2GRMA

Crystal structure of prgx/icf10 complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
315
structure length
315
Chain Sequence
b'MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGCYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVAIENNPIPEIKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PrgX
publication title Molecular basis for control of conjugation by bacterial pheromone and inhibitor peptides.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
total genus 121
structure length 315
sequence length 315
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2grmA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2grmA02
4OB4A 3HZIB 1RZSA 3VK0A 4F8DA 4MCTA 1ADRA 1WIZA 1LQCA 3BD1A 4J1XA 2GZUA 1QP0A 2LYQA 2PUDA 4X4EA 3O9XA 1ZAYA 2WIUB 3CECA 3MLFA 1OSLA 2PIJA 4X4IA 1CQTA 4MCXA 3SCGA 3SCHA 4Z59A 4Z5DA 2CROA 1RZRA 2OR1L 2FJRA 3U3WA 3CLCA 2WUSR 1Y7YA 1NEQA 4GQMA 4IVZA 1X2LA 4X4BA 2AUWA 2PUCA 2LYPA 1GT0C 1LMB3 2O49A 2AWIA 1S7EA 2EWTA 1PRAA 3IVPA 2L49A 3QWGA 3ZKCA 1ZZ6A 1B0NA 2BNNA 4X4HA 1JFTA 3OQMA 2A6CA 2KEJA 1UTXA 2IUOA 2L8NA 3ZHIA 2IV1A 1RIOA 4JCYA 1R69A 1ZZBA 2PPXA 3KXAA 3G5GA 2AXUA 4PU8A 4Z58A 4YG7B 1OCTC 3SCFA 4PU3C 2OFYA 1SQ8A 3B7HA 2LYRA 2IU7A 3JXDL 4I6UA 3LFPA 4I6RA 3OP9A 2BJCA 4Z5HA 3D1NI 2PE5A 1LLIA 1UXDA 1ZUGA 2EBYA 2O38A 1WETA 1QQAA 4NDWA 4PU7A 1R63A 1HF0A 4JCXA 2XIUA 3R1FA 3FYAA 3ZHMA 1ZZ8A 3EUSA 1L1MA 3GN5A 2XCJA 4X4FA 1LCCA 3GBFA 3GN5B 4FBIA 2IVQA 3JXBC 2R63A 1YSEA 1QP7A 2KEIA 1WH8A 2HSGA 2PUFA 2KPJA 3JXCL 1DW9A 1ZZ7A 2LCVA 5K98B 1E3OC 4JQDA 3RZZA 1NERA 3PXPA 2MEZA 4Z5CA 5A7LA 3DNVB 1EFAA 4IA8A 2MQKA 1UXCA 1X57A 2B5AA 1JWLA 4I8TA 4FN3A 2ICTA 1RZRD 1QP4A 3F6WA 2IVBA 2BNOA 2HINA 2GRMA 3OMTA 3F52A 3QYXA 1ZPQA 1PERL 2EF8A 3BDNA 2LYSA 3UFDA 4YG1A 1DWKA 2LYJA 3H5TA 1BDHA 3OQOA 2PUGA 4YARA 3F51A 2AW6A 2PUAA 4YG4A 3FMYA 2XI8A 4GHJA 1XWRA 2D5VA 3KJXA 4J1WA 3OQNA 1QQBA 3CROL 2JVLA 4X4DA 2KZ8A 3TRBA 4I6TA 4X4GA 2XSDC 3LISA 2R1JL 1AU7A 1PNRA 1WH6A 1PRUA 2AXVA 2BNMA 1ZZ9A 2XJ3A 3KZ3A 3S8QA 3QF3A 2LYKA 1QPZA 4X4CA 1JFSA 1LCDA 1ZVVA 2KEKA 2IVGA 2CSFA 3FYMA 1JH9A 2PUBA 2PUEA 2ICPA 1PRVA 2H8RA 4O8BA 1RPEL 3QQ6A 1POUA 2O4AA 1CJGA 2GRLA 4Y42A 4PU4C 1BDIA 1Y9QA 1O4XA 1VPWA 3L1PA 4IWRA 2LYLA 4YBAA 3BS3A 1IC8A 2AXZA 1ZZCA 1ZS4A 3G7DA 2JCGA
chains in the Genus database with same CATH superfamily
2HYZA 1HQ1A 3ZHEB 3RIBA 4J1XA 2KCVA 4CDMA 2PXVA 3G2SA 3QOXA 4KVOA 4MCXA 1EF1C 4Q69A 3CVPA 1BPOA 1N0QA 4LUNU 2V0PA 3TWVA 3FU5A 2JEKA 3DBSA 4GU5A 4CZ2D 1B0NA 5JHBA 3HRAA 4Y6CA 3APFA 2KATA 4CGWA 4E6HA 4EECA 2IV1A 2WMOA 4PU8A 3W9GA 3LCAA 5IY5E 3UKUG 4G26A 4EQZA 2PXLA 4GTQA 4UQZA 2M4HA 4FJZA 3KEZA 3FP3A 2CG2A 2H6HA 2L6JA 2LSVA 3GN5B 3JXBC 4F1PA 3RAUA 3R9MA 4DX7D 4GYYA 4PH4B 4OBMA 2KCKA 4RG9A 1K1BA 1E90A 2XCCA 3SFZA 3IKOB 4ILIA 1RZRD 5FZQA 3QNKA 4B89A 2R59A 2PM6A 4YARA 1OWPA 3HVEB 4JA7A 5BNWA 4U0ZA 1OCCE 2MXDA 2XRZA 1HFAA 3B95A 4AOFA 1JH9A 3FYMA 4L2YA 2LAHA 5KNGA 3AJIA 3E4BA 4G25A 4A3TA 3B7TA 2M63A 4W9RA 3TWSA 5A23A 4HOSA 3UT8A 3EIJA 4F8DA 3CHQA 4I6EA 3DPYA 3QDNA 3ZPXA 4GZCA 4B93B 5HQ8A 1OCZE 2WPVA 3V31A 4EHMA 4Q2JA 3L16A 5CBNA 3EJNA 3FTYA 1S70B 3NQPA 1HXIA 4DX1A 1L5JA 3FH8A 2A6CA 2FI7A 3ML9A 1LF8A 2XQ0A 2PQRA 2V5QC 3OP9A 4IYPA 1UXDA 3MX3A 5ANLA 5CCMA 3LXUX 2XPZA 4PU7A 4GTMA 1Y6IA 2YINA 4N3BA 2VSOE 4JPSA 3GBFA 3FUEA 2DZNA 4BX8A 3T8MA 3DSWA 3D9MA 2P9LG 3RZZA 3A9XA 3LEWA 1FT1A 2OEVA 2LO6A 3PEUB 4C0MA 1U2ZA 4GZ6A 4RQIA 3SO8A 5LX8A 1PERL 3RK6A 3JCKC 3IEGA 1HS6A 2CHXA 4OAVB 2PUGA 5ARFA 1NZNA 3PE4A 4XKBA 4HFGA 4BTAA 1LTXA 2I1JA 4OAUC 4G8KA 2R17C 3L17A 2LNIA 1VPWA 3HDXA 3JQ0A 3MV3B 1IC8A 3CVYA 5E75A 2XGSA 3ZNGA 2VGXA 2E2EA 3HIZA 2CFZA 2J7WA 2FJRA 4X4BA 4JB8P 2WQ6A 2VTBA 3KS2A 4JHJA 4APFA 2I6HA 4WNFA 4F53A 2BNNA 4X4HA 3OQMA 3S7FA 3CSFA 1OY3D 1UTXA 1O1SA 3NF1A 5BV0A 2VEOA 4YDYA 1HG2A 3CVWA 4LEUA 3MKQB 1O1RA 2V5FA 5EN5D 3L54A 5FQ7A 5J90A 3AS8A 2VGXB 2P58C 5AAOA 1N4RA 4GZ3A 4JCXA 4M7CA 5H7PA 1DULA 5C2YA 4X4FA 4YDOA 4HLLA 5KJLA 2XRYA 4O60A 5FJYA 5CMYA 2DZOA 3SQVA 2NXPA 1EPUA 5BXUA 1X57A 4FN3A 2DCPA 3V2OA 2LUHA 3F52A 2Q7FA 2I1KA 3N71A 4JHKA 3ASGA 2L9BA 3FH5A 5DIZA 2Y69E 1OXJA 2D5VA 1IKND 4K5BA 4BTBA 3MEKA 5EDSA 1FVFA 1NI1A 2KEKA 4Y6WA 1X5BA 5HI7A 4ER7A 4ACLA 4X8QA 3C3OA 3UKRG 4JD2G 2E0IA 3NAWA 3MGBA 1N11A 2AXZA 4HBDA 4FP7A 3UI2A 1X81A 5FQ8A 3BD1A 2L0IA 2P9NG 1OSLA 1JPLA 3R7RA 5AQAA 4PS7A 4JL0A 3MCXA 2FULA 3EHMA 3B13A 5AN8A 1UN8A 3T8KA 4ATGA 2OVFA 1OCRE 