 1RZRA 2Q7FA 3TWVA 2LYSA 1KZOA 3UM2A 2OV8A 1LLIA 1Y8MA 3U3WA 1OWOA 4WVLA 1HE8A 3UM0A 1FVHA 5CCLA 3CEQA 4RG9A 5EILA 3UM3A 1N4RA 2Y1LE 4Y6WA 1DC2A 1OCZE 1HG5A 2PUAA 3UT7A 2LYPA 5DRTA 1OWPA 3DEPA 3SCHA 2H6GA 3AAAC 5HRYA 5DIZA 4EZLA 2WB2A 2P9SG 3LCAA 5H7PA 4LNGA 2VQ2A 2KZTA 2LUHA 2WXQA 3SFYA 4LNBA 2XGMA 2H6HA 3TRBA 4HRMB 1G3NB 4JA7A 3A9ZA 2L8NA 2J8SD 1HH8A 4UI9K 2J09A 1Z6TA 4PU3C 3DXKG 1O1RA 4CT0A 1QZ2A 4DLQA 1MQSA 1U3CA 4O8BA 3TJPA 2UY1A 4PS7A 4L2LA 3NQPA 3D9LA 3ZXPA 1SZAA 5KNHD 1QQAA 1QQEA 4F7AA 3RK6A 2GRNB 1NL4A 3BG0B 4J8EA 2EILE 4IA8A 4YDEA 3FU0A 1FCHA 1OT8A 1TNUA 1ELWA 1MYOA 2MYOA 2FJRA 2IOSA 2EQXA 4EKIA 5EIBE 2VYIA 4NRHB 4U95D 1POUA 4ATGA 5E75A 4MS6A 1QYMA 1V55E 2HM8A 2OEVA 1INZA 3CQGB 1KT0A 3HZIB 4GTRA 3LJ3A 4EPZA 4O6FA 3ASGA 3V2OA 2HE0A 2B0OE 2YINA 4GQMA 3GW4A 4MCTA 4GZ3A 4CGWA 4I6UA 3KEAA 3LDZA 4CZ2D 3B7RL 4OB4A 4UWFA 2VSXE 2Y3AA 4NQ0A 4FULA 3L82A 1H2TC 4WWPA 5AQ9A 2L6BA 3ASDA 1TN7A 2Y4TA 3UMVA 3FTUA 2QY7A 4FP7A 2VSYA 1D9SA 2P9NG 2HYZA 5G04C 1FT2A 4TXPA 3JXBC 5KWDA 3S7DA 2CROA 3GZDC 3L13A 1H19A 4I6RA 4U96D 5DRYA 5LCWC 2J07A 5JHBA 5BNWA 1S64A 3O48A 3Q7AA 4FU3A 2PIJA 3SR4A 2KEIA 3QK0A 3FU3A 4ME2A 3D9IA 3MA5A 4GYOA 2GW1A 1MFQC 3IKOB 1OSLA 4CEMA 2DBAA 4QQIA 2AXVA 3JQ1A 1EYHA 3CK7A 4YNDA 3UT8A 2R03A 2WMNA 1CQTA 3IEGA 4WUYA 2ETCA 4ER7A 2IQCA 2L0TB 4HLLA 4N39A 2IVBA 3DSUA 4G11A 3K9IA 3NZLA 2IF4A 2DZNA 1HFAA 1YA0A 3LVRE 4L2YA 4CDNA 4DUIA 4FA6A 4LCTA 2XI8A 2F8YA 5JUWA 2NYJA 3LS8A 2HCSA 1BLXB 2VGXB 4Q2JA 3CLJA 2OFYA 3ULQA 3RO2A 2PM6A 2MHKA 4GTPA 3D9HA 3GZ1A 2ZXWE 4AY6A 3B95A 3QYXA 4F53A 2A5EA 1OCRE 2BNNA 1XNFA 5FTPA 1JH9A 2MEZA 4I8TA 2YNQA 1ZS4A 2JEKA 1IHGA 1X2LA 1TEZA 1WETA 3JUEA 3BQOA 3B13A 4A3VA 2XRZA 4KMOA 3EUSA 3NBNB 4DLOA 4J8SA 3ML9A 1SA4A 5E76A 2RD0A 3PZ1A 3G2WA 4F3VA 3HIZA 3SGHA 5EIDA 2ICPA 1H2VC 3QJZA 2DVWA 4WNDA 4APOA 2PXVA 1PRAA 3LY9A 2LYLA 4HFGA 2EIME 3Q75A 3OMTA 4AP2A 4HS2A 2CFZA 2P9KG 4JPSA 2WXOA 3HHMA 4G8KA 4I9EA 4B94A 4GTVA 4Z5DA 3MCXA 3NB2A 1ZZ8A 1UN8A 4B93B 3TGOA 3L16A 4I9CA 4PU8A 3RU0A 1JWFA 4YBAA 4AXHA 4HOTA 4DX2A 1XGWA 1ADRA 4BFRA 2AJAA 4AOFA 2PUDA 2LXMA 2YHEA 1AP7A 3PE5A 2IO3C 3CV0A 4XX5A 1K1AA 1S7EA 2QFCA 3CHRA 3V30A 5FQ7A 3PUKA 1E7UA 3DBSA 3TAXA 3BG1B 1QBQA 2IY0C 2DYRE 5DTQA 5GAHi 3HXCA 3NOCD 2F8XK 3SI5A 5EN5D 2X38A 2HSGA 4G24A 4RLYA 3TWXA 2IFUA 2LSVA 2Y4UA 3RO3A 4BTAA 4EQFA 3CLCA 3RAUA 4C0EA 1A5EA 3QF3A 4Z68A 1ZZCA 3W9GA 4J6IA 4Z58A 1RZSA 3D9OA 2LSUA 5DT2A 2X6FA 3PNTB 3DM5A 3ZRHA 1EFAA 2AUWA 2LAHA 4PH4B 4U0ZA 1W3BA 3G2TA 3QDNA 4Z59A 4B0ZA 4I1AA 2PXKA 5A23A 4FADA 2BUGA 2LYKA 2P2CP 3TWSA 2PQNA 3Q4AB 3D1NI 2HCNA 3E4BA 4ANVA 4BETA 2IO2C 1E7VA 1K8KG 5G05C 4ANWA 4GPMA 3H5TA 3W9FA 2R63A 3JXDL 1QPZA 4TUUA 4WWOA 2VSOE 1U2VG 2CHZA 5T8IA 5J08A 3OQOA 2J4BA 3C5RA 2IJGX 3ML8A 3DSTA 1DCEA 2J7WA 2BTDA 2PZIA 3SD5A 3WG7E 4HRLA 4XIFA 2XRYA 2GRQB 3Q9UC 1E8WA 3JUIA 1JWLA 4YDYA 3UPVA 4O1OA 3L1PA 3V2XA 4BT8A 3TXNA 4XKBA 3FP3A 2Y0BG 3N71A 4Q94A 3LYAA 3CVPA 2I2OA 1YMPA 2I6HA 2GROB 4YDOA 5G04J 3TXMA 1EF1C 3WXXA 1IXVA 3PRZA 3QKYA 3PZDA 2H6IA 3FTXA 2DWZA 1MX4A 1UTXA 5LCWJ 2A6CA 4ER6A 3FTSA 3HG0D 3OP9A 3HXBA 2KPJA 2KCLA 2MRIA 3F51A 1Q2ZA 2FULA 2ICTA 3OWQA 4N3AA 4I17A 4LEUA 1LF8A 3L9TA 3Q79A 3F6QA 4L23A 3FUNA 2XHEA 5KBAA 3HVEA 2KC7A 2A5UA 2XCCA 4HOQA 4DX6D 4X4IA 1GW6A 4JC8A 5EX3A 4BT9A 3TWWA 5AJLA 1JCRA 4K5AB 4BESA 2F37A 4WNFA 4FHKA 3NZUA 4O1PA 4UQYA 4UQZA 4J1XA 3CVXA 3FUEA 5BT1A 3OXFA 5ENTD 5D66A 3CKBA 4E85A 2CHXA 1WH8A 2LYQA 2IV1A 4L1BA 3NZSA 3IBEA 5JJTA 4YVOA 1KZPA 1OUVA 2J49A 3SQVA 1E8XA 3FMYA 2KXPC 4J8YA 4MRUA 3OAWA 3O9XA 2KEKA 3SX0A 3B7BA 4XEIG 2ILRA 3TG4A 1YYHA 2Y69E 2BF0X 4FC8A 4N2SA 4EQZA 3CROL 1DVPA 3V31A 4HLEA 3RKVA 3FYMA 2L9BA 3ZYQA 3D9JA 4JD2G 5BW8C 3NROA 2R59A 5CEDB 4WAFA 2XSDC 1MHQA 1N4SA 3SBSA 4IYPA 5K98B 2KEJA 5JMND 4Q69A 5T3RA 2XIUA 3GBFA 3U64A 3CSTA 1PC2A 3DEOA 3R09A 4PU7A 5ENNA 3LXUX 5C2YA 4PU4C 5FZRA 3KSLA 3PREA 4DI3A 4DK5A 1E96B 3C3QA 4C48B 3ESLA 3PZ2A 1H6OA 2X6JA 3E37A 1WH6A 2VGXA 5BV1A 3ABLE 4ZHBA 2KCVA 3T8KA 4TUMA 3GN5A 2P58C 5AAOA 1DWKA 3QARA 2FI7A 3DRAA 2P9IG 2XCBA 3MEKA 5EYPF 3TG5A 5ANLA 4URKA 3EHMA 4JCXA 2P9PG 4X4EA 4Y42A 1LTXA 5FQ8A 2C0LA 3MKQA 3PNLB 3UINC 5CHEE 4Y6CA 3MV3B 2R1JL 5AN8A 2ETBA 5AARA 3SBTB 4J1WA 4CCAA 2JQEA 5CBOA 1E8ZA 5KJMA 2LYRA 2L49A 3AU5A 2ZISA 5FIOA 5D0OD 4K03A 2WXJA 4Q96A 3L6AA 4JW1A 3ONLA 4GCNA 3T8MA 3CR3A 4I6EA 2EIJE 2J08A 1TNBA 1PNRA 3D9NA 4X8QA 2WXFA 3SF4A 3RRMB 2LNIA 4GA2A 1ZUGA 3TL5A 3PH0C 3CGHA 1SQ8A 2HR2A 3ZXSA 5KJNA 2XEVA 1UXCA 3FEYA 1B0NA 1OCTC 2I9CA 1MJ0A 2OVFA 4AIFA 2ZGGA 2ODRD 4HI8A 2PXTA 4BX8A 3MJWA 1PAQA 1NFIE 3AG3E 3PZ4A 5G05J 3JQ0A 3KD7A 3CVVA 2R5SA 3G7DA 3ASFA 2QZAA 4MBGA 3G2UA 1P5QA 3QNKA 2L6JA 4CT4A 2PXQA 2BNOA 1TYQG 4OAVB 3VTYA 5ENPD 1ZBPA 3FUDA 1Y7YA 1N52A 4A3TA 3NXHA 3LY8A 3E33A 4U7EB 1S0PA 3EJNA 5A6CA 2HFZA 1ELRA 5ENRD 3Q5MA 1CJGA 2VSNA
chains in the Genus database with same CATH topology
3Q15A 1A17A 1JPLA 2MOWA 1S7EA 3FHEA 2NXPA 2DIWA 2QFCA 2E0IA 1QP7A 2FBNA 3CHRA 3EIJA 3RIBA 5G2NA 5FQ7A 3CVQA 2WXRA 3PUKA 1E7UA 4I43A 3DBSA 4Z5HA 2VTBA 2V5FA 3TAXA 3LVQE 3BG1B 3JYSA 2I1JA 3ZYKA 3KS2A 4GZCA 3MKRA 3PS6A 4U63A 4C9BB 2JVLA 1EDUA 2X6IA 4JVSA 3U9WA 4G2VA 2WQHA 4P29A 3DNVB 3SI5A 2XCJA 2X38A 3ZW3A 2CG2A 2HSGA 4KVMA 1ZZ6A 1PY1A 3EDTB 1OWNA 3PVLA 4G24A 3R1FA 3UX4A 3R9AB 3KZ3A 4AV7A 4EBAA 5LOZA 4FBIA 3PEUB 4N2QA 5AENA 2WXGA 2IFUA 1UW4B 1NERA 2LSVA 2Y4UA 3RO3A 2X3MA 4BTAA 4EQFA 3CLCA 2IUOA 4BSXA 4X4GA 2WVIA 4C0EA 4U8HA 1IC8A 2D5VA 4B8CB 2M63A 2LYJA 4KXKB 3QF3A 4M3OA 3T5XA 1ZZCA 2KZTB 3L22A 1UJJA 1ZU2A 4J8FA 2FF4A 4J6IA 5LP0A 4Z58A 1RZSA 3D9OA 3MX3A 4PS3A 3PDNA 2XGSA 3RJVA 4DI4A 2XPIA 3O4ZA 3UUXA 2IOLA 2OVBA 4I6JA 5A7DB 4ILHB 2LSUA 3QC1A 2FEZA 3VLDA 3RZZA 2EWTA 1KLXA 4KVOA 2X6FA 3IV0A 3PNTB 1WM5A 3CIAA 3B7SA 3ZRHA 1EFAA 2GRLA 2AUWA 4HXIA 2LAHA 4PH4B 4GZ6A 3QWGA 1W3BA 3G2TA 4U0ZA 5G55A 3QDNA 4CRWA 1DNPA 4OYSA 4Z59A 4B0ZA 1DW9A 3LPZA 4I1AA 4N3CA 1PERL 2PL2A 3FEXA 4R7LA 5HI7A 5A23A 4UWHA 4NDWA 4FLBA 4FADA 2BUGA 2WXLA 2LYKA 2O38A 1OWMA 1N54A 3FH5A 2R17C 4MKTA 2ONDA 2PPXA 2PQNA 3Q49B 3VLFA 3HVEB 1B89A 3KXAA 3Q4AB 5BV0A 4JCYA 4GA1A 4JL0A 5JJ7A 3JCKC 3VLEA 4X4HA 3D1NI 1ZVVA 4JEUA 3E4BA 3FUFA 4ILIA 3ZKCA 4ANVA 2MQKA 1ZAYA 2WPVA 4AVXA 4AY5A 1E7VA 5G05C 4ANWA 4YG4A 5EDSA 5C1DA 3DPDA 3S7BA 3G2SA 5JJ6A 3H5TA 2H8RA 2IVGA 3PE4A 2KM4A 3ZPJA 2R63A 3RRUA 3JXDL 1QPZA 1UN9A 4TUUA 2LO6A 3VK0A 2VSOE 3FTYA 4WWOA 4DK5A 2CHZA 5T8IA 1HXIA 5J08A 4UI9J 3PEVB 2KATA 3OQOA 2WMOA 2J4BA 3SFZA 4IRUA 1R63A 2IJGX 3ML8A 3FYAA 3BEEA 4KYOB 4OVUA 5A7LA 1RZRA 2BTDA 2Q7FA 2PZIA 2E2EA 1EPUA 1PRVA 3SD5A 4ABNA 3CHSA 3S7JA 2LYSA 2XJ3A 2ZU6B 3FUIA 3ZYLA 4XIFA 2XRYA 2VJ8A 3URZA 3FTZA 1HX8A 2OV8A 1LLIA 5J90A 3BD1A 1Y8MA 3U3WA 1OWOA 1E8WA 4GZ5A 3JUIA 1JWLA 4YARA 4LUNU 4RG6A 4CGVA 1HE8A 2AW6A 3UPVA 1UXDA 3L1PA 4MCXA 4F1SA 3FFLA 3FH7A 4BT8A 4WNEA 3CKCA 4HORA 1FVHA 4KZCA 4TV3A 3TXNA 5CCLA 4XKBA 1XWRA 4YG1A 5AIJA 3CEQA 4RG9A 3FP3A 2NSZA 3N71A 4IULA 1LCDA 3P1UA 4I2WA 5FZQA 4Q94A 4Y6WA 4FHJA 3LYAA 3CVPA 2I2OA 1HG5A 5AJDA 2BNMA 3IHVA 1BDHA 3APFA 4GPKA 2OOEA 2PUAA 2I6HA 3UT7A 4APFA 2LYPA 4DPRA 1O4XA 4A1SA 3MGBA 4XKCA 2O4AA 1OWPA 1PRUA 5FWQA 5G04J 1Y6IA 2B5AA 2GRMA 3SCHA 1LQCA 3QQ6A 1EF1C 3TXMA 3IHYA 3CVNA 5DIZA 3WXXA 1VPWA 4EZLA 2WB2A 3OQMA 3PRZA 3QKYA 3AU4A 4V3IA 3EHNA 3LCAA 3PZDA 3F52A 3FH8A 1NEQA 2VQ2A 4X4CA 2KZTA 3LY7A 2WXQA 4C0MA 3LFPA 1X5BA 3FTXA 1UTXA 2XGMA 5LCWJ 2YQ8A 1HZ4A 2A6CA 3TRBA 4I1OB 4X4DA 3FTSA 2PM7A 4GB9A 2CHWA 4FLHA 4JA7A 4U0SA 2L8NA 2C2LA 3MYVA 1HH8A 3OP9A 4UI9K 3AS4A 2KPJA 1OWLA 2KCLA 2MRIA 3I4GA 2JCGA 3F51A 2FULA 2ICTA 2J09A 4N3AA 4I17A 5BUZA 1Z6TA 1JFSA 4JXTA 3CVUA 1QP4A 3ENEA 5CMWA 2PUCA 2WQ6A 4PU3C 4LEUA 4CT0A 4DLQA 1QZ2A 1IQRA 1MQSA 3OTNA 1L1MA 1U3CA 1LF8A 3ASHA 2WXKA 4L23A 4X4BA 4KZ0A 4O8BA 3TJPA 3FUNA 3ONKA 2XHEA 1ZZBA 2XGOA 2UY1A 2CSFA 1AU7A 4PS7A 4FJYA 3HVEA 4L2LA 1YSEA 2A5UA 2KC7A 2XCCA 3NQPA 3CVWA 4GHJA 4GYWA 4HOQA 5FJYA 4X4IA 2WXHA 2PUGA 4ACKA 3D9LA 1GW6A 1SZAA 3ESKA 4JC8A 5EX3A 5ARFA 4JQDA 2I1KA 4BT9A 2XPZA 3ZHIA 1QQAA 1NA0A 1QQEA 1TJFA 4G26A 4TRQA 5AJLA 4F7AA 2YHCA 3I3NA 3SHFA 1H2UA 4G1TA 3RK6A 1SZ9A 4LERA 5D0QD 3ZFWA 4WNFA 5M72A 3BG0B 4J8EA 4IA8A 3FU0A 1FCHA 4FHKA 3NZUA 1ELWA 4UQYA 3G5GA 4UQZA 4J1XA 2FJRA 2IOSA 5LX8A 3CVXA 1RIOA 2EQXA 1JUQA 3FUEA 3U66A 2LCVA 3CHMA 2HO1A 3OXGA 3PE3A 2VYIA 3UFDA 1JFTA 3GN5B 3KAEA 4NRHB 2UY1B 4UI9C 5BT1A 1WY6A 1POUA 3OXFA 4ILGA 5E75A 4ATGA 3CKBA 2WXMA 4MS6A 4OVVA 4E85A 2CHXA 5JHAA 2HM8A 1WH8A 1INZA 2LYQA 3CECA 3CQGB 2IV1A 1KT0A 3HZIB 4JHJA 3ZHMA 4L1BA 3LJ3A 3NZSA 2L0IA 3IBEA 4EPZA 5JJTA 2XPYA 1HF8A 1HG2A 3CK8A 4O6FA 3ASGA 3CSFA 4BX9A 3SCGA 2YINA 2O49A 4HOUA 4YVOA 4GQMA 3GW4A 3MKQB 4MCTA 2GZUA 1OUVA 4GZ3A 4CGWA 2J49A 4I6UA 1E8XA 3LDZA 3B7RL 3FMYA 4OB4A 4UWFA 4JZYA 1NZNA 4RVBA 4XI9A 2VSXE 2Y3AA 1IQUA 4MRUA 4NQ0A 3I5PA 1X57A 1Z3XA 3GYZA 4FULA 3OAWA 4RSYA 4BY6A 3O9XA 4IWRA 1H2TC 2KEKA 4WWPA 3ASDA 5FQ4A 2Y4TA 3FUJA 4UWKA 4I6GA 1RPEL 3UMVA 5CCMA 3FTUA 2ILRA 3TG4A 4N2SA 2BF0X 4FC8A 3QWWA 2DCPA 1LCCA 3CROL 4BTBA 4GU5A 1DVPA 2QY7A 2HINA 4FP7A 3VTXA 2WUSR 2V8SE 2VSYA 1RZRD 2HYZA 4HLEA 3RKVA 3CHQA 4XI0A 5G04C 4ANUA 3FYMA 2IVQA 2L9BA 3OQNA 4GZDA 3JXBC 2PUBA 3ZYQA 3CHOA 3D9JA 5EX0A 4L7TA 4U04A 5BW8C 4F8DA 2R59A 4XE0A 3S7DA 4WAFA 2CROA 3PXPA 3HYMB 3P2BA 3BS3A 2XSDC 1MHQA 2GGFA 3SBSA 2PUEA 1BPOA 4IYPA 3SZ7A 3L13A 1H19A 3ZVVA 1TJCA 4I6RA 4I1MA 4A55A 5K98B 2V4LA 3FWVA 1HO8A 1E90A 3G2VA 2KEJA 2NC9A 3SCFA 2J07A 5EKQD 3I4RB 3RRNB 4QFVA 5JHBA 5LCWC 4Q69A 3JXCL 4GMLA 3ZEFA 5BNWA 3L54A 2XIUA 3O48A 4IN3B 4J0UA 5T3RA 3GBFA 4FU3A 1E8YA 3UQ3A 4B8AA 2PIJA 2KEIA 3CSTA 3L08A 1PC2A 3QK0A 3U64A 3T5VA 3FU3A 4ME2A 2PE5A 3D9IA 3MA5A 4GYOA 1ELKA 4PU7A 1H0AA 1E3OC 2KZ8A 2AWIA 1L5JA 4N5CA 5ENNA 1HU3A 4Z5CA 2BJCA 1JWGA 2GW1A 3FU5A 1NA3A 3LXUX 5C2YA 5KJLA 3IKOB 5AYWD 2PUFA 1OSLA 4PU4C 4W9RA 4CEMA 2DBAA 5FZRA 2UWJG 3OXLA 4WWNA 3PREA 2AXVA 4DI3A 3JQ1A 4H7YA 1EYHA 1U3DA 2FO7A 3CK7A 1ZPQA 1E96B 3PUJA 4JHRA 4YNDA 3UT8A 2WMNA 2WXPA 1CQTA 4NURA 3AS5A 1GT0C 5BPPA 3ESLA 4YVQC 3IEGA 4GA0A 1R69A 2JLBA 4DJAA 4MLPA 2X6JA 4YG7B 4WUYA 1WH6A 2VGXA 3ZHEA 4JA9A 5BV1A 1BDIA 3HDXA 2KCVA 2XQ0A 3QOUA 2IQCA 2L0TB 3LKUA 4IVZA 4N39A 2IVBA 5ARGA 3GN5A 3AS8A 4K0RA 2P58C 4G11A 4EZKA 1H6KA 1DWKA 3QARA 4UWGA 4FN3A 4J8DA 2FI7A 3K9IA 2XCBA 3FY4A 3U4TA 2IU7A 2IF4A 1HFAA 2IU1A 3MEKA 4ANXA 1YA0A 4PS8A 3LVRE 3TG5A 1NP7A 4L2YA 4CDNA 3B7HA 5ANLA 4URKA 3EHMA 4JCXA 4FA6A 3KEZA 1Z3YA 4LCTA 2EBYA 2XI8A 5KJKA 4X4EA 4Y42A 1VDYA 1LMB3 5FQ8A 2C0LA 3MKQA 4U0UA 3PNLB 1ZZ9A 2WIUB 4GAAA 3LISA 5CHEE 3LS8A 4U07A 4H7XA 4Y6CA 3S7FA 2VGXB 3ZHEB 3MV3B 2R1JL 3CLJA 3FUHA 2OFYA 5DBKA 3BDNA 3ULQA 1QQBA 3QWVA 4CDRA 5KCMA 4G23A 3RO2A 2PM6A 3SBTB 2VTBB 4J1WA 2MHKA 4CCAA 3FUKA 