4EKGA 2HCNA 2B0OE 1TNZA 3ZYMA 3CSTA 2PXQA 2QFCA 3ML8A 2GRNB 2LLWA 3TEPA 5AQ7A 2XXPA 1XNFA 4NQ0A 4YDEA 4BY6A 2EBYA 3APCA 2VSYA 1HF0A 3CVNA 4BSZB 3NROA 2DYRE 4N39A 5KJMA 1DCQA 3Q73A 4U7EB 4CYMD 4K5AB 2IQCA 4U8YD 2XZDG 4U96D 4Z5CA 4IA8A 1O5MA 3RRMB 3UQ3A 4I8TA 3PZ1A 4GAAA 3BEEA 1N4QA 2IVBA 3CHSA 4JHRA 2EQXA 5FINA 3VWSA 3BDNA 2JLBA 4NACA 3BU8A 4I43A 1W3BA 3FUKA 3HYMB 2PM7A 3BQOA 3ZXPA 3LISA 5EKQD 4C0EA 3FEXA 1Z6TA 3C3RA 1KT0A 1QYMA 1POUA 3NOCD 3L82A 4L1BA 3UINC 3L1PA 4JVSA 3G2TA 3FU0A 2GRQB 2XEHA 1MZCA 1RZSA 4WWPA 4HOUA 3E34A 4GTSA 4CDRA 1ZAYA 3NXHA 2R02A 3HXEA 2V3CC 3QC1A 3URZA 2XEEA 2WUSR 5JJ6A 3JQ1A 3ZXSA 5CCLA 2WXRA 4FC8A 3NOGD 3ZKCA 4EZKA 3PS6A 3PH0C 2I2OA 4BERA 1N9AA 2YBDA 3ISMC 4HRAA 3PZ3A 1RW2A 3G2UA 3CKCA 3DWLG 2IU7A 4UWHA 4G2VA 4I6RA 4BETA 4DI3A 1KZPA 2PXUA 4U0UA 4U04A 3ZIMA 3E37A 1KPSB 1QQAA 4JA9A 3DSVA 1ZZ8A 2PXPA 2J07A 3ZYQA 4JQDA 1H2UA 5A6CA 3PZDA 4YDWA 5CMWA 4MS6A 4U95D 3F6WA 5CHEE 5CRVA 3ZGQA 2XXQA 3UTMA 3HHMA 5CEDB 3UFDA 2J4DA 5KJKA 2UWJG 5DTMA 1MX4A 4I2ZA 4CT0A 1NFIE 4RLYA 2QY7A 3SI5A 1WY6A 2JVLA 1KZOA 4KBQA 2XSDC 3T5VA 3CHPA 4NRHB 1ZZ9A 2XJ3A 3QF3A 3LS8A 2CSFA 3R9AB 4AV7A 4O8BA 4H7YA 2V4LA 3S2AA 1CJGA 2PXFA 4GCNA 2LNMA 1O4XA 1JCSA 2BF0X 3NZSA 3ZN3A 3CKBA 2HM8A 3ZHEA 3ME5A 1UOHA 2LAIA 2RKKA 3ZYKA 1MX2A 3CIAA 3PDNA 4X4EA 4N2SA 3CECA 4B0ZA 3PE3A 1CQTA 1LD8A 2VQ2A 4GMJA 2VJ8A 2IF4A 2PPXA 1D8EA 4UI9K 3B7SA 1TNUA 1SA5A 3Q47B 4NURA 4I6UA 3RO2A 2KC7A 3I3NA 3FULA 4LG6A 1TN6A 4ACKA 1TN7A 2X6KA 3EHQA 3G2WA 4XZ4A 4EK9A 3L08A 1SZAA 3LDZA 3EDTB 3GN5A 4ER5A 1LCCA 1S63A 1HH8A 3Q9UC 4TV3A 3FFLA 1WH8A 3SD5A 1NA3A 3RU0A 5A7LA 4LSZE 3S7BA 2HINA 2WXOA 2WXGA 2EIJE 4YNDA 2ETAA 3LVQE 4N5CA 2PXKA 1N52A 4CGVA 4AVXA 3HVEA 4FHKA 4HI8A 1INZA 2WXIA 2LXLA 1PNRA 4JC8A 4N2QA 3TELA 3RRNB 3V79K 2IOSA 2WXHA 3MYVA 5AJLA 3NZLA 2B6CA 3ULQA 4G8LA 1BDIA 4FULA 3CV0A 4LNGA 5CECB 4OB4A 1PAQA 2J9QA 5G05J 1WIZA 1K8KG 2MHKA 1LQCA 1IHGA 3O9XA 3V2XA 1BI8B 1UG3A 5LFAA 4Z5DA 3E32A 4L7TA 1E7UA 4BWRA 2IO3C 4EBAA 4HOTA 3CK7A 4GA2A 2HFZA 1S7EA 3EHNA 4ATZD 1BU9A 5T8IA 1S0PA 2FF4A 4HI9A 3G5GA 1N0RA 1OCTC 3O4ZA 1U3CA 5C1DA 5EILA 3B7HA 2QZAA 4I9CA 3CVUA 5AARA 4HRMB 1MJ0A 4ME2A 1JWFA 5G55A 3EU9A 1ZUGA 4FJYA 2XS1A 4K0RA 3ZU7B 2DYSE 2WQHA 1ELWA 2R63A 4WWNA 4OVVA 4H7XA 3EU5A 3LPZA 4TUMA 2ETBA 2HCSA 4FADA 3SFXA 4HOQA 4JXTA 2P9UG 1RZ4A 4J6IA 4TRQA 5JHAA 3OTNA 3Q49B 2Y3AA 1TNOA 4J0UA 2J7UA 1BDHA 1HG5A 3KEAA 4I6GA 3OXGA 3D9LA 3ESLA 3D9IA 3OQNA 3KZ3A 1BLXB 1HE8A 1TNYA 1FPPA 1E8YA 1LCDA 1ZB1A 2KZTA 3Q78A 4AJWA 4GYWA 4GTVA 2XHEA 4Y42A 3TGOA 4A1GA 2ETCA 3NB2A 3UIPC 4URKA 4IWRA 2OCCE 4F3VA 3EUVA 1ZS4A 5JMND 2XCBA 3OXFA 3BG0B 2OR1L 5JJTA 1Y7YA 2IJGX 2KZTB 4TXRA 2AUWA 4A55A 1QB2A 1ZZ6A 1XGWA 4KYOB 1UN9A 4L9PA 1U3DA 2KCLA 4IN3B 4GA0A 4YG7B 2A5UA 2XENA 3MKQA 3PZ2A 3TG5A 3SF4A 3CVLA 1HO8A 4JEHA 1PY1A 4CCAA 3D1NI 5FWQA 1EYHA 1Y8MA 2J4BA 3J5QB 3Q9NC 1DC2A 3R1FA 3FYAA 3AG1E 3JXIA 2WXKA 2KEIA 3C72A 2MEZA 5CEAA 2EIKE 1H19A 4EZIA 4P29A 2R05A 4HS2A 2GRMA 2NSZA 2HE0A 1ZU2A 2CHWA 2IO2C 3DXMG 4NIKA 3OQOA 5ENSD 2XEVA 3PUJA 4MRUA 2HR2A 2GROB 2FBNA 4I6TA 3QWPA 2BEDA 3G2VA 1WH6A 2JABA 1JCQA 4AXHA 1IQUA 3HXDA 3PVLA 4X4CA 3TWTA 2BTDA 3SY2A 3KD7A 2XPIA 4F7AA 4N5QA 3LY7A 3MJWA 4LRZA 4O1PA 1A5EA 3VLDA 5ENPD 3FTUA 4UWFA 3D9JA 3CVVA 1S64A 3CR3A 4ZHBA 4J8EA 2VYIA 4ER6A 3DSXA 4PS3A 1ADRA 3DSTA 5ENQD 1QP0A 5ENNA 2J8SD 2WIUB 1RZRA 1OWNA 1N54A 3CLCA 3U3WA 4D10C 5T3RA 2OEWA 4XX5A 3D9NA 4CDNA 3E30A 1Z5SC 3ASDA 1R69A 3KXAA 3IV0A 2ZU6B 1JUQA 2WXLA 4Z58A 3C3QA 4PU3C 4FHJA 3K9IA 5T4YA 4GMLA 4Q94A 1K1AA 2BJCA 4G1TA 3LFPA 3VTYA 1SA4A 3BG1B 5BT1A 4GB9A 4YVOA 3HXFA 4ER0A 2J09A 3FHEA 1N94A 1P5QA 1L1MA 2MRIA 2F8XK 2XGOA 3FU3A 3B7RL 1YSEA 4GTPA 2L1PA 2AJAA 1DW9A 2AVPA 5J08A 3I4GA 3TWUA 2LSUA 4GZ5A 4DI4A 1JWLA 1AP7A 2QYJA 2EILE 4WNDA 4BSXA 2J49A 5JA4D 3AU4A 2LYSA 3UM2A 3H5TA 3FDHA 2PXDA 2XI8A 3PZ4A 4GHJA 5FIOA 1XWRA 3AS5A 4B8CB 2KZ8A 3UM0A 5HRYA 1HZ4A 1PC2A 2FO7A 4G23A 2PUBA 3GW4A 2ICPA 5AJDA 4DK5A 4I2WA 3LKUA 1H6PA 4E85A 2PZIA 3TXNA 1KLXA 3LY8A 3U9WA 3ZFWA 3ONKA 3MLFA 5BW8C 3GZDC 3SGHA 3SCHA 2PUCA 2LYPA 3L13A 3QWGA 5BXOA 4DRXE 4U07A 1ELKA 4PUCA 3ZHIA 5KJNA 3FTZA 4UUCA 3LY9A 1OWLA 5CBOA 3PREA 3FUIA 3ABKE 1G3NB 2WXFA 2F37A 4DPRA 3QWWA 3G0TA 4UI9J 3VTXA 2NC9A 4NDWA 1R63A 1JCRA 4HQDA 4WAFA 2WQ7A 4WWOA 1LD7A 2IVQA 2WB2A 2F8YA 1TR4A 1TNBA 3JUEA 3DPDA 2KPJA 3UX4A 1UJKA 3CQGB 5K98B 3CVXA 2ZXWE 3IBEA 4HVBA 4LNBA 5HKPA 2ICTA 4UQXA 3R7QA 1QP4A 1H6KA 