4X4FA 4AEZC 4G25A 3GZ2A 2CFUA 3D9MA 3GZ1A 1E8ZA 1WAO1 3GZSA 5KJMA 2LYRA 2L49A 3AU5A 2WQ7A 4AY6A 3B7TA 4KBQA 3QYXA 4F53A 2OR1L 5D0OD 4HVBA 4JEHA 2BNNA 4KT6B 1XNFA 3CHPA 2RG8A 4K03A 5FTPA 2WXJA 1JH9A 4Q96A 3L6AA 2VGYA 3NF1A 2MEZA 4I8TA 2YNQA 3L17A 4JW1A 5HQ8A 3IVPA 1ZS4A 2KCKA 3FULA 3ONLA 4GCNA 5FQ6A 3SNXA 3T8MA 3CR3A 3FUMA 4I6EA 2JEKA 2J08A 1IHGA 1X2LA 3FTVA 1WETA 1TEZA 2X6HA 1PNRA 3B13A 3D9NA 3ZGQA 4A3VA 2XRZA 4KMOA 3EUSA 2WXFA 3SF4A 4DLOA 3CVLA 4J8SA 4BWRA 3ML9A 3RRMB 2LNIA 3ZYMA 4N3BA 4FJZA 4E6HA 3CVYA 4GA2A 1ZUGA 2X6KA 5FZSA 4AJWA 5E76A 2V0PA 3TL5A 5LFAA 3LEWA 1HS6A 2RD0A 4PDXA 5CMYA 3PH0C 4AM9A 4D10C 4EBAG 3CGHA 3FDHA 1SQ8A 3G2WA 2HR2A 4GCOA 3ZXSA 3HIZA 3SGHA 4F3VA 5KJNA 2XEVA 2ICPA 1UXCA 3FEYA 1B0NA 1H2VC 3APCA 1OCTC 2I9CA 2PQRA 3CK9A 3Q47B 3QJZA 2OVFA 4WNDA 3F6WA 4AIFA 1UG3A 4APOA 2WXIA 3QAQA 4GYYA 1PRAA 2WXNA 3QWPA 3R7RA 3ZIMA 4BX8A 3MJWA 3LY9A 3FTWA 1PAQA 4CDMA 4EECA 2IONA 3UT4A 2LYLA 4HFGA 4A1GA 5T4YA 4UQXA 5G05J 5FT9A 4EZJA 2AXUA 3OMTA 3D9KA 3JQ0A 3KD7A 4AP2A 3MLFA 4HS2A 3CVVA 1QP0A 2CFZA 2R5SA 1FVFA 2CG3A 2A4ZA 4I6TA 3QB2A 4JPSA 4NACA 4ACLA 3ZN3A 1Y9QA 3G7DA 2WXOA 3ASFA 3HHMA 4I9EA 3FU6A 4PUCA 3EIQC 1P5QA 3KJXA 3G2UA 3QNKA 4B94A 2J9QA 2L6JA 4Z5DA 4CT4A 2BNOA 3MCXA 4WNGA 1ZZ8A 1UJKA 1WIZA 1UN8A 3CQCB 4I2ZA 3TGOA 3L16A 3VTYA 4UWLA 4HOSA 2AVPA 1ZBPA 4I9CA 4PU8A 3FUDA 1Y7YA 3RU0A 1JWFA 1N52A 4YBAA 4A3TA 1ZZ7A 2LAIA 2C0MA 3LY8A 4AXHA 4HOTA 4JHKA 3R7QA 1SQMA 1XGWA 1ADRA 4BFRA 1S0PA 3C98A 3EJNA 3MZLB 1HF0A 5A6CA 4LRZA 2WM9A 4AOFA 2PUDA 3B7UX 2YHEA 2AXZA 1ELRA 3S2AA 3S8QA 2EF8A 3Q5MA 1QNFA 3MV2B 1IYGA 3D9PA 2J4DA 3D3MA 4B89A 3CV0A 1CJGA 3APDA 4GMJA 4XX5A 4XZ4A 5ANRA 2VSNA 1KT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O49 A;  1UXD A;  3L1P A;  4MCX A;  1S7E A;  1ZZ9 A;  2WIU B;  4GQM A;  2GZU A;  4MCT A;  3LIS A;  1QP7 A;  4I6U A;  1XWR A;  4YG1 A;  3FMY A;  4OB4 A;  2R1J L;  2OFY A;  4Z5H A;  3BDN A;  1LCD A;  1QQB A;  1X57 A;  4J1W A;  2JVL A;  3O9X A;  2BNM A;  4X4F A;  2KEK A;  1BDH A;  4IWR A;  2PUA A;  2LYP A;  3DNV B;  1O4X A;  2LYR A;  2L49 A;  2XCJ A;  1RPE L;  2O4A A;  3QYX A;  2HSG A;  1PRU A;  1ZZ6 A;  2OR1 L;  2BNN A;  2B5A A;  2GRM A;  3KZ3 A;  1LQC A;  3QQ6 A;  3R1F A;  3SCH A;  4FBI A;  1LCC A;  3CRO L;  2HIN A;  2WUS R;  1VPW A;  1JH9 A;  3OQM A;  1RZR D;  1NER A;  2MEZ A;  4I8T A;  3IVP A;  3F52 A;  1ZS4 A;  3FYM A;  2IUO A;  2IVQ A;  4X4G A;  3OQN A;  3CLC A;  1NEQ A;  3JXB C;  2PUB A;  1IC8 A;  2D5V A;  4F8D A;  4X4C A;  2LYJ A;  3QF3 A;  3LFP A;  1ZZC A;  2CRO A;  1X2L A;  1WET A;  1UTX A;  3PXP A;  3BS3 A;  4Z58 A;  1RZS A;  2A6C A;  2XSD C;  3TRB A;  1PNR A;  4X4D A;  2PUE A;  3EUS A;  4I6R A;  5K98 B;  2L8N A;  3OP9 A;  2KEJ A;  2KPJ A;  2EWT A;  3RZZ A;  3SCF A;  2JCG A;  3F51 A;  1ZUG A;  2ICT A;  3JXC L;  2XIU A;  1JFS A;  1QP4 A;  3GBF A;  2PUC A;  1SQ8 A;  4PU3 C;  1EFA A;  2PIJ A;  2GRL A;  2AUW A;  2KEI A;  3QWG A;  2ICP A;  1UXC A;  1L1M A;  1B0N A;  1OCT C;  4Z59 A;  2PE5 A;  1DW9 A;  3F6W A;  4X4B A;  4PU7 A;  1E3O C;  1PER L;  2KZ8 A;  2AWI A;  4O8B A;  4NDW A;  1PRA A;  4Z5C A;  2BJC A;  1ZZB A;  2LYK A;  2CSF A;  2O38 A;  4PU4 C;  1OSL A;  1AU7 A;  2PUF A;  1YSE A;  2LYL A;  2PPX A;  4GHJ A;  3KXA A;  4X4I A;  2PUG A;  4JCY A;  2AXU A;  3OMT A;  2AXV A;  4JQD A;  3MLF A;  4X4H A;  3D1N I;  1QP0 A;  1ZVV A;  3ZHI A;  1QQA A;  1ZPQ A;  4I6T A;  3ZKC A;  2MQK A;  1ZAY A;  1Y9Q A;  3G7D A;  1CQT A;  4YG4 A;  1GT0 C;  3KJX A;  3H5T A;  2H8R A;  2IVG A;  2R63 A;  1R69 A;  4IA8 A;  2BNO A;  4Z5D A;  3JXD L;  1QPZ A;  1ZZ8 A;  4YG7 B;  1WIZ A;  1WH6 A;  3VK0 A;  3G5G A;  1BDI A;  4J1X A;  2FJR A;  4PU8 A;  3OQO A;  1RIO A;  1Y7Y A;  1R63 A;  4YBA A;  3FYA A;  1ZZ7 A;  5A7L A;  4IVZ A;  2IVB A;  2LCV A;  3GN5 A;  1RZR A;  3UFD A;  1DWK A;  3GN5 B;  1PRV A;  1JFT A;  4FN3 A;  1ADR A;  2LYS A;  2XJ3 A;  1POU A;  2IU7 A;  1HF0 A;  2PUD A;  2AXZ A;  1LLI A;  3BD1 A;  2EF8 A;  3S8Q A;  1WH8 A;  2LYQ A;  3CEC A;  3U3W A;  2IV1 A;  3B7H A;  3HZI B;  3ZHM A;  4JCX A;  2EBY A;  2XI8 A;  1JWL A;  4YAR A;  4X4E A;  1CJG A;  4Y42 A;  1LMB 3;  2AW6 A;  3SCG A; 
#chains in the Genus database with same CATH topology
 1A17 A;  2DIW A;  2E0I A;  3E30 A;  2FBN A;  3CVQ A;  2WXR A;  4I43 A;  3SFX A;  1AWC B;  2VTB A;  2V5F A;  3LVQ E;  3JYS A;  4HNA D;  2KBX A;  3PS6 A;  3MKR A;  4C9B B;  2JVL A;  1EDU A;  2XCJ A;  4J7W A;  4DE9 A;  3Q78 A;  4HQD A;  3EDT B;  3UX4 A;  4EBA A;  4GTM A;  3KZ3 A;  4ZFH A;  5LOZ A;  4FBI A;  2WXG A;  2GRR B;  3R9M A;  2X3M A;  2IUO A;  3TEL A;  4U8H A;  1IC8 A;  3T5X A;  2LYJ A;  2KZT B;  1UJJ A;  1ZU2 A;  5LP0 A;  3E32 A;  3PDN A;  2XGS A;  2XPI A;  5A7D B;  4ILH B;  3QC1 A;  3VLD A;  2EWT A;  2MXD A;  4GTO A;  3IV0 A;  1WM5 A;  2GRL A;  3ZYM A;  4CRW A;  1DNP A;  4HB5 A;  3LPZ A;  4R7L A;  4N3C A;  4N2Q A;  2PL2 A;  4UWH A;  2WXL A;  1JCS A;  2O38 A;  1OWM A;  3FH5 A;  3VLF A;  3Q49 B;  5BV0 A;  1S70 B;  5EYL A;  2VGE A;  2J7U A;  3ZKC A;  3M9L A;  1TN8 A;  5JJ6 A;  2IVG A;  3ZPJ A;  1HXI A;  2WMO A;  3EHQ A;  3AJI A;  4IRU A;  4KYO B;  4F1P A;  2E2E A;  1EPU A;  4ABN A;  3CHS A;  3S7J A;  3FUI A;  1NI1 A;  2ZU6 B;  2VJ8 A;  3QFI A;  1HX8 A;  1UOH A;  4LUN U;  4RG6 A;  2XXP A;  4CGV A;  2AW6 A;  4MCX A;  5D2M C;  3FFL