2IEJA 4DX2A 3DSUA 4M3OA 4UQYA 2IFUA 3FUJA 3QB2A 4DUIA 4ANXA 4HLEA 2AW6A 3QFIA 3M9LA 2VGYA 2YQ8A 3CLJA 3UT4A 4FLBA 2R1JL 1AU7A 2V4HC 4APOA 1OCOE 3OXLA 1GW6A 2LYKA 2WXPA 4KZ0A 1ZBPA 3X2QE 2IVGA 4GTRA 2PUEA 2GGFA 1PRVA 4EKIA 1BD8A 2R03A 4RSYA 4RVBA 3ONLA 2GRLA 3JYSA 4PU4C 4AIFA 4JZYA 1KT1A 3SBTB 3ULYA 3Q5MA 4UWLA 3GZDA 3OWQA 3Q4AB 1HU3A 5DT2A 3VK0A 4HRNA 3EHRA 3KL4A 3D9OA 2PUDA 4J8DA 3D9HA 3D3MA 4Z68A 5KNHD 4ZFHA 5GAGi 4IVZA 2KXPC 1GT0C 3I4RB 3AG2E 3W9FA 4JEUA 2L49A 3GUUA 3PEVB 1HF8A 4I17A 4ANVA 4U8VD 1D9SA 4KMOA 2R2LA 3QARA 2AXUA 1NA0A 4KZCA 4GTOA 2OFYA 4MKTA 2VGEA 4O6FA 1B89A 3CGHA 2FO1E 2KM4A 4Q96A 1Z3YA 2GRRB 3R09A 1D8DA 3ZHMA 3IHYA 2IU1A 3C5RA 3U64A 2L0TB 2PQNA 2HO1A 3JXCL 3FUNA 5FT9A 4I1OB 2V8SE 3B7BA 5DRTA 3PXPA 1A17A 3I5PA 1H6OA 1V54E 2RD0A 2BNOA 3L22A 2MYOA 3SBSA 2LXMA 5DBKA 4PDXA 2NYJA 1IQRA 3GYZA 4F6RD 4ABNA 4EQFA 2CFUA 3FWVA 4ER3A 3F51A 4YG4A 2LLVA 4N3CA 4J1WA 2P9KG 4X4DA 5G04J 3TXMA 5FTPA 3KAEA 5FZSA 3WG7E 3BUAA 2RFMA 1E8XA 3UPVA 3DM5A 2P9IG 2O4AA 2J08A 3SR4A 4EBAG 3AG3E 3DEPA 5ENRD 4I9EA 4WUYA 3TFLA 5AENA 5ARGA 2DWZA 4XE0A 3APDA 1WG0A 5B1BE 4BT8A 4DX6D 4UI9C 3E33A 2Y4UA 2CROA 2X38A 1LMB3 4YVQC 3ABME 3NDBB 1PRAA 4UWKA 5EX3A 1H0AA 1H2VC 4F1SA 1RIOA 4JCYA 2WXMA 5G2NA 2H6FA 3LJNA 4MLPA 3C98A 3OAWA 4XKCA 2XXAA 5EIDA 4Z5HA 1AWCB 4AEZC 2C0MA 5CERB 3Q7FA 5D0QD 2YHEA 3VLEA 4DX5D 3FTWA 3KSQA 1FCHA 3CK8A 4U63A 1WDYA 4DLQA 4FBIA 2XPYA 3FY4A 4KVMA 4JW1A 4C48B 4CEMA 5EIBE 1EFAA 3QAQA 4J8FA 2X3MA 4V3IA 3QJZA 1UJJA 4WVLA 4FA6A 3OMTA 3CK9A 3MZLB 3CQCB 1DNPA 1VDYA 3TWXA 2ODRD 4GTTA 1QQEA 4J8YA 1MYOA 3ESKA 3FH7A 4I1AA 5FZRA 1NW3A 5LOZA 2AXVA 1PRUA 2BNMA 1ZVVA 1N95A 2OOEA 3U66A 5E76A 5DRYA 2FEZA 3UT7A 3RSEG 4QQIA 1RPEL 2R5SA 2PXEA 3GZSA 4GZDA 4OYSA 3LQXA 3RJVA 3UXGA 4HNAD 3CHMA 1U2VG 2C0LA 2FFHA 5M72A 1E8WA 4FU3A 4X4IA 4WNEA 3ZUVB 2XS8A 3P1UA 4GQMA 1JWGA 1X2LA 3J5PA 4GPKA 3SFYA 1FVHA 4LERA 2AWIA 1SQMA 1N4SA 4GYOA 3L6AA 5AIJA 5D0OD 1BI7B 3FEYA 3FUHA 3GZCA 2PXTA 4BX9A 2CHZA 2P9SG 2EIME 2GW1A 3ZRHA 4GA1A 5LCWJ 3LJ3A 2LYRA 2X6JA 2CG3A 3UIOC 3FU6A 2O38A 3QWVA 4LCTA 2XIUA 3EUSA 5G04C 2WXQA 2DVWA 3S7DA 1IHBA 3PNLB 4PS8A 3HG0D 3ENEA 1E3OC 5AQBA 4N3AA 1K3ZD 4UWGA 4XI9A 3CEQA 3V30A 2KBXA 2UY1A 2OVBA 3ZPJA 4A63B 3ULEG 4J8SA 1YCSB 2PL2A 3S7JA 3CHOA 2PUAA 4GCOA 3Q79A 3KJXA 1QQBA 4LNUD 3TL5A 3ZKJA 4G11A 5JUWA 2ILRA 3FUFA 5JJ7A 3UMVA 2YHCA 3QQ6A 4ILGA 2UY1B 4OVUA 2DIWA 3MKRA 3TWWA 4EZLA 5DTRA 5G05C 1QZ2A 1Q2ZA 1OT8A 1TEZA 5ENTD 3D9KA 2MOWA 5KWDA 5B3SE 3DXKG 5EX0A 2PIJA 1MX6A 3SCGA 4Z59A 1DCEA 3ASOE 2VTBB 2WXNA 3ZEFA 3WXXA 3QK0A 2KEJA 2H6GA 4O1OA 5KCMA 2DBAA 4I1MA 2OV8A 4GMRA 5HS0A 5D2MC 2IY0C 1E8ZA 3FTXA 5CRUA 5FQ6A 4XI0A 5BV1A 4U8HA 1IXVA 2X6IA 1QBQA 1OWOA 3ZVVA 3QOUA 4K03A 4TXPA 2WXJA 2HSGA 3TAXA 1WM5A 1ZZ7A 3QOWA 4A3VA 3DNVB 1HX8A 2Y1LE 3AU5A 4AY5A 2B5AA 1OUVA 4HRLA 1OWMA 3FTVA 3ASNE 3LVRE 5EYLA 3AG4E 3FMYA 2ZISA 2ONDA 3T9KA 4TUUA 3TRBA 4X4GA 4J7WA 4G24A 2QYUA 4DE8A 5AYWD 4ANWA 4B94A 2F0YA 1EDUA 3VLFA 2IOLA 3UWPA 1QZXA 1Y9QA 4EZJA 2ZIRA 1ZZCA 5AQ9A 5LCWC 2C2LA 2RG8A 3OKZA 2LYQA 2BKKB 3PUKA 1YA0A 4KXKB 4XEIG 1NL4A 5FQ4A 3MEJA 2BKGA 2L6BA 2X6HA 3Q15A 4TXQA 3UM1A 3MV2B 1NEQA 4DE9A 2XZTG 1MQSA 2O49A 3RRUA 2EWTA 1TJFA 3AAAC 4ANUA 3ZW3A 4DJAA 5BPPA 2IUOA 5B1AE 3NBNB 1ZZBA 1TN8A 2H6IA 3SX0A 2BUGA 2VSNA 5LP0A 1SQ8A 3Q7AA 3JXDL 1H2TC 2IONA 2PE5A 4EPZA 1ELRA 2WM9A 1NP7A 1WETA 4AP2A 2P9PG 2XCJA 2VSXE 2A5EA 3NZUA 4WNGA 1QP7A 4B8AA 4BEPA 3B7UX 1QNFA 4L2LA 4AM9A 3GZ2A 2GRPB 4MBGA 3FUMA 4L23A 2P2CP 2MQKA 4AY6A 1UXCA 4KT6B 5A7DB 1IYGA 3JXJA 3AS4A 3HXCA 3FTSA 3P2BA 1YMPA 3CVQA 1ZPQA 3DSSA 4CT4A 1DWKA 3TWQA 3DEOA 3HXBA 2X6FA 2RFAA 1SVXA 3SHFA 5ITZF 4R7LA 4ILHB 3LYAA 3EIQC 4HORA 1JFSA 2WVIA 1FT2A 1MFQC 3TJPA 3SNXA 2H8RA 1Z3XA 1V55E 3U4TA 4CRWA 3Q75A 4IULA 2LYLA 3IHVA 3FUDA 2JQEA 3G7DA 2JCGA 2A4ZA 3HZIB 4HXIA 4MCTA 2GZUA 1WAO1 1E96B 3IXEA 1SW6A 3CHRA 3DRAA 4DLOA 1JFTA 3IVPA 4FLHA 1N4PA 3PE5A 4RG6A 3ASFA 4C9BB 4HB5A 2L8NA 3SCFA 4BT9A 2QC9A 5GAHi 1DVPA 1LLIA 4U0SA 2I9CA 1TJCA 5ANRA 3TG4A 1SZ9A 2EINE 3D9PA 2PUFA 2ZGGA 2LCVA 5DTQA 2Y4TA 3QKYA 1NERA 5ENOD 4BFRA 4I6JA 4BESA 2WMNA 5D66A 3A9ZA 3RO3A 3KSLA 1TYQG 3ASHA 3QYXA 1UW4B 2EF8A 3UUXA 2YNQA 4YG1A 5DSXA 2LYJA 3F6QA 3O48A 2XGMA 3GZ1A 4XIFA 2Y0BG 3A9YA 2PNNA 3L9TA 3MA5A 4QFVA 5BUZA 3CROL 4IRUA 3ABLE 1YYHA 3PRZA 3JUIA 3S8QA 1QPZA 2PXBA 5KBAA 3RKVA 1E7VA 1O1TA 3UM3A 3ZYLA 3SZ7A 3TWRA 4K5CA 1MHQA 4YBAA 3BS3A 3PNTB 3T5XA 5EYPF 2ZGDA 4GPMA 4A1SA
chains in the Genus database with same CATH topology
2HYZA 4PS3A 4WWPA 1RZSA 5M72A 3ZHEB 1ADRA 1E8WA 4HOUA 3RIBA 4FU3A 4J1XA 1QP0A 2KCVA 5ENNA 4CDRA 1ZAYA 2WQ7A 2WIUB 4CDMA 3QC1A 3G2SA 4KVOA 4X4IA 4WNEA 3URZA 4MCXA 1RZRA 1OWNA 1N54A 3CLCA 3P1UA 3U3WA 1EF1C 4Q69A 2WUSR 3CVPA 4GQMA 3JQ1A 1BPOA 1X2LA 1JWGA 5JJ6A 3ZXSA 5T3RA 4D10C 5CCLA 2WXRA 4FC8A 4LUNU 4GPKA 2V0PA 3FU5A 1FVHA 2JEKA 2AWIA 3DBSA 4LERA 4GU5A 3ZKCA 4EZKA 1B0NA 3PS6A 5JHBA 1SQMA 4XX5A 4GYOA 3L6AA 3D9NA 4Y6CA 3APFA 2KATA 3PH0C 2I2OA 4E6HA 4CGWA 4EECA 5AIJA 4CDNA 5D0OD 2IV1A 3ASDA 1R69A 2WMOA 3FEYA 3KXAA 3IV0A 2ZU6B 3FUHA 4PU8A 1JUQA 3LCAA 2WXLA 4Z58A 4BX9A 2CHZA 4PU3C 4FHJA 2GW1A 3K9IA 3ZRHA 3G2UA 5T4YA 4GA1A 5LCWJ 4G26A 3LJ3A 2LYRA 2X6JA 3CKCA 2IU7A 4GMLA 4Q94A 4UWHA 2BJCA 4G1TA 3LFPA 4I6RA 4G2VA 4DI3A 3VTYA 3BG1B 3CVUA 2CG3A 4U0UA 4UQZA 5BT1A 4GB9A 4U04A 3FU6A 4FJZA 3ZIMA 4YVOA 2O38A 3QWVA 1QQAA 2J09A 3FHEA 4LCTA 1P5QA 3KEZA 2XIUA 4JA9A 3FP3A 1ZZ8A 3EUSA 1L1MA 2MRIA 2XGOA 2CG2A 5G04C 2WXQA 3FU3A 2L6JA 2LSVA 3S7DA 2J07A 3GN5B 3B7RL 3ZYQA 3JXBC 3PNLB 4PS8A 1YSEA 4GYYA 1DW9A 3ENEA 4PH4B 2AVPA 2KCKA 3I4GA 1E3OC 1E90A 4JQDA 4RG9A 5J08A 1H2UA 2LSUA 2XCCA 5A6CA 3PZDA 4GZ5A 4N3AA 3SFZA 4XI9A 4UWGA 4DI4A 3CEQA 3IKOB 1JWLA 4ILIA 1RZRD 5CMWA 4MS6A 2UY1A 5FZQA 3F6WA 2OVBA 4WNDA 5CHEE 3ZGQA 3ZPJA 4BSXA 2J49A 3QNKA 4B89A 3AU4A 3HHMA 2LYSA 3UFDA 2J4DA 4J8SA 5KJKA 3H5TA 2R59A 2PL2A 2UWJG 2PM6A 3FDHA 3S7JA 4YARA 1OWPA 3CHOA 2PUAA 3HVEB 4GCOA 4JA7A 5BNWA 4I2ZA 2XI8A 4CT0A 4U0ZA 4GHJA 1XWRA 2QY7A 3KJXA 3AS5A 3SI5A 1QQBA 1WY6A 2JVLA 4B8CB 2KZ8A 4KBQA 3TL5A 2XSDC 1HZ4A 3T5VA 3CHPA 4NRHB 1ZZ9A 2XJ3A 1HFAA 2XRZA 3QF3A 4G11A 1PC2A 2FO7A 4G23A 4AOFA 3LS8A 1JH9A 2CSFA 3FYMA 2PUBA 2ILRA 3FUFA 3GW4A 4L2YA 5JJ7A 2ICPA 2LAHA 3R9AB 3UMVA 4AV7A 4O8BA 2YHCA 4H7YA 3QQ6A 2V4LA 4ILGA 5AJDA 1CJGA 3S2AA 2UY1B 3E4BA 4G25A 4I2WA 4OVUA 4DK5A 2DIWA 3MKRA 4EZLA 4GCNA 4A3TA 1O4XA 2M63A 3B7TA 3LKUA 4W9RA 5G05C 2BF0X 1QZ2A 3NZSA 4E85A 5A23A 3D9KA 1TEZA 2MOWA 3ZN3A 3CKBA 2HM8A 2PZIA 3ZHEA 4HOSA 3TXNA 1KLXA 3LY8A 3EIJA 4F8DA 3U9WA 3UT8A 3ZFWA 2LAIA 3CHQA 4I6EA 3ZYKA 3ONKA 3CIAA 3PDNA 4X4EA 4N2SA 3QDNA 3CECA 4B0ZA 3MLFA 5BW8C 3PE3A 5EX0A 3SGHA 2PIJA 1CQTA 4GZCA 5HQ8A 3SCHA 3SCGA 4Z59A 2WPVA 2PUCA 2VQ2A 3L16A 4GMJA 2LYPA 3EJNA 2VTBB 3L13A 3QWGA 2WXNA 3FTYA 3NQPA 1HXIA 3ZEFA 1L5JA 3WXXA 4U07A 1ELKA 3FH8A 2A6CA 3QK0A 2VJ8A 2KEJA 4PUCA 5KCMA 2IF4A 3ZHIA 2DBAA 4I1MA 2PPXA 2FI7A 3ML9A 2OV8A 5KJNA 3FTZA 4UI9K 1LF8A 3B7SA 2XQ0A 3LY9A 1OWLA 3Q47B 2PQRA 4NURA 4I6UA 3PREA 2KC7A 3OP9A 3FUIA 4IYPA 3RO2A 1E8ZA 2WXFA 1UXDA 4DPRA 3MX3A 3FTXA 3I3NA 3FULA 3QWWA 5ANLA 5CCMA 4ACKA 2X6KA 4UI9J 3LXUX 2NC9A 2XPZA 5FQ6A 3G2WA 4NDWA 4PU7A 1R63A 4XZ4A 4XI0A 1Y6IA 3L08A 1SZAA 3LDZA 4WAFA 5BV1A 2YINA 4N3BA 4U8HA 2VSOE 3GN5A 1LCCA 2X6IA 3EDTB 4JPSA 3GBFA 3FUEA 4WWOA 2IVQA 1HH8A 1OWOA 4BX8A 3T8MA 2WB2A 3ZVVA 3QOUA 4K03A 4TV3A 2WXJA 1WH8A 2HSGA 3D9MA 2KPJA 3DPDA 3FFLA 3SD5A 3TAXA 1WM5A 1ZZ7A 1UJKA 3CQGB 5K98B 3UX4A 4A3VA 1NA3A 3RZZA 3CVXA 3LEWA 3RU0A 5A7LA 3DNVB 1HX8A 3AU5A 4AY5A 2LO6A 3IBEA 2B5AA 3PEUB 4C0MA 4HVBA 3R7QA 2ICTA 4UQXA 3S7BA 1QP4A 1H6KA 1OUVA 4GZ6A 2HINA 2WXOA 2WXGA 5LX8A 1PERL 1OWMA 4YNDA 3LVQE 4N5CA 4M3OA 4UQYA 2IFUA 3FTVA 3FUJA 3QB2A 1N52A 4CGVA 3RK6A 3JCKC 4AVXA 4ANXA 4HLEA 3IEGA 1HS6A 2CHXA 3HVEA 2PUGA 3LVRE 4FHKA 2AW6A 2VGYA 2YQ8A 3FMYA 5ARFA 3CLJA 2ONDA 1NZNA 1INZA 2WXIA 3UT4A 4TUUA 4FLBA 3TRBA 3PE4A 4X4GA 2R1JL 1PNRA 1AU7A 4JC8A 4XKBA 4N2QA 4HFGA 4APOA 4BTAA 4G24A 3RRNB 3OXLA 1GW6A 2LYKA 2I1JA 2WXPA 4KZ0A 2IOSA 2WXHA 3MYVA 1ZBPA 5AYWD 4ANWA 2IVGA 5AJLA 4B94A 2PUEA 3ULQA 2GGFA 1PRVA 4RSYA 1EDUA 2R17C 4RVBA 3VLFA 3ONLA 2IOLA 2GRLA 3JYSA 4PU4C 3L17A 4AIFA 1BDIA 1Y9QA 2LNIA 1VPWA 4JZYA 4FULA 3CV0A 3HDXA 3JQ0A 1KT1A 3MV3B 4EZJA 1IC8A 3CVYA 5E75A 3SBTB 1ZZCA 3Q5MA 4UWLA 5LCWC 3Q4AB 4OB4A 1HU3A 2C2LA 3VK0A 1PAQA 2J9QA 2RG8A 5G05J 1WIZA 2MHKA 1LQCA 2XGSA 1IHGA 2PUDA 2LYQA 3D9OA 4J8DA 3PUKA 3O9XA 1YA0A 4KXKB 1UG3A 2VGXA 3D3MA 5FQ4A 2E2EA 3HIZA 2X6HA 3Q15A 2CFZA 5LFAA 4Z5DA 2FJRA 3MV2B 4IVZA 1NEQA 4X4BA 4L7TA 2WQ6A 1E7UA 2VTBA 3KS2A 4JHJA 1MQSA 1GT0C 4BWRA 4EBAA 2O49A 3CK7A 4GA2A 3RRUA 2I6HA 1S7EA 2EWTA 3EHNA 3I4RB 2L49A 3PEVB 4JEUA 4WNFA 2BNNA 4X4HA 1TJFA 1HF8A 4ANUA 3OQMA 3S7FA 3ZW3A 4I17A 3CSFA 4DJAA 1UTXA 2IUOA 4ANVA 3NF1A 5BPPA 5BV0A 5T8IA 1S0PA 1ZZBA 2FF4A 4KMOA 3QARA 3G5GA 2AXUA 2BUGA 1NA0A 1HG2A 4KZCA 1OCTC 3CVWA 3O4ZA 4LEUA 3MKQB 