A;  4F1S A;  3LJN A;  4HOR A;  3CKC A;  5HS0 A;  4TV3 A;  4KZC A;  4YG1 A;  5DTM A;  4IUL A;  1LCD A;  5FZQ A;  1SVX A;  3IHV A;  4GPK A;  2OOE A;  4DPR A;  4APF A;  1O4X A;  4A1S A;  5FWQ A;  5CEC B;  1Y6I A;  2B5A A;  3QQ6 A;  3IHY A;  3CVN A;  2QYU A;  3OQM A;  3AU4 A;  1KPS B;  3FH8 A;  1NEQ A;  4X4C A;  4C0M A;  3LY7 A;  3LFP A;  2YQ8 A;  1HZ4 A;  4I1O B;  2PM7 A;  2CHW A;  4FLH A;  4U0S A;  3TWT A;  3IXE A;  2EIK E;  3I4G A;  3UKR G;  5BUZ A;  1JFS A;  4JXT A;  1QP4 A;  3ENE A;  3Q9N C;  1N9A A;  1BI8 B;  3OTN A;  3ASH A;  4EHM A;  1X81 A;  3ABM E;  3ONK A;  4BEP A;  2XXA A;  1ZZB A;  2CSF A;  1AU7 A;  3CVW A;  1YSE A;  4GYW A;  4LSZ E;  2I1K A;  2EIN E;  1NA0 A;  4TRQ A;  1TJF A;  3AG2 E;  1TNO A;  2YHC A;  3I3N A;  3SHF A;  1H2U A;  4G1T A;  2XZD G;  4LER A;  3DSX A;  3ZFW A;  5DSX A;  5M72 A;  3G5G A;  3TFL A;  1JUQ A;  2LLV A;  2LCV A;  3CHM A;  2HO1 A;  3PE3 A;  3ZU7 B;  1JFT A;  4UI9 C;  1NW3 A;  1WY6 A;  4ILG A;  1ZB1 A;  2PXE A;  2WXM A;  4OVV A;  5JHA A;  3ZHM A;  2L0I A;  2XPY A;  1HG2 A;  3CK8 A;  3CSF A;  3SCG A;  2O49 A;  4HOU A;  2GZU A;  2LXL A;  1N95 A;  3DSV A;  4XI9 A;  4JZY A;  4RVB A;  1IQU A;  4DRX E;  3I5P A;  1Z3X A;  2OCC E;  4IWR A;  3DSS A;  4HRN A;  5FQ4 A;  2V3C C;  3FUJ A;  4I6G A;  3QWW A;  4BTB A;  2WUS R;  2V8S E;  1RZR D;  4ANU A;  4GZD A;  3OQN A;  3CHO A;  5EX0 A;  4L7T A;  1JCQ A;  1BPO A;  3ZVV A;  1TJC A;  2V4L A;  3FWV A;  2VEO A;  1HO8 A;  3G2V A;  2NC9 A;  5EKQ D;  3I4R B;  4DE8 A;  3JXC L;  4GML A;  3ZEF A;  2P9L G;  1LD8 A;  3UQ3 A;  2M4H A;  3T5V A;  4O60 A;  1ELK A;  1H0A A;  1E3O C;  1L5J A;  2AWI A;  5ENO D;  1HU3 A;  4Z5C A;  2BJC A;  1JWG A;  2QYJ A;  3FU5 A;  1NA3 A;  4W9R A;  4GTS A;  2UWJ G;  3OXL A;  4WWN A;  1Z5S C;  2FO7 A;  3PUJ A;  1ZPQ A;  1LD7 A;  2XS1 A;  3T9K A;  2RKK A;  2WXP A;  4NUR A;  3C3R A;  3AS5 A;  4YVQ C;  1R69 A;  3ZPX A;  4DJA A;  4MLP A;  4YG7 B;  5CEA A;  4JA9 A;  1OXJ A;  3OKZ A;  3PZ3 A;  2XQ0 A;  5GAG i;  5ARG A;  3AS8 A;  4K0R A;  4EZK A;  1H6K A;  4FN3 A;  4J8D A;  3U4T A;  4ANX A;  3B7H A;  1N0R A;  5KJK A;  4DX1 A;  3KSQ A;  1LMB 3;  1H6P A;  1ZZ9 A;  4GAA A;  3LIS A;  4U07 A;  3S7F A;  4H7X A;  3ZHE B;  5DBK A;  3NOG D;  4AEZ C;  3GZ2 A;  3B7T A;  4KBQ A;  1V54 E;  2OR1 L;  4HVB A;  4JEH A;  4JB8 P;  2XEE A;  1FPP A;  4BER A;  2VGY A;  3L17 A;  4YDW A;  3FUM A;  1TN6 A;  3ZGQ A;  3A9X A;  2XXQ A;  4BWR A;  4N3B A;  2X6K A;  5FZS A;  4AJW A;  5LFA A;  1HS6 A;  4PDX A;  4AM9 A;  4D10 C;  4EBA G;  3FDH A;  4GCO A;  3CK9 A;  2PQR A;  4GMR A;  3A9Y A;  2PXL A;  4DX7 D;  3R7R A;  3FTW A;  2ION A;  3UT4 A;  4GTT A;  4UQX A;  2AXU A;  4K5B A;  3MLF A;  4NAC A;  4I6T A;  4ACL A;  2PXU A;  3FU6 A;  1IHB A;  3KJX A;  2J9Q A;  2GRP B;  4WNG A;  1WIZ A;  4I2Z A;  4HOS A;  4UWL A;  2L1P A;  1ZZ7 A;  2C0M A;  4JHK A;  3R7Q A;  1SQM A;  2ETA A;  3MZL B;  1HF0 A;  4LRZ A;  3B7U X;  1QNF A;  3D9P A;  2J4D A;  1RZ4 A;  4B89 A;  4GMJ A;  3Q15 A;  2MOW A;  3EU5 A;  3RIB A;  3EIJ A;  2BKK B;  4HRA A;  4U63 A;  2R2L A;  4ER5 A;  2XS8 A;  1RW2 A;  4G2V A;  2WQH A;  4P29 A;  3DNV B;  1YCS B;  3DXM G;  4KVM A;  3PVL A;  1OWN A;  3R1F A;  3PEU B;  3ME5 A;  4HI9 A;  1NER A;  4BSX A;  2WVI A;  4UUC A;  2D5V A;  3V79 K;  4M3O A;  3UWP A;  1FT1 A;  4K5C A;  2R05 A;  2FF4 A;  3MX3 A;  2OEW A;  3RJV A;  2IOL A;  2OVB A;  4I6J A;  2ZGD A;  4ATZ D;  2PXP A;  3RZZ A;  1D8E A;  4G8L A;  2F0Y A;  3QWG A;  5G55 A;  4OYS A;  3ISM C;  1DW9 A;  3MEJ A;  1PER L;  3FEX A;  4NDW A;  3E34 A;  1HQ1 A;  2R17 C;  4MKT A;  2OND A;  2PPX A;  3HVE B;  3KXA A;  4JCY A;  4JL0 A;  3BUA A;  3JCK C;  1QZX A;  3VLE A;  4X4H A;  4AY5 A;  1D8D A;  2R02 A;  5C1D A;  3S7B A;  3G2S A;  3ULE G;  2H8R A;  3UI2 A;  2KM4 A;  3RRU A;  2LO6 A;  3FTY A;  3UXG A;  4ER3 A;  4UI9 J;  2KAT A;  3SFZ A;  1R63 A;  3FYA A;  4OVU A;  5A7L A;  3ZNG A;  1WG0 A;  1N94 A;  1PRV A;  2XJ3 A;  1N0Q A;  3ZYL A;  3URZ A;  3GZD A;  3DWL G;  3FTZ A;  4A63 B;  5J90 A;  3BD1 A;  4GZ5 A;  2LNM A;  4YAR A;  3ASN E;  5BXO A;  1N11 A;  1UXD A;  3FH7 A;  4WNE A;  1XWR A;  5AIJ A;  2BED A;  2NSZ A;  3NAW A;  3P1U A;  4I2W A;  5CRV A;  4TXQ A;  4F6R D;  4FHJ A;  2BNM A;  1BDH A;  3APF A;  4L9P A;  3MGB A;  4XKC A;  2O4A A;  2B6C A;  1TR4 A;  1PRU A;  2GRM A;  1LQC A;  1VPW A;  4V3I A;  3EHN A;  2PXB A;  3F52 A;  3QOW A;  3UIO C;  1X5B A;  5B3S E;  2BKG A;  2V5Q C;  4X4D A;  4GB9 A;  3MYV A;  2C2L A;  5AJD A;  3AS4 A;  3EUV A;  1OWL A;  2JCG A;  3CVU A;  3EU9 A;  3GUU A;  2PUC A;  5CMW A;  2WQ6 A;  1IQR A;  5BXU A;  1L1M A;  1SA5 A;  5AQA A;  2FO1 E;  2WXK A;  4X4B A;  4KZ0 A;  2DYS E;  2XGO A;  5B1A E;  2RFM A;  4FJY A;  3ULY A;  4GHJ A;  2XZT G;  5FJY A;  2WXH A;  2PUG A;  4ACK A;  3ESK A;  5ARF A;  4JQD A;  4DX5 D;  2XPZ A;  3ZHI A;  4G26 A;  1SZ9 A;  4EZI A;  1TNY A;  2ZIR A;  5LX8 A;  1RIO A;  3AG1 E;  3U66 A;  3OXG A;  3UFD A;  3KAE A;  3GN5 B;  2UY1 B;  3UIP C;  4EKG A;  1TNZ A;  1BU9 A;  3CEC A;  4LNU D;  4JHJ A;  1HF8 A;  2P9U G;  4BX9 A;  3ASO E;  3MKQ B;  3ZUV B;  1NZN A;  3EHR A;  5CRU A;  5CER B;  3C72 A;  1X57 A;  3GYZ A;  4RSY A;  1DCQ A;  4UWK A;  1RPE L;  5CCM A;  1OY3 D;  4HBD A;  2DCP A;  1LCC A;  4GU5 A;  2HIN A;  3VTX A;  2YBD A;  3C3O A;  3CHQ A;  4XI0 A;  2IVQ A;  1O1T A;  2PUB A;  4CYM D;  4BY6 A;  4EEC A;  2XEH A;  4U04 A;  4F8D A;  4XE0 A;  3BU8 A;  3HXF A;  2V4H C;  3PXP A;  3HYM B;  3P2B A;  3BS3 A;  4N5Q A;  2GGF A;  2PUE A;  3SZ7 A;  2LLW A;  4I1M A;  5ITZ F;  4A55 A;  4U8V D;  5AQ7 A;  1MZC A;  1E90 A;  3SCF A;  3RRN B;  4QFV A;  5JA4 D;  3L54 A;  4IN3 B;  4J0U A;  4B8A A;  1E8Y A;  1K1B A;  3L08 A;  1O5M A;  2PE5 A;  3JXJ A;  2KZ8 A;  4N5C A;  2PXF A;  1IKN D;  5KJL A;  5AYW D;  2PUF A;  2PNN A;  4H7Y A;  1U3D A;  4JHR A;  3SO8 A;  3UM1 A;  3JXI A;  1MX6 A;  1GT0 C;  2JAB A;  5BPP A;  2H6F A;  4GA0 A;  3AG4 E;  2JLB A;  3HXD A;  3ZHE A;  1BDI A;  3HDX A;  3QOU A;  4BSZ B;  3LKU A;  4IVZ A;  3VWS A;  4UWG A;  4RQI A;  1K3Z D;  4GTQ A;  3FY4 A;  2IU7 A;  2IU1 A;  4PS8 A;  1NP7 A;  3KEZ A;  1Z3Y A;  2EBY A;  1VDY A;  3LQX A;  4U0U A;  3J5P A;  1O1S A;  2WIU B;  3TWQ A;  3FUH A;  2RFA A;  3BDN A;  4CDR A;  1QQB A;  3QWV A;  1BD8 A;  4G23 A;  5KCM A;  4OAU C;  2VTB B;  3UTM A;  3FUK A;  4X4F A;  4G25 A;  2CFU A;  3D9M A;  3GZS A;  1WAO 1;  2WQ7 A;  1U2Z A;  5KNG A;  4KT6 B;  3CHP A;  1QB2 A;  2RG8 A;  1WDY A;  3NF1 A;  5HQ8 A;  3DPY A;  3IVP A;  2KCK A;  3FUL A;  5FQ6 A;  3TEP A;  3SNX A;  4ER0 A;  2XEN A;  5AQB A;  3FTV A;  2QC9 A;  2X6H A;  4EK9 A;  3CVL A;  3ABK E;  2FFH A;  4FJZ A;  4E6H A;  3CVY A;  2V0P A;  3LEW A;  5CMY A;  5DTR A;  5FIN A;  3APC A;  3Q47 B;  4M7C A;  3F6W A;  1UG3 A;  2WXI A;  3QAQ A;  4GYY A;  2WXN A;  3QWP A;  3ZIM A;  4CDM A;  4A1G A;  5T4Y A;  3DSW A;  4EZJ A;  5FT9 A;  3D9K A;  3GZC A;  1QP0 A;  1FVF A;  2CG3 A;  2A4Z A;  3QB2 A;  3ZN3 A;  1Y9Q A;  3NDB B;  3ZKJ A;  5CBN A;  1S63 A;  4PUC A;  3EIQ C;  1OCO E;  1UJK A;  3SY2 A;  3CQC B;  2AVP A;  2LAI A;  3C98 A;  5IY5 E;  2WM9 A;  2AXZ A;  3S2A A;  3S8Q A;  2EF8 A;  3MV2 B;  1IYG A;  3D3M A;  4NIK A;  3APD A;  4XZ4 A;  5ANR A;  5D0Q D;  1KT1 A;  1JPL A;  1SW6 A;  3FHE A;  2NXP A;  1QP7 A;  2PXD A;  5G2N A;  2IEJ A;  1N4P A;  4Z5H A;  2DZO A;  3ZYK A;  2I1J A;  3KS2 A;  4GZC A;  2X6I A;  4JVS A;  3U9W A;  3G0T A;  5ENQ D;  4OBM A;  3ZW3 A;  2CG2 A;  1DUL A;  3Q7F A;  1ZZ6 A;  1PY1 A;  4AV7 A;  3R9A B;  4LG6 A;  5AEN A;  1UW4 B;  4X4G A;  5HKP A;  4B8C B;  2M63 A;  3Q73 A;  4KXK B;  3L22 A;  4J8F A;  3RSE G;  4PS3 A;  4DI4 A;  3O4Z A;  3UUX A;  2FEZ A;  3HRA A;  1KLX A;  4KVO A;  3UKU G;  3CIA A;  3B7S A;  3TWR A;  4HXI A;  4GZ6 A;  3KL4 A;  5HI7 A;  4U8Y D;  4FLB A;  1N54 A;  3QOX A;  1B89 A;  3J5Q B;  5JJ7 A;  1OCC E;  4GA1 A;  5ENS D;  3X2Q E;  1ZVV A;  4JEU A;  3FUF A;  4ILI A;  2MQK A;  1ZAY A;  2WPV A;  5B1B E;  4AVX A;  1MX2 A;  4YG4 A;  5EDS A;  3DPD A;  4TXR A;  3PE4 A;  1N4Q A;  1UN9 A;  3VK0 A;  1BI7 B;  3PEV B;  3TWU A;  3BEE A;  3HXE A;  1RZR A;  2Q7F A;  3TWV A;  2LYS A;  1KZO A;  3UM2 A;  2OV8 A;  1LLI A;  1Y8M A;  3U3W A;  1OWO A;  4WVL A;  1HE8 A;  3UM0 A;  1FVH A;  5CCL A;  3CEQ A;  4RG9 A;  5EIL A;  3UM3 A;  1N4R A;  2Y1L E;  4Y6W A;  1DC2 A;  1OCZ E;  1HG5 A;  2PUA A;  3UT7 A;  2LYP A;  5DRT A;  1OWP A;  3DEP A;  3SCH A;  2H6G A;  3AAA C;  5HRY A;  5DIZ A;  4EZL A;  2WB2 A;  2P9S G;  3LCA A;  5H7P A;  4LNG A;  2VQ2 A;  2KZT A;  2LUH A;  2WXQ A;  3SFY A;  4LNB A;  2XGM A;  2H6H A;  3TRB A;  4HRM B;  1G3N B;  4JA7 A;  3A9Z A;  2L8N A;  2J8S D;  1HH8 A;  4UI9 K;  2J09 A;  1Z6T A;  4PU3 C;  3DXK G;  1O1R A;  4CT0 A;  1QZ2 A;  4DLQ A;  1MQS A;  1U3C A;  4O8B A;  3TJP A;  2UY1 A;  4PS7 A;  4L2L A;  3NQP A;  3D9L A;  3ZXP A;  1SZA A;  5KNH D;  1QQA A;  1QQE A;  4F7A A;  3RK6 A;  2GRN B;  1NL4 A;  3BG0 B;  4J8E A;  2EIL E;  4IA8 A;  4YDE A;  3FU0 A;  1FCH A;  1OT8 A;  1TNU A;  1ELW A;  1MYO A;  2MYO A;  2FJR A;  2IOS A;  2EQX A;  4EKI A;  5EIB E;  2VYI A;  4NRH B;  4U95 D;  1POU A;  4ATG A;  5E75 A;  4MS6 A;  1QYM A;  1V55 E;  2HM8 A;  2OEV A;  1INZ A;  3CQG B;  1KT0 A;  3HZI B;  4GTR A;  3LJ3 A;  4EPZ A;  4O6F A;  3ASG A;  3V2O A;  2HE0 A;  2B0O E;  2YIN A;  4GQM A;  3GW4 A;  4MCT A;  4GZ3 A;  4CGW A;  4I6U A;  3KEA A;  3LDZ A;  4CZ2 D;  3B7R L;  4OB4 A;  4UWF A;  2VSX E;  2Y3A A;  4NQ0 A;  4FUL A;  3L82 A;  1H2T C;  4WWP A;  5AQ9 A;  2L6B A;  3ASD A;  1TN7 A;  2Y4T A;  3UMV A;  3FTU A;  2QY7 A;  4FP7 A;  2VSY A;  1D9S A;  2P9N G;  2HYZ A;  5G04 C;  1FT2 A;  4TXP A;  3JXB C;  5KWD A;  3S7D A;  2CRO A;  3GZD C;  3L13 A;  1H19 A;  4I6R A;  4U96 D;  5DRY A;  5LCW C;  2J07 A;  5JHB A;  5BNW A;  1S64 A;  3O48 A;  3Q7A A;  4FU3 A;  2PIJ A;  3SR4 A;  2KEI A;  3QK0 A;  3FU3 A;  4ME2 A;  3D9I A;  3MA5 A;  4GYO A;  2GW1 A;  1MFQ C;  3IKO B;  1OSL A;  4CEM A;  2DBA A;  4QQI A;  2AXV A;  3JQ1 A;  1EYH A;  3CK7 A;  4YND A;  3UT8 A;  2R03 A;  2WMN A;  1CQT A;  3IEG A;  4WUY A;  2ETC A;  4ER7 A;  2IQC A;  2L0T B;  4HLL A;  4N39 A;  2IVB A;  3DSU A;  4G11 A;  3K9I A;  3NZL A;  2IF4 A;  2DZN A;  1HFA A;  1YA0 A;  3LVR E;  4L2Y A;  4CDN A;  4DUI A;  4FA6 A;  4LCT A;  2XI8 A;  2F8Y A;  5JUW A;  2NYJ A;  3LS8 A;  2HCS A;  1BLX B;  2VGX B;  4Q2J A;  3CLJ A;  2OFY A;  3ULQ A;  3RO2 A;  2PM6 A;  2MHK A;  4GTP A;  3D9H A;  3GZ1 A;  2ZXW E;  4AY6 A;  3B95 A;  3QYX A;  4F53 A;  2A5E A;  1OCR E;  2BNN A;  1XNF A;  5FTP A;  1JH9 A;  2MEZ A;  4I8T A;  2YNQ A;  1ZS4 A;  2JEK A;  1IHG A;  1X2L A;  1TEZ A;  1WET A;  3JUE A;  3BQO A;  3B13 A;  4A3V A;  2XRZ A;  4KMO A;  3EUS A;  3NBN B;  4DLO A;  4J8S A;  3ML9 A;  1SA4 A;  5E76 A;  2RD0 A;  3PZ1 A;  3G2W A;  4F3V A;  3HIZ A;  3SGH A;  5EID A;  2ICP A;  1H2V C;  3QJZ A;  2DVW A;  4WND A;  4APO A;  2PXV A;  1PRA A;  3LY9 A;  2LYL A;  4HFG A;  2EIM E;  3Q75 A;  3OMT A;  4AP2 A;  4HS2 A;  2CFZ A;  2P9K G;  4JPS A;  2WXO A;  3HHM A;  4G8K A;  4I9E A;  4B94 A;  4GTV A;  4Z5D A;  3MCX A;  3NB2 A;  1ZZ8 A;  1UN8 A;  4B93 B;  3TGO A;  3L16 A;  4I9C A;  4PU8 A;  3RU0 A;  1JWF A;  4YBA A;  4AXH A;  4HOT A;  4DX2 A;  1XGW A;  1ADR A;  4BFR A;  2AJA A;  4AOF A;  2PUD A;  2LXM A;  2YHE A;  1AP7 A;  3PE5 A;  2IO3 C;  3CV0 A;  4XX5 A;  1K1A A;  1S7E A;  2QFC A;  3CHR A;  3V30 A;  5FQ7 A;  3PUK A;  1E7U A;  3DBS A;  3TAX A;  3BG1 B;  1QBQ A;  2IY0 C;  2DYR E;  5DTQ A;  5GAH i;  3HXC A;  3NOC D;  2F8X K;  3SI5 A;  5EN5 D;  2X38 A;  2HSG A;  4G24 A;  4RLY A;  3TWX A;  2IFU A;  2LSV A;  2Y4U A;  3RO3 A;  4BTA A;  4EQF A;  3CLC A;  3RAU A;  4C0E A;  1A5E A;  3QF3 A;  4Z68 A;  1ZZC A;  3W9G A;  4J6I A;  4Z58 A;  1RZS A;  3D9O A;  2LSU A;  5DT2 A;  2X6F A;  3PNT B;  3DM5 A;  3ZRH A;  1EFA A;  2AUW A;  2LAH A;  4PH4 B;  4U0Z A;  1W3B A;  3G2T A;  3QDN A;  4Z59 A;  4B0Z A;  4I1A A;  2PXK A;  5A23 A;  4FAD A;  2BUG A;  2LYK A;  2P2C P;  3TWS A;  2PQN A;  3Q4A B;  3D1N I;  2HCN A;  3E4B A;  4ANV A;  4BET A;  2IO2 C;  1E7V A;  1K8K G;  5G05 C;  4ANW A;  4GPM A;  3H5T A;  3W9F A;  2R63 A;  3JXD L;  1QPZ A;  4TUU A;  4WWO A;  2VSO E;  1U2V G;  2CHZ A;  5T8I A;  5J08 A;  3OQO A;  2J4B A;  3C5R A;  2IJG X;  3ML8 A;  3DST A;  1DCE A;  2J7W A;  2BTD A;  2PZI A;  3SD5 A;  3WG7 E;  4HRL A;  4XIF A;  2XRY A;  2GRQ B;  3Q9U C;  1E8W A;  3JUI A;  1JWL A;  4YDY A;  3UPV A;  4O1O A;  3L1P A;  3V2X A;  4BT8 A;  3TXN A;  4XKB A;  3FP3 A;  2Y0B G;  3N71 A;  4Q94 A;  3LYA A;  3CVP A;  2I2O A;  1YMP A;  2I6H A;  2GRO B;  4YDO A;  5G04 J;  3TXM A;  1EF1 C;  3WXX A;  1IXV A;  3PRZ A;  3QKY A;  3PZD A;  2H6I A;  3FTX A;  2DWZ A;  1MX4 A;  1UTX A;  5LCW J;  2A6C A;  4ER6 A;  3FTS A;  3HG0 D;  3OP9 A;  3HXB A;  2KPJ A;  2KCL A;  2MRI A;  3F51 A;  1Q2Z A;  2FUL A;  2ICT A;  3OWQ A;  4N3A A;  4I17 A;  4LEU A;  1LF8 A;  3L9T A;  3Q79 A;  3F6Q A;  4L23 A;  3FUN A;  2XHE A;  5KBA A;  3HVE A;  2KC7 A;  2A5U A;  2XCC A;  4HOQ A;  4DX6 D;  4X4I A;  1GW6 A;  4JC8 A;  5EX3 A;  4BT9 A;  3TWW A;  5AJL A;  1JCR A;  4K5A B;  4BES A;  2F37 A;  4WNF A;  4FHK A;  3NZU A;  4O1P A;  4UQY A;  4UQZ A;  4J1X A;  3CVX A;  3FUE A;  5BT1 A;  3OXF A;  5ENT D;  5D66 A;  3CKB A;  4E85 A;  2CHX A;  1WH8 A;  2LYQ A;  2IV1 A;  4L1B A;  3NZS A;  3IBE A;  5JJT A;  4YVO A;  1KZP A;  1OUV A;  2J49 A;  3SQV A;  1E8X A;  3FMY A;  2KXP C;  4J8Y A;  4MRU A;  3OAW A;  3O9X A;  2KEK A;  3SX0 A;  3B7B A;  4XEI G;  2ILR A;  3TG4 A;  1YYH A;  2Y69 E;  2BF0 X;  4FC8 A;  4N2S A;  4EQZ A;  3CRO L;  1DVP A;  3V31 A;  4HLE A;  3RKV A;  3FYM A;  2L9B A;  3ZYQ A;  3D9J A;  4JD2 G;  5BW8 C;  3NRO A;  2R59 A;  5CED B;  4WAF A;  2XSD C;  1MHQ A;  1N4S A;  3SBS A;  4IYP A;  5K98 B;  2KEJ A;  5JMN D;  4Q69 A;  5T3R A;  2XIU A;  3GBF A;  3U64 A;  3CST A;  1PC2 A;  3DEO A;  3R09 A;  4PU7 A;  5ENN A;  3LXU X;  5C2Y A;  4PU4 C;  5FZR A;  3KSL A;  3PRE A;  4DI3 A;  4DK5 A;  1E96 B;  3C3Q A;  4C48 B;  3ESL A;  3PZ2 A;  1H6O A;  2X6J A;  3E37 A;  1WH6 A;  2VGX A;  5BV1 A;  3ABL E;  4ZHB A;  2KCV A;  3T8K A;  4TUM A;  3GN5 A;  2P58 C;  5AAO A;  1DWK A;  3QAR A;  2FI7 A;  3DRA A;  2P9I G;  2XCB A;  3MEK A;  5EYP F;  3TG5 A;  5ANL A;  4URK A;  3EHM A;  4JCX A;  2P9P G;  4X4E A;  4Y42 A;  1LTX A;  5FQ8 A;  2C0L A;  3MKQ A;  3PNL B;  3UIN C;  5CHE E;  4Y6C A;  3MV3 B;  2R1J L;  5AN8 A;  2ETB A;  5AAR A;  3SBT B;  4J1W A;  4CCA A;  2JQE A;  5CBO A;  1E8Z A;  5KJM A;  2LYR A;  2L49 A;  3AU5 A;  2ZIS A;  5FIO A;  5D0O D;  4K03 A;  2WXJ A;  4Q96 A;  3L6A A;  4JW1 A;  3ONL A;  4GCN A;  3T8M A;  3CR3 A;  4I6E A;  2EIJ E;  2J08 A;  1TNB A;  1PNR A;  3D9N A;  4X8Q A;  2WXF A;  3SF4 A;  3RRM B;  2LNI A;  4GA2 A;  1ZUG A;  3TL5 A;  3PH0 C;  3CGH A;  1SQ8 A;  2HR2 A;  3ZXS A;  5KJN A;  2XEV A;  1UXC A;  3FEY A;  1B0N A;  1OCT C;  2I9C A;  1MJ0 A;  2OVF A;  4AIF A;  2ZGG A;  2ODR D;  4HI8 A;  2PXT A;  4BX8 A;  3MJW A;  1PAQ A;  1NFI E;  3AG3 E;  3PZ4 A;  5G05 J;  3JQ0 A;  3KD7 A;  3CVV A;  2R5S A;  3G7D A;  3ASF A;  2QZA A;  4MBG A;  3G2U A;  1P5Q A;  3QNK A;  2L6J A;  4CT4 A;  2PXQ A;  2BNO A;  1TYQ G;  4OAV B;  3VTY A;  5ENP D;  1ZBP A;  3FUD A;  1Y7Y A;  1N52 A;  4A3T A;  3NXH A;  3LY8 A;  3E33 A;  4U7E B;  1S0P A;  3EJN A;  5A6C A;  2HFZ A;  1ELR A;  5ENR D;  3Q5M A;  1CJG A;  2VSN A; 
#chains in the Genus database with same CATH homology