2VSNA 1U3CA 2OFYA 5C1DA 5LP0A 1SQ8A 4MKTA 2V5FA 1B89A 3B7HA 4O6FA 4I9CA 3L54A 3CGHA 5FQ7A 5J90A 3AS8A 3JXDL 2VGXB 1H2TC 4ME2A 2IONA 4JHRA 2PE5A 1JWFA 5G55A 2KM4A 2P58C 1ZUGA 4Q96A 4EPZA 1ELRA 1Z3YA 2WM9A 1NP7A 4GZ3A 1WETA 4JCXA 4FJYA 3ZHMA 4F53A 3IHYA 4K0RA 4AP2A 2IU1A 5C2YA 2WQHA 2XCJA 4X4FA 2VSXE 3NZUA 1ELWA 3U64A 2R63A 2L0TB 2PQNA 4WNGA 5KJLA 1QP7A 2HO1A 2XRYA 4WWNA 4OVVA 4B8AA 4H7XA 4HOTA 3JXCL 3FUNA 5FJYA 3B7UX 1QNFA 2V8SE 3LPZA 4I1OB 4L2LA 5FT9A 3GZ2A 4AM9A 5CMYA 3PXPA 1A17A 3FUMA 3I5PA 4L23A 2NXPA 2MQKA 1EPUA 1UXCA 1X57A 4KT6B 5A7DB 4AY6A 1IYGA 4FN3A 4FADA 3AS4A 2RD0A 4HOQA 2DCPA 3FTSA 3P2BA 4JXTA 2BNOA 3CVQA 3L22A 3SBSA 3F52A 2Q7FA 4J6IA 5DBKA 1ZPQA 4PDXA 4TRQA 5JHAA 2I1KA 1IQRA 3GYZA 3OTNA 3Q49B 2Y3AA 4J0UA 4ABNA 3N71A 1DWKA 4JHKA 4CT4A 3ASGA 2CFUA 3FWVA 4EQFA 2L9BA 1BDHA 1HG5A 4I6GA 3OXGA 3F51A 3D9LA 3FH5A 2X6FA 4YG4A 5DIZA 3ESLA 3SHFA 3D9IA 2D5VA 4N3CA 4J1WA 3OQNA 4BTBA 4X4DA 5G04J 3MEKA 5EDSA 4R7LA 5FTPA 3TXMA 1FVFA 3KAEA 5FZSA 3KZ3A 3LYAA 4ILHB 3EIQC 1HE8A 4HORA 1JFSA 1E8YA 1LCDA 2KZTA 2KEKA 1E8XA 2WVIA 1X5BA 4GYWA 4Y6WA 3TJPA 4AJWA 5HI7A 3UPVA 3SNXA 2H8RA 1Z3XA 4ACLA 2O4AA 2XHEA 4Y42A 2J08A 3TGOA 3U4TA 4CRWA 2E0IA 4EBAG 3MGBA 4A1GA 4IULA 4I9EA 4WUYA 4URKA 4IWRA 2LYLA 3IHVA 4F3VA 3FUDA 2AXZA 5AENA 5ARGA 1ZS4A 3G7DA 4FP7A 2JCGA 2A4ZA 4XE0A 3HZIB 3APDA 4HXIA 4UWFA 4MCTA 5FQ8A 3BD1A 2XCBA 2GZUA 2L0IA 4BT8A 1WAO1 1OSLA 3OXFA 4UI9C 3BG0B 2Y4UA 1JPLA 1E96B 2CROA 2OR1L 3R7RA 5JJTA 1Y7YA 2IJGX 2KZTB 3CHRA 2AUWA 4PS7A 4JL0A 2X38A 4DLOA 3MCXA 1LMB3 4YVQC 2FULA 4A55A 1PRAA 3IVPA 1JFTA 3EHMA 4UWKA 1ZZ6A 1XGWA 4FLHA 4KYOB 1UN9A 3B13A 4RG6A 3ASFA 5EX3A 4C9BB 1H0AA 1H2VC 1UN8A 4F1SA 4ATGA 1U3DA 1RIOA 2L8NA 4JCYA 2OVFA 2KCLA 4IN3B 4GA0A 2WXMA 3ZYMA 5G2NA 3CSTA 4YG7B 2A5UA 3MKQA 3SCFA 3TG5A 3VTXA 4BT9A 3SF4A 2QFCA 3ML8A 4MLPA 3CVLA 1HO8A 3C98A 4JEHA 3OAWA 1PY1A 1DVPA 4XKCA 4CCAA 4Z5HA 3D1NI 1LLIA 4U0SA 2I9CA 4AEZC 5FWQA 1TJCA 1EYHA 1XNFA 2C0MA 1Y8MA 4NQ0A 5D0QD 2EBYA 4APFA 2YHEA 3APCA 3VLEA 4BY6A 5ANRA 2J4BA 1HF0A 2VSYA 3TG4A 3FTWA 3R1FA 3FYAA 1FCHA 3CVNA 3CK8A 4U63A 1SZ9A 4DLQA 4N39A 5KJMA 4FBIA 2XPYA 3FY4A 3D9PA 2WXKA 2KEIA 2PUFA 2IQCA 4JW1A 4KVMA 2LCVA 4CEMA 2Y4TA 3QKYA 1NERA 2MEZA 4Z5CA 1EFAA 4BFRA 4IA8A 3RRMB 3UQ3A 1H19A 4I8TA 3QAQA 4I6JA 2WMNA 2X3MA 4J8FA 4V3IA 4P29A 4GAAA 3BEEA 4HS2A 3RO3A 3QJZA 2IVBA 1UJJA 2GRMA 2NSZA 3CHSA 4FA6A 3OMTA 3ASHA 3QYXA 3CK9A 3MZLB 2EQXA 1UW4B 3CQCB 1ZU2A 2CHWA 2EF8A 3BDNA 3UUXA 2YNQA 1DNPA 4YG1A 2JLBA 2LYJA 4NACA 1VDYA 3O48A 3OQOA 2XGMA 3GZ1A 2XEVA 4I43A 4XIFA 3PUJA 1W3BA 1QQEA 4MRUA 2HR2A 3FUKA 3HYMB 3MA5A 2PM7A 4QFVA 5BUZA 3ESKA 3CROL 2FBNA 3FH7A 4I1AA 4I6TA 3QWPA 4IRUA 3LISA 5FZRA 3G2VA 5LOZA 1WH6A 1PRUA 2AXVA 2BNMA 3PRZA 3JUIA 3S8QA 4AXHA 5EKQD 1IQUA 3PVLA 1QPZA 4X4CA 1ZVVA 2BTDA 2OOEA 3U66A 5E76A 4C0EA 3FEXA 2FEZA 3KD7A 3UT7A 1Z6TA 3RKVA 1E7VA 2XPIA 1RPEL 1KT0A 4F7AA 1POUA 2R5SA 3GZSA 3LY7A 3MJWA 4GZDA 4LRZA 4OYSA 3SZ7A 3ZYLA 3RJVA 4L1BA 3VLDA 3CHMA 3L1PA 1MHQA 3FTUA 4JVSA 4YBAA 2C0LA 3BS3A 3D9JA 3G2TA 3CR3A 3PNTB 3T5XA 3CVVA 3FU0A 4J8EA 2VYIA 4A1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OB4 A;  3HZI B;  1RZS A;  3VK0 A;  4F8D A;  4MCT A;  1ADR A;  1WIZ A;  1LQC A;  3BD1 A;  4J1X A;  2GZU A;  1QP0 A;  2LYQ A;  2PUD A;  4X4E A;  3O9X A;  1ZAY A;  2WIU B;  3CEC A;  3MLF A;  1OSL A;  2PIJ A;  4X4I A;  1CQT A;  4MCX A;  3SCG A;  3SCH A;  4Z59 A;  4Z5D A;  2CRO A;  1RZR A;  2OR1 L;  2FJR A;  3U3W A;  3CLC A;  2WUS R;  1Y7Y A;  1NEQ A;  4GQM A;  4IVZ A;  1X2L A;  4X4B A;  2AUW A;  2PUC A;  2LYP A;  1GT0 C;  1LMB 3;  2O49 A;  2AWI A;  1S7E A;  2EWT A;  1PRA A;  3IVP A;  2L49 A;  3QWG A;  3ZKC A;  1ZZ6 A;  1B0N A;  2BNN A;  4X4H A;  1JFT A;  3OQM A;  2A6C A;  2KEJ A;  1UTX A;  2IUO A;  2L8N A;  3ZHI A;  2IV1 A;  1RIO A;  4JCY A;  1R69 A;  1ZZB A;  2PPX A;  3KXA A;  3G5G A;  2AXU A;  4PU8 A;  4Z58 A;  4YG7 B;  1OCT C;  3SCF A;  4PU3 C;  2OFY A;  1SQ8 A;  3B7H A;  2LYR A;  2IU7 A;  3JXD L;  4I6U A;  3LFP A;  4I6R A;  3OP9 A;  2BJC A;  4Z5H A;  3D1N I;  2PE5 A;  1LLI A;  1UXD A;  1ZUG A;  2EBY A;  2O38 A;  1WET A;  1QQA A;  4NDW A;  4PU7 A;  1R63 A;  1HF0 A;  4JCX A;  2XIU A;  3R1F A;  3FYA A;  3ZHM A;  1ZZ8 A;  3EUS A;  1L1M A;  3GN5 A;  2XCJ A;  4X4F A;  1LCC A;  3GBF A;  3GN5 B;  4FBI A;  2IVQ A;  3JXB C;  2R63 A;  1YSE A;  1QP7 A;  2KEI A;  1WH8 A;  2HSG A;  2PUF A;  2KPJ A;  3JXC L;  1DW9 A;  1ZZ7 