 3Q15 A;  1A17 A;  1JPL A;  2MOW A;  1S7E A;  3FHE A;  2NXP A;  2DIW A;  2QFC A;  2E0I A;  1QP7 A;  2FBN A;  3CHR A;  3EIJ A;  3RIB A;  5G2N A;  5FQ7 A;  3CVQ A;  2WXR A;  3PUK A;  1E7U A;  4I43 A;  3DBS A;  4Z5H A;  2VTB A;  2V5F A;  3TAX A;  3LVQ E;  3BG1 B;  3JYS A;  2I1J A;  3ZYK A;  3KS2 A;  4GZC A;  3MKR A;  3PS6 A;  4U63 A;  4C9B B;  2JVL A;  1EDU A;  2X6I A;  4JVS A;  3U9W A;  4G2V A;  2WQH A;  4P29 A;  3DNV B;  3SI5 A;  2XCJ A;  2X38 A;  3ZW3 A;  2CG2 A;  2HSG A;  4KVM A;  1ZZ6 A;  1PY1 A;  3EDT B;  1OWN A;  3PVL A;  4G24 A;  3R1F A;  3UX4 A;  3R9A B;  3KZ3 A;  4AV7 A;  4EBA A;  5LOZ A;  4FBI A;  3PEU B;  4N2Q A;  5AEN A;  2WXG A;  2IFU A;  1UW4 B;  1NER A;  2LSV A;  2Y4U A;  3RO3 A;  2X3M A;  4BTA A;  4EQF A;  3CLC A;  2IUO A;  4BSX A;  4X4G A;  2WVI A;  4C0E A;  4U8H A;  1IC8 A;  2D5V A;  4B8C B;  2M63 A;  2LYJ A;  4KXK B;  3QF3 A;  4M3O A;  3T5X A;  1ZZC A;  2KZT B;  3L22 A;  1UJJ A;  1ZU2 A;  4J8F A;  2FF4 A;  4J6I A;  5LP0 A;  4Z58 A;  1RZS A;  3D9O A;  3MX3 A;  4PS3 A;  3PDN A;  2XGS A;  3RJV A;  4DI4 A;  2XPI A;  3O4Z A;  3UUX A;  2IOL A;  2OVB A;  4I6J A;  5A7D B;  4ILH B;  2LSU A;  3QC1 A;  2FEZ A;  3VLD A;  3RZZ A;  2EWT A;  1KLX A;  4KVO A;  2X6F A;  3IV0 A;  3PNT B;  1WM5 A;  3CIA A;  3B7S A;  3ZRH A;  1EFA A;  2GRL A;  2AUW A;  4HXI A;  2LAH A;  4PH4 B;  4GZ6 A;  3QWG A;  1W3B A;  3G2T A;  4U0Z A;  5G55 A;  3QDN A;  4CRW A;  1DNP A;  4OYS A;  4Z59 A;  4B0Z A;  1DW9 A;  3LPZ A;  4I1A A;  4N3C A;  1PER L;  2PL2 A;  3FEX A;  4R7L A;  5HI7 A;  5A23 A;  4UWH A;  4NDW A;  4FLB A;  4FAD A;  2BUG A;  2WXL A;  2LYK A;  2O38 A;  1OWM A;  1N54 A;  3FH5 A;  2R17 C;  4MKT A;  2OND A;  2PPX A;  2PQN A;  3Q49 B;  3VLF A;  3HVE B;  1B89 A;  3KXA A;  3Q4A B;  5BV0 A;  4JCY A;  4GA1 A;  4JL0 A;  5JJ7 A;  3JCK C;  3VLE A;  4X4H A;  3D1N I;  1ZVV A;  4JEU A;  3E4B A;  3FUF A;  4ILI A;  3ZKC A;  4ANV A;  2MQK A;  1ZAY A;  2WPV A;  4AVX A;  4AY5 A;  1E7V A;  5G05 C;  4ANW A;  4YG4 A;  5EDS A;  5C1D A;  3DPD A;  3S7B A;  3G2S A;  5JJ6 A;  3H5T A;  2H8R A;  2IVG A;  3PE4 A;  2KM4 A;  3ZPJ A;  2R63 A;  3RRU A;  3JXD L;  1QPZ A;  1UN9 A;  4TUU A;  2LO6 A;  3VK0 A;  2VSO E;  3FTY A;  4WWO A;  4DK5 A;  2CHZ A;  5T8I A;  1HXI A;  5J08 A;  4UI9 J;  3PEV B;  2KAT A;  3OQO A;  2WMO A;  2J4B A;  3SFZ A;  4IRU A;  1R63 A;  2IJG X;  3ML8 A;  3FYA A;  3BEE A;  4KYO B;  4OVU A;  5A7L A;  1RZR A;  2BTD A;  2Q7F A;  2PZI A;  2E2E A;  1EPU A;  1PRV A;  3SD5 A;  4ABN A;  3CHS A;  3S7J A;  2LYS A;  2XJ3 A;  2ZU6 B;  3FUI A;  3ZYL A;  4XIF A;  2XRY A;  2VJ8 A;  3URZ A;  3FTZ A;  1HX8 A;  2OV8 A;  1LLI A;  5J90 A;  3BD1 A;  1Y8M A;  3U3W A;  1OWO A;  1E8W A;  4GZ5 A;  3JUI A;  1JWL A;  4YAR A;  4LUN U;  4RG6 A;  4CGV A;  1HE8 A;  2AW6 A;  3UPV A;  1UXD A;  3L1P A;  4MCX A;  4F1S A;  3FFL A;  3FH7 A;  4BT8 A;  4WNE A;  3CKC A;  4HOR A;  1FVH A;  4KZC A;  4TV3 A;  3TXN A;  5CCL A;  4XKB A;  1XWR A;  4YG1 A;  5AIJ A;  3CEQ A;  4RG9 A;  3FP3 A;  2NSZ A;  3N71 A;  4IUL A;  1LCD A;  3P1U A;  4I2W A;  5FZQ A;  4Q94 A;  4Y6W A;  4FHJ A;  3LYA A;  3CVP A;  2I2O A;  1HG5 A;  5AJD A;  2BNM A;  3IHV A;  1BDH A;  3APF A;  4GPK A;  2OOE A;  2PUA A;  2I6H A;  3UT7 A;  4APF A;  2LYP A;  4DPR A;  1O4X A;  4A1S A;  3MGB A;  4XKC A;  2O4A A;  1OWP A;  1PRU A;  5FWQ A;  5G04 J;  1Y6I A;  2B5A A;  2GRM A;  3SCH A;  1LQC A;  3QQ6 A;  1EF1 C;  3TXM A;  3IHY A;  3CVN A;  5DIZ A;  3WXX A;  1VPW A;  4EZL A;  2WB2 A;  3OQM A;  3PRZ A;  3QKY A;  3AU4 A;  4V3I A;  3EHN A;  3LCA A;  3PZD A;  3F52 A;  3FH8 A;  1NEQ A;  2VQ2 A;  4X4C A;  2KZT A;  3LY7 A;  2WXQ A;  4C0M A;  3LFP A;  1X5B A;  3FTX A;  1UTX A;  2XGM A;  5LCW J;  2YQ8 A;  1HZ4 A;  2A6C A;  3TRB A;  4I1O B;  4X4D A;  3FTS A;  2PM7 A;  4GB9 A;  2CHW A;  4FLH A;  4JA7 A;  4U0S A;  2L8N A;  2C2L A;  3MYV A;  1HH8 A;  3OP9 A;  4UI9 K;  3AS4 A;  2KPJ A;  1OWL A;  2KCL A;  2MRI A;  3I4G A;  2JCG A;  3F51 A;  2FUL A;  2ICT A;  2J09 A;  4N3A A;  4I17 A;  5BUZ A;  1Z6T A;  1JFS A;  4JXT A;  3CVU A;  1QP4 A;  3ENE A;  5CMW A;  2PUC A;  2WQ6 A;  4PU3 C;  4LEU A;  4CT0 A;  4DLQ A;  1QZ2 A;  1IQR A;  1MQS A;  3OTN A;  1L1M A;  1U3C A;  1LF8 A;  3ASH A;  2WXK A;  4L23 A;  4X4B A;  4KZ0 A;  4O8B A;  3TJP A;  3FUN A;  3ONK A;  2XHE A;  1ZZB A;  2XGO A;  2UY1 A;  2CSF A;  1AU7 A;  4PS7 A;  4FJY A;  3HVE A;  4L2L A;  1YSE A;  2A5U A;  2KC7 A;  2XCC A;  3NQP A;  3CVW A;  4GHJ A;  4GYW A;  4HOQ A;  5FJY A;  4X4I A;  2WXH A;  2PUG A;  4ACK A;  3D9L A;  1GW6 A;  1SZA A;  3ESK A;  4JC8 A;  5EX3 A;  5ARF A;  4JQD A;  2I1K A;  4BT9 A;  2XPZ A;  3ZHI A;  1QQA A;  1NA0 A;  1QQE A;  1TJF A;  4G26 A;  4TRQ A;  5AJL A;  4F7A A;  2YHC A;  3I3N A;  3SHF A;  1H2U A;  4G1T A;  3RK6 A;  1SZ9 A;  4LER A;  5D0Q D;  3ZFW A;  4WNF A;  5M72 A;  3BG0 B;  4J8E A;  4IA8 A;  3FU0 A;  1FCH A;  4FHK A;  3NZU A;  1ELW A;  4UQY A;  3G5G A;  4UQZ A;  4J1X A;  2FJR A;  2IOS A;  5LX8 A;  3CVX A;  1RIO A;  2EQX A;  1JUQ A;  3FUE A;  3U66 A;  2LCV A;  3CHM A;  2HO1 A;  3OXG A;  3PE3 A;  2VYI A;  3UFD A;  1JFT A;  3GN5 B;  3KAE A;  4NRH B;  2UY1 B;  4UI9 C;  5BT1 A;  1WY6 A;  1POU A;  3OXF A;  4ILG A;  5E75 A;  4ATG A;  3CKB A;  2WXM A;  4MS6 A;  4OVV A;  4E85 A;  2CHX A;  5JHA A;  2HM8 A;  1WH8 A;  1INZ A;  2LYQ A;  3CEC A;  3CQG B;  2IV1 A;  1KT0 A;  3HZI B;  4JHJ A;  3ZHM A;  4L1B A;  3LJ3 A;  3NZS A;  2L0I A;  3IBE A;  4EPZ A;  5JJT A;  2XPY A;  1HF8 A;  1HG2 A;  3CK8 A;  4O6F A;  3ASG A;  3CSF A;  4BX9 A;  3SCG A;  2YIN A;  2O49 A;  4HOU A;  4YVO A;  4GQM A;  3GW4 A;  3MKQ B;  4MCT A;  2GZU A;  1OUV A;  4GZ3 A;  4CGW A;  2J49 A;  4I6U A;  1E8X A;  3LDZ A;  3B7R L;  3FMY A;  4OB4 A;  4UWF A;  4JZY A;  1NZN A;  4RVB A;  4XI9 A;  2VSX E;  2Y3A A;  1IQU A;  4MRU A;  4NQ0 A;  3I5P A;  1X57 A;  1Z3X A;  3GYZ A;  4FUL A;  3OAW A;  4RSY A;  4BY6 A;  3O9X A;  4IWR A;  1H2T C;  