A;  2LCV A;  5K98 B;  1E3O C;  4JQD A;  3RZZ A;  1NER A;  3PXP A;  2MEZ A;  4Z5C A;  5A7L A;  3DNV B;  1EFA A;  4IA8 A;  2MQK A;  1UXC A;  1X57 A;  2B5A A;  1JWL A;  4I8T A;  4FN3 A;  2ICT A;  1RZR D;  1QP4 A;  3F6W A;  2IVB A;  2BNO A;  2HIN A;  2GRM A;  3OMT A;  3F52 A;  3QYX A;  1ZPQ A;  1PER L;  2EF8 A;  3BDN A;  2LYS A;  3UFD A;  4YG1 A;  1DWK A;  2LYJ A;  3H5T A;  1BDH A;  3OQO A;  2PUG A;  4YAR A;  3F51 A;  2AW6 A;  2PUA A;  4YG4 A;  3FMY A;  2XI8 A;  4GHJ A;  1XWR A;  2D5V A;  3KJX A;  4J1W A;  3OQN A;  1QQB A;  3CRO L;  2JVL A;  4X4D A;  2KZ8 A;  3TRB A;  4I6T A;  4X4G A;  2XSD C;  3LIS A;  2R1J L;  1AU7 A;  1PNR A;  1WH6 A;  1PRU A;  2AXV A;  2BNM A;  1ZZ9 A;  2XJ3 A;  3KZ3 A;  3S8Q A;  3QF3 A;  2LYK A;  1QPZ A;  4X4C A;  1JFS A;  1LCD A;  1ZVV A;  2KEK A;  2IVG A;  2CSF A;  3FYM A;  1JH9 A;  2PUB A;  2PUE A;  2ICP A;  1PRV A;  2H8R A;  4O8B A;  1RPE L;  3QQ6 A;  1POU A;  2O4A A;  1CJG A;  2GRL A;  4Y42 A;  4PU4 C;  1BDI A;  1Y9Q A;  1O4X A;  1VPW A;  3L1P A;  4IWR A;  2LYL A;  4YBA A;  3BS3 A;  1IC8 A;  2AXZ A;  1ZZC A;  1ZS4 A;  3G7D A;  2JCG A; 
#chains in the Genus database with same CATH topology
 2HYZ A;  1HQ1 A;  3ZHE B;  3RIB A;  4J1X A;  2KCV A;  4CDM A;  2PXV A;  3G2S A;  3QOX A;  4KVO A;  4MCX A;  1EF1 C;  4Q69 A;  3CVP A;  1BPO A;  1N0Q A;  4LUN U;  2V0P A;  3TWV A;  3FU5 A;  2JEK A;  3DBS A;  4GU5 A;  4CZ2 D;  1B0N A;  5JHB A;  3HRA A;  4Y6C A;  3APF A;  2KAT A;  4CGW A;  4E6H A;  4EEC A;  2IV1 A;  2WMO A;  4PU8 A;  3W9G A;  3LCA A;  5IY5 E;  3UKU G;  4G26 A;  4EQZ A;  2PXL A;  4GTQ A;  4UQZ A;  2M4H A;  4FJZ A;  3KEZ A;  3FP3 A;  2CG2 A;  2H6H A;  2L6J A;  2LSV A;  3GN5 B;  3JXB C;  4F1P A;  3RAU A;  3R9M A;  4DX7 D;  4GYY A;  4PH4 B;  4OBM A;  2KCK A;  4RG9 A;  1K1B A;  1E90 A;  2XCC A;  3SFZ A;  3IKO B;  4ILI A;  1RZR D;  5FZQ A;  3QNK A;  4B89 A;  2R59 A;  2PM6 A;  4YAR A;  1OWP A;  3HVE B;  4JA7 A;  5BNW A;  4U0Z A;  1OCC E;  2MXD A;  2XRZ A;  1HFA A;  3B95 A;  4AOF A;  1JH9 A;  3FYM A;  4L2Y A;  2LAH A;  5KNG A;  3AJI A;  3E4B A;  4G25 A;  4A3T A;  3B7T A;  2M63 A;  4W9R A;  3TWS A;  5A23 A;  4HOS A;  3UT8 A;  3EIJ A;  4F8D A;  3CHQ A;  4I6E A;  3DPY A;  3QDN A;  3ZPX A;  4GZC A;  4B93 B;  5HQ8 A;  1OCZ E;  2WPV A;  3V31 A;  4EHM A;  4Q2J A;  3L16 A;  5CBN A;  3EJN A;  3FTY A;  1S70 B;  3NQP A;  1HXI A;  4DX1 A;  1L5J A;  3FH8 A;  2A6C A;  2FI7 A;  3ML9 A;  1LF8 A;  2XQ0 A;  2PQR A;  2V5Q C;  3OP9 A;  4IYP A;  1UXD A;  3MX3 A;  5ANL A;  5CCM A;  3LXU X;  2XPZ A;  4PU7 A;  4GTM A;  1Y6I A;  2YIN A;  4N3B A;  2VSO E;  4JPS A;  3GBF A;  3FUE A;  2DZN A;  4BX8 A;  3T8M A;  3DSW A;  3D9M A;  2P9L G;  3RZZ A;  3A9X A;  3LEW A;  1FT1 A;  2OEV A;  2LO6 A;  3PEU B;  4C0M A;  1U2Z A;  4GZ6 A;  4RQI A;  3SO8 A;  5LX8 A;  1PER L;  3RK6 A;  3JCK C;  3IEG A;  1HS6 A;  2CHX A;  4OAV B;  2PUG A;  5ARF A;  1NZN A;  3PE4 A;  4XKB A;  4HFG A;  4BTA A;  1LTX A;  2I1J A;  4OAU C;  4G8K A;  2R17 C;  3L17 A;  2LNI A;  1VPW A;  3HDX A;  3JQ0 A;  3MV3 B;  1IC8 A;  3CVY A;  5E75 A;  2XGS A;  3ZNG A;  2VGX A;  2E2E A;  3HIZ A;  2CFZ A;  2J7W A;  2FJR A;  4X4B A;  4JB8 P;  2WQ6 A;  2VTB A;  3KS2 A;  4JHJ A;  4APF A;  2I6H A;  4WNF A;  4F53 A;  2BNN A;  4X4H A;  3OQM A;  3S7F A;  3CSF A;  1OY3 D;  1UTX A;  1O1S A;  3NF1 A;  5BV0 A;  2VEO A;  4YDY A;  1HG2 A;  3CVW A;  4LEU A;  3MKQ B;  1O1R A;  2V5F A;  5EN5 D;  3L54 A;  5FQ7 A;  5J90 A;  3AS8 A;  2VGX B;  2P58 C;  5AAO A;  1N4R A;  4GZ3 A;  4JCX A;  4M7C A;  5H7P A;  1DUL A;  5C2Y A;  4X4F A;  4YDO A;  4HLL A;  5KJL A;  2XRY A;  4O60 A;  5FJY A;  5CMY A;  2DZO A;  3SQV A;  2NXP A;  1EPU A;  5BXU A;  1X57 A;  4FN3 A;  2DCP A;  3V2O A;  2LUH A;  3F52 A;  2Q7F A;  2I1K A;  3N71 A;  4JHK A;  3ASG A;  2L9B A;  3FH5 A;  5DIZ A;  2Y69 E;  1OXJ A;  2D5V A;  1IKN D;  4K5B A;  4BTB A;  3MEK A;  5EDS A;  1FVF A;  1NI1 A;  2KEK A;  4Y6W A;  1X5B A;  5HI7 A;  4ER7 A;  4ACL A;  4X8Q A;  3C3O A;  3UKR G;  4JD2 G;  2E0I A;  3NAW A;  3MGB A;  1N11 A;  2AXZ A;  4HBD A;  4FP7 A;  3UI2 A;  1X81 A;  5FQ8 A;  3BD1 A;  2L0I A;  2P9N G;  1OSL A;  1JPL A;  3R7R A;  5AQA A;  4PS7 A;  4JL0 A;  3MCX A;  2FUL A;  3EHM A;  3B13 A;  5AN8 A;  1UN8 A;  3T8K A;  4ATG A;  2OVF A;  1OCR E;  4EKG A;  2HCN A;  2B0O E;  1TNZ A;  3ZYM A;  3CST A;  2PXQ A;  2QFC A;  3ML8 A;  2GRN B;  2LLW A;  3TEP A;  5AQ7 A;  2XXP A;  1XNF A;  