2KEK A;  4WWP A;  3ASD A;  5FQ4 A;  2Y4T A;  3FUJ A;  4UWK A;  4I6G A;  1RPE L;  3UMV A;  5CCM A;  3FTU A;  2ILR A;  3TG4 A;  4N2S A;  2BF0 X;  4FC8 A;  3QWW A;  2DCP A;  1LCC A;  3CRO L;  4BTB A;  4GU5 A;  1DVP A;  2QY7 A;  2HIN A;  4FP7 A;  3VTX A;  2WUS R;  2V8S E;  2VSY A;  1RZR D;  2HYZ A;  4HLE A;  3RKV A;  3CHQ A;  4XI0 A;  5G04 C;  4ANU A;  3FYM A;  2IVQ A;  2L9B A;  3OQN A;  4GZD A;  3JXB C;  2PUB A;  3ZYQ A;  3CHO A;  3D9J A;  5EX0 A;  4L7T A;  4U04 A;  5BW8 C;  4F8D A;  2R59 A;  4XE0 A;  3S7D A;  4WAF A;  2CRO A;  3PXP A;  3HYM B;  3P2B A;  3BS3 A;  2XSD C;  1MHQ A;  2GGF A;  3SBS A;  2PUE A;  1BPO A;  4IYP A;  3SZ7 A;  3L13 A;  1H19 A;  3ZVV A;  1TJC A;  4I6R A;  4I1M A;  4A55 A;  5K98 B;  2V4L A;  3FWV A;  1HO8 A;  1E90 A;  3G2V A;  2KEJ A;  2NC9 A;  3SCF A;  2J07 A;  5EKQ D;  3I4R B;  3RRN B;  4QFV A;  5JHB A;  5LCW C;  4Q69 A;  3JXC L;  4GML A;  3ZEF A;  5BNW A;  3L54 A;  2XIU A;  3O48 A;  4IN3 B;  4J0U A;  5T3R A;  3GBF A;  4FU3 A;  1E8Y A;  3UQ3 A;  4B8A A;  2PIJ A;  2KEI A;  3CST A;  3L08 A;  1PC2 A;  3QK0 A;  3U64 A;  3T5V A;  3FU3 A;  4ME2 A;  2PE5 A;  3D9I A;  3MA5 A;  4GYO A;  1ELK A;  4PU7 A;  1H0A A;  1E3O C;  2KZ8 A;  2AWI A;  1L5J A;  4N5C A;  5ENN A;  1HU3 A;  4Z5C A;  2BJC A;  1JWG A;  2GW1 A;  3FU5 A;  1NA3 A;  3LXU X;  5C2Y A;  5KJL A;  3IKO B;  5AYW D;  2PUF A;  1OSL A;  4PU4 C;  4W9R A;  4CEM A;  2DBA A;  5FZR A;  2UWJ G;  3OXL A;  4WWN A;  3PRE A;  2AXV A;  4DI3 A;  3JQ1 A;  4H7Y A;  1EYH A;  1U3D A;  2FO7 A;  3CK7 A;  1ZPQ A;  1E96 B;  3PUJ A;  4JHR A;  4YND A;  3UT8 A;  2WMN A;  2WXP A;  1CQT A;  4NUR A;  3AS5 A;  1GT0 C;  5BPP A;  3ESL A;  4YVQ C;  3IEG A;  4GA0 A;  1R69 A;  2JLB A;  4DJA A;  4MLP A;  2X6J A;  4YG7 B;  4WUY A;  1WH6 A;  2VGX A;  3ZHE A;  4JA9 A;  5BV1 A;  1BDI A;  3HDX A;  2KCV A;  2XQ0 A;  3QOU A;  2IQC A;  2L0T B;  3LKU A;  4IVZ A;  4N39 A;  2IVB A;  5ARG A;  3GN5 A;  3AS8 A;  4K0R A;  2P58 C;  4G11 A;  4EZK A;  1H6K A;  1DWK A;  3QAR A;  4UWG A;  4FN3 A;  4J8D A;  2FI7 A;  3K9I A;  2XCB A;  3FY4 A;  3U4T A;  2IU7 A;  2IF4 A;  1HFA A;  2IU1 A;  3MEK A;  4ANX A;  1YA0 A;  4PS8 A;  3LVR E;  3TG5 A;  1NP7 A;  4L2Y A;  4CDN A;  3B7H A;  5ANL A;  4URK A;  3EHM A;  4JCX A;  4FA6 A;  3KEZ A;  1Z3Y A;  4LCT A;  2EBY A;  2XI8 A;  5KJK A;  4X4E A;  4Y42 A;  1VDY A;  1LMB 3;  5FQ8 A;  2C0L A;  3MKQ A;  4U0U A;  3PNL B;  1ZZ9 A;  2WIU B;  4GAA A;  3LIS A;  5CHE E;  3LS8 A;  4U07 A;  4H7X A;  4Y6C A;  3S7F A;  2VGX B;  3ZHE B;  3MV3 B;  2R1J L;  3CLJ A;  3FUH A;  2OFY A;  5DBK A;  3BDN A;  3ULQ A;  1QQB A;  3QWV A;  4CDR A;  5KCM A;  4G23 A;  3RO2 A;  2PM6 A;  3SBT B;  2VTB B;  4J1W A;  2MHK A;  4CCA A;  3FUK A;  4X4F A;  4AEZ C;  4G25 A;  3GZ2 A;  2CFU A;  3D9M A;  3GZ1 A;  1E8Z A;  1WAO 1;  3GZS A;  5KJM A;  2LYR A;  2L49 A;  3AU5 A;  2WQ7 A;  4AY6 A;  3B7T A;  4KBQ A;  3QYX A;  4F53 A;  2OR1 L;  5D0O D;  4HVB A;  4JEH A;  2BNN A;  4KT6 B;  1XNF A;  3CHP A;  2RG8 A;  4K03 A;  5FTP A;  2WXJ A;  1JH9 A;  4Q96 A;  3L6A A;  2VGY A;  3NF1 A;  2MEZ A;  4I8T A;  2YNQ A;  3L17 A;  4JW1 A;  5HQ8 A;  3IVP A;  1ZS4 A;  2KCK A;  3FUL A;  3ONL A;  4GCN A;  5FQ6 A;  3SNX A;  3T8M A;  3CR3 A;  3FUM A;  4I6E A;  2JEK A;  2J08 A;  1IHG A;  1X2L A;  3FTV A;  1WET A;  1TEZ A;  2X6H A;  1PNR A;  3B13 A;  3D9N A;  3ZGQ A;  4A3V A;  2XRZ A;  4KMO A;  3EUS A;  2WXF A;  3SF4 A;  4DLO A;  3CVL A;  4J8S A;  4BWR A;  3ML9 A;  3RRM B;  2LNI A;  3ZYM A;  4N3B A;  4FJZ A;  4E6H A;  3CVY A;  4GA2 A;  1ZUG A;  2X6K A;  5FZS A;  4AJW A;  5E76 A;  2V0P A;  3TL5 A;  5LFA A;  3LEW A;  1HS6 A;  2RD0 A;  4PDX A;  5CMY A;  3PH0 C;  4AM9 A;  4D10 C;  4EBA G;  3CGH A;  3FDH A;  1SQ8 A;  3G2W A;  2HR2 A;  4GCO A;  3ZXS A;  3HIZ A;  3SGH A;  4F3V A;  5KJN A;  2XEV A;  2ICP A;  1UXC A;  3FEY A;  1B0N A;  1H2V C;  3APC A;  1OCT C;  2I9C A;  2PQR A;  3CK9 A;  3Q47 B;  3QJZ A;  2OVF A;  4WND A;  3F6W A;  4AIF A;  1UG3 A;  4APO A;  2WXI A;  3QAQ A;  4GYY A;  1PRA A;  2WXN A;  3QWP A;  3R7R A;  3ZIM A;  4BX8 A;  3MJW A;  3LY9 A;  3FTW A;  1PAQ A;  4CDM A;  4EEC A;  2ION A;  3UT4 A;  2LYL A;  4HFG A;  4A1G A;  5T4Y A;  4UQX A;  5G05 J;  5FT9 A;  4EZJ A;  2AXU A;  3OMT A;  3D9K A;  3JQ0 A;  3KD7 A;  4AP2 A;  3MLF A;  4HS2 A;  3CVV A;  1QP0 A;  2CFZ A;  2R5S A;  1FVF A;  2CG3 A;  2A4Z A;  4I6T A;  3QB2 A;  4JPS A;  4NAC A;  4ACL A;  3ZN3 A;  1Y9Q A;  3G7D A;  2WXO A;  3ASF A;  3HHM A;  4I9E A;  3FU6 A;  4PUC A;  3EIQ C;  1P5Q A;  3KJX A;  3G2U A;  3QNK A;  4B94 A;  2J9Q A;  2L6J A;  4Z5D A;  4CT4 A;  2BNO A;  3MCX A;  4WNG A;  1ZZ8 A;  1UJK A;  1WIZ A;  1UN8 A;  3CQC B;  4I2Z A;  3TGO A;  3L16 A;  3VTY A;  4UWL A;  4HOS A;  2AVP A;  1ZBP A;  4I9C A;  4PU8 A;  3FUD A;  1Y7Y A;  3RU0 A;  1JWF A;  1N52 A;  4YBA A;  4A3T A;  1ZZ7 A;  2LAI A;  2C0M A;  3LY8 A;  4AXH A;  4HOT A;  4JHK A;  3R7Q A;  1SQM A;  1XGW A;  1ADR A;  4BFR A;  1S0P A;  3C98 A;  3EJN A;  3MZL B;  1HF0 A;  5A6C A;  4LRZ A;  2WM9 A;  4AOF A;  2PUD A;  3B7U X;  2YHE A;  2AXZ A;  1ELR A;  3S2A A;  3S8Q A;  2EF8 A;  3Q5M A;  1QNF A;  3MV2 B;  1IYG A;  3D9P A;  2J4D A;  3D3M A;  4B89 A;  3CV0 A;  1CJG A;  3APD A;  4GMJ A;  4XX5 A;  4XZ4 A;  5ANR A;  2VSN A;  1KT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...