4NQ0 A;  4YDE A;  4BY6 A;  2EBY A;  3APC A;  2VSY A;  1HF0 A;  3CVN A;  4BSZ B;  3NRO A;  2DYR E;  4N39 A;  5KJM A;  1DCQ A;  3Q73 A;  4U7E B;  4CYM D;  4K5A B;  2IQC A;  4U8Y D;  2XZD G;  4U96 D;  4Z5C A;  4IA8 A;  1O5M A;  3RRM B;  3UQ3 A;  4I8T A;  3PZ1 A;  4GAA A;  3BEE A;  1N4Q A;  2IVB A;  3CHS A;  4JHR A;  2EQX A;  5FIN A;  3VWS A;  3BDN A;  2JLB A;  4NAC A;  3BU8 A;  4I43 A;  1W3B A;  3FUK A;  3HYM B;  2PM7 A;  3BQO A;  3ZXP A;  3LIS A;  5EKQ D;  4C0E A;  3FEX A;  1Z6T A;  3C3R A;  1KT0 A;  1QYM A;  1POU A;  3NOC D;  3L82 A;  4L1B A;  3UIN C;  3L1P A;  4JVS A;  3G2T A;  3FU0 A;  2GRQ B;  2XEH A;  1MZC A;  1RZS A;  4WWP A;  4HOU A;  3E34 A;  4GTS A;  4CDR A;  1ZAY A;  3NXH A;  2R02 A;  3HXE A;  2V3C C;  3QC1 A;  3URZ A;  2XEE A;  2WUS R;  5JJ6 A;  3JQ1 A;  3ZXS A;  5CCL A;  2WXR A;  4FC8 A;  3NOG D;  3ZKC A;  4EZK A;  3PS6 A;  3PH0 C;  2I2O A;  4BER A;  1N9A A;  2YBD A;  3ISM C;  4HRA A;  3PZ3 A;  1RW2 A;  3G2U A;  3CKC A;  3DWL G;  2IU7 A;  4UWH A;  4G2V A;  4I6R A;  4BET A;  4DI3 A;  1KZP A;  2PXU A;  4U0U A;  4U04 A;  3ZIM A;  3E37 A;  1KPS B;  1QQA A;  4JA9 A;  3DSV A;  1ZZ8 A;  2PXP A;  2J07 A;  3ZYQ A;  4JQD A;  1H2U A;  5A6C A;  3PZD A;  4YDW A;  5CMW A;  4MS6 A;  4U95 D;  3F6W A;  5CHE E;  5CRV A;  3ZGQ A;  2XXQ A;  3UTM A;  3HHM A;  5CED B;  3UFD A;  2J4D A;  5KJK A;  2UWJ G;  5DTM A;  1MX4 A;  4I2Z A;  4CT0 A;  1NFI E;  4RLY A;  2QY7 A;  3SI5 A;  1WY6 A;  2JVL A;  1KZO A;  4KBQ A;  2XSD C;  3T5V A;  3CHP A;  4NRH B;  1ZZ9 A;  2XJ3 A;  3QF3 A;  3LS8 A;  2CSF A;  3R9A B;  4AV7 A;  4O8B A;  4H7Y A;  2V4L A;  3S2A A;  1CJG A;  2PXF A;  4GCN A;  2LNM A;  1O4X A;  1JCS A;  2BF0 X;  3NZS A;  3ZN3 A;  3CKB A;  2HM8 A;  3ZHE A;  3ME5 A;  1UOH A;  2LAI A;  2RKK A;  3ZYK A;  1MX2 A;  3CIA A;  3PDN A;  4X4E A;  4N2S A;  3CEC A;  4B0Z A;  3PE3 A;  1CQT A;  1LD8 A;  2VQ2 A;  4GMJ A;  2VJ8 A;  2IF4 A;  2PPX A;  1D8E A;  4UI9 K;  3B7S A;  1TNU A;  1SA5 A;  3Q47 B;  4NUR A;  4I6U A;  3RO2 A;  2KC7 A;  3I3N A;  3FUL A;  4LG6 A;  1TN6 A;  4ACK A;  1TN7 A;  2X6K A;  3EHQ A;  3G2W A;  4XZ4 A;  4EK9 A;  3L08 A;  1SZA A;  3LDZ A;  3EDT B;  3GN5 A;  4ER5 A;  1LCC A;  1S63 A;  1HH8 A;  3Q9U C;  4TV3 A;  3FFL A;  1WH8 A;  3SD5 A;  1NA3 A;  3RU0 A;  5A7L A;  4LSZ E;  3S7B A;  2HIN A;  2WXO A;  2WXG A;  2EIJ E;  4YND A;  2ETA A;  3LVQ E;  4N5C A;  2PXK A;  1N52 A;  4CGV A;  4AVX A;  3HVE A;  4FHK A;  4HI8 A;  1INZ A;  2WXI A;  2LXL A;  1PNR A;  4JC8 A;  4N2Q A;  3TEL A;  3RRN B;  3V79 K;  2IOS A;  2WXH A;  3MYV A;  5AJL A;  3NZL A;  2B6C A;  3ULQ A;  4G8L A;  1BDI A;  4FUL A;  3CV0 A;  4LNG A;  5CEC B;  4OB4 A;  1PAQ A;  2J9Q A;  5G05 J;  1WIZ A;  1K8K G;  2MHK A;  1LQC A;  1IHG A;  3O9X A;  3V2X A;  1BI8 B;  1UG3 A;  5LFA A;  4Z5D A;  3E32 A;  4L7T A;  1E7U A;  4BWR A;  2IO3 C;  4EBA A;  4HOT A;  3CK7 A;  4GA2 A;  2HFZ A;  1S7E A;  3EHN A;  4ATZ D;  1BU9 A;  5T8I A;  1S0P A;  2FF4 A;  4HI9 A;  3G5G A;  1N0R A;  1OCT C;  3O4Z A;  1U3C A;  5C1D A;  5EIL A;  3B7H A;  2QZA A;  4I9C A;  3CVU A;  5AAR A;  4HRM B;  1MJ0 A;  4ME2 A;  1JWF A;  5G55 A;  3EU9 A;  1ZUG A;  4FJY A;  2XS1 A;  4K0R A;  3ZU7 B;  2DYS E;  2WQH A;  1ELW A;  2R63 A;  4WWN A;  4OVV A;  4H7X A;  3EU5 A;  3LPZ A;  4TUM A;  2ETB A;  2HCS A;  4FAD A;  3SFX A;  4HOQ A;  4JXT A;  2P9U G;  1RZ4 A;  4J6I A;  4TRQ A;  5JHA A;  3OTN A;  3Q49 B;  2Y3A A;  1TNO A;  4J0U A;  2J7U A;  1BDH A;  1HG5 A;  3KEA A;  4I6G A;  3OXG A;  3D9L A;  3ESL A;  3D9I A;  3OQN A;  3KZ3 A;  1BLX B;  1HE8 A;  1TNY A;  1FPP A;  1E8Y A;  1LCD A;  1ZB1 A;  2KZT A;  3Q78 A;  4AJW A;  4GYW A;  4GTV A;  2XHE A;  4Y42 A;  3TGO A;  4A1G A;  2ETC A;  3NB2 A;  3UIP C;  4URK A;  4IWR A;  2OCC E;  4F3V A;  3EUV A;  1ZS4 A;  5JMN D;  2XCB A;  3OXF A;  3BG0 B;  2OR1 L;  5JJT A;  1Y7Y A;  2IJG X;  2KZT B;  4TXR A;  2AUW A;  4A55 A;  1QB2 A;  1ZZ6 A;  1XGW A;  4KYO B;  1UN9 A;  4L9P A;  1U3D A;  2KCL A;  4IN3 B;  4GA0 A;  4YG7 B;  2A5U A;  2XEN A;  3MKQ A;  3PZ2 A;  3TG5 A;  3SF4 A;  3CVL A;  1HO8 A;  4JEH A;  1PY1 A;  4CCA A;  3D1N I;  5FWQ A;  1EYH A;  1Y8M A;  2J4B A;  3J5Q B;  3Q9N C;  1DC2 A;  3R1F A;  3FYA A;  3AG1 E;  3JXI A;  2WXK A;  2KEI A;  3C72 A;  2MEZ A;  5CEA A;  2EIK E;  1H19 A;  4EZI A;  4P29 A;  2R05 A;  4HS2 A;  2GRM A;  2NSZ A;  2HE0 A;  1ZU2 A;  2CHW A;  2IO2 C;  3DXM G;  4NIK A;  3OQO A;  5ENS D;  2XEV A;  3PUJ A;  4MRU A;  2HR2 A;  2GRO B;  2FBN A;  4I6T A;  3QWP A;  2BED A;  3G2V A;  1WH6 A;  2JAB A;  1JCQ A;  4AXH A;  1IQU A;  3HXD A;  3PVL A;  4X4C A;  3TWT A;  2BTD A;  3SY2 A;  3KD7 A;  2XPI A;  4F7A A;  4N5Q A;  3LY7 A;  3MJW A;  4LRZ A;  4O1P A;  1A5E A;  3VLD A;  5ENP D;  3FTU A;  4UWF A;  3D9J A;  3CVV A;  1S64 A;  3CR3 A;  4ZHB A;  4J8E A;  2VYI A;  4ER6 A;  3DSX A;  4PS3 A;  1ADR A;  3DST A;  5ENQ D;  1QP0 A;  5ENN A;  2J8S D;  2WIU B;  1RZR A;  1OWN A;  1N54 A;  3CLC A;  3U3W A;  4D10 C;  5T3R A;  2OEW A;  4XX5 A;  3D9N A;  4CDN A;  3E30 A;  1Z5S C;  3ASD A;  1R69 A;  3KXA A;  3IV0 A;  2ZU6 B;  1JUQ A;  2WXL A;  4Z58 A;  3C3Q A;  4PU3 C;  4FHJ A;  3K9I A;  5T4Y A;  4GML A;  4Q94 A;  1K1A A;  2BJC A;  4G1T A;  3LFP A;  3VTY A;  1SA4 A;  3BG1 B;  5BT1 A;  4GB9 A;  4YVO A;  3HXF A;  4ER0 A;  2J09 A;  3FHE A;  1N94 A;  1P5Q A;  1L1M A;  2MRI A;  2F8X K;  2XGO A;  3FU3 A;  3B7R L;  1YSE A;  4GTP A;  2L1P A;  2AJA A;  1DW9 A;  2AVP A;  5J08 A;  3I4G A;  3TWU A;  2LSU A;  4GZ5 A;  4DI4 A;  1JWL A;  1AP7 A;  2QYJ A;  2EIL E;  4WND A;  4BSX A;  2J49 A;  5JA4 D;  3AU4 A;  2LYS A;  3UM2 A;  3H5T A;  3FDH A;  2PXD A;  2XI8 A;  3PZ4 A;  4GHJ A;  5FIO A;  1XWR A;  3AS5 A;  4B8C B;  2KZ8 A;  3UM0 A;  5HRY A;  1HZ4 A;  1PC2 A;  2FO7 A;  4G23 A;  2PUB A;  3GW4 A;  2ICP A;  5AJD A;  4DK5 A;  4I2W A;  3LKU A;  1H6P A;  4E85 A;  2PZI A;  3TXN A;  1KLX A;  3LY8 A;  3U9W A;  3ZFW A;  3ONK A;  3MLF A;  5BW8 C;  3GZD C;  3SGH A;  3SCH A;  2PUC A;  2LYP A;  3L13 A;  3QWG A;  5BXO A;  4DRX E;  4U07 A;  1ELK A;  4PUC A;  3ZHI A;  5KJN A;  3FTZ A;  4UUC A;  3LY9 A;  1OWL A;  5CBO A;  3PRE A;  3FUI A;  3ABK E;  1G3N B;  2WXF A;  2F37 A;  4DPR A;  3QWW A;  3G0T A;  4UI9 J;  3VTX A;  2NC9 A;  4NDW A;  1R63 A;  1JCR A;  4HQD A;  4WAF A;  2WQ7 A;  4WWO A;  1LD7 A;  2IVQ A;  2WB2 A;  2F8Y A;  1TR4 A;  1TNB A;  3JUE A;  3DPD A;  2KPJ A;  3UX4 A;  1UJK A;  3CQG B;  5K98 B;  3CVX A;  2ZXW E;  3IBE A;  4HVB A;  4LNB A;  5HKP A;  2ICT A;  4UQX A;  3R7Q A;  1QP4 A;  1H6K A;  2IEJ A;  4DX2 A;  3DSU A;  4M3O A;  4UQY A;  2IFU A;  3FUJ A;  3QB2 A;  4DUI A;  4ANX A;  4HLE A;  2AW6 A;  3QFI A;  3M9L A;  2VGY A;  2YQ8 A;  3CLJ A;  3UT4 A;  4FLB A;  2R1J L;  1AU7 A;  2V4H C;  4APO A;  1OCO E;  3OXL A;  1GW6 A;  2LYK A;  2WXP A;  4KZ0 A;  1ZBP A;  3X2Q E;  2IVG A;  4GTR A;  2PUE A;  2GGF A;  1PRV A;  4EKI A;  1BD8 A;  2R03 A;  4RSY A;  4RVB A;  3ONL A;  2GRL A;  3JYS A;  4PU4 C;  4AIF A;  4JZY A;  1KT1 A;  3SBT B;  3ULY A;  3Q5M A;  4UWL A;  3GZD A;  3OWQ A;  3Q4A B;  1HU3 A;  5DT2 A;  3VK0 A;  4HRN A;  3EHR A;  3KL4 A;  3D9O A;  2PUD A;  4J8D A;  3D9H A;  3D3M A;  4Z68 A;  5KNH D;  4ZFH A;  5GAG i;  4IVZ A;  2KXP C;  1GT0 C;  3I4R B;  3AG2 E;  3W9F A;  4JEU A;  2L49 A;  3GUU A;  3PEV B;  1HF8 A;  4I17 A;  4ANV A;  4U8V D;  1D9S A;  4KMO A;  2R2L A;  3QAR A;  2AXU A;  1NA0 A;  4KZC A;  4GTO A;  2OFY A;  4MKT A;  2VGE A;  4O6F A;  1B89 A;  3CGH A;  2FO1 E;  2KM4 A;  4Q96 A;  1Z3Y A;  2GRR B;  3R09 A;  1D8D A;  3ZHM A;  3IHY A;  2IU1 A;  3C5R A;  3U64 A;  2L0T B;  2PQN A;  2HO1 A;  3JXC L;  3FUN A;  5FT9 A;  4I1O B;  2V8S E;  3B7B A;  5DRT A;  3PXP A;  1A17 A;  3I5P A;  1H6O A;  1V54 E;  2RD0 A;  2BNO A;  3L22 A;  2MYO A;  3SBS A;  2LXM A;  5DBK A;  4PDX A;  2NYJ A;  1IQR A;  3GYZ A;  4F6R D;  4ABN A;  4EQF A;  2CFU A;  3FWV A;  4ER3 A;  3F51 A;  4YG4 A;  2LLV A;  4N3C A;  4J1W A;  2P9K G;  4X4D A;  5G04 J;  3TXM A;  5FTP A;  3KAE A;  5FZS A;  3WG7 E;  3BUA A;  2RFM A;  1E8X A;  3UPV A;  3DM5 A;  2P9I G;  2O4A A;  2J08 A;  3SR4 A;  4EBA G;  3AG3 E;  3DEP A;  5ENR D;  4I9E A;  4WUY A;  3TFL A;  5AEN A;  5ARG A;  2DWZ A;  4XE0 A;  3APD A;  1WG0 A;  5B1B E;  4BT8 A;  4DX6 D;  4UI9 C;  3E33 A;  2Y4U A;  2CRO A;  2X38 A;  1LMB 3;  4YVQ C;  3ABM E;  3NDB B;  1PRA A;  4UWK A;  5EX3 A;  1H0A A;  1H2V C;  4F1S A;  1RIO A;  4JCY A;  2WXM A;  5G2N A;  2H6F A;  3LJN A;  4MLP A;  3C98 A;  3OAW A;  4XKC A;  2XXA A;  5EID A;  4Z5H A;  1AWC B;  4AEZ C;  2C0M A;  5CER B;  3Q7F A;  5D0Q D;  2YHE A;  3VLE A;  4DX5 D;  3FTW A;  3KSQ A;  1FCH A;  3CK8 A;  4U63 A;  1WDY A;  4DLQ A;  4FBI A;  2XPY A;  3FY4 A;  4KVM A;  4JW1 A;  4C48 B;  4CEM A;  5EIB E;  1EFA A;  3QAQ A;  4J8F A;  2X3M A;  4V3I A;  3QJZ A;  1UJJ A;  4WVL A;  4FA6 A;  3OMT A;  3CK9 A;  3MZL B;  3CQC B;  1DNP A;  1VDY A;  3TWX A;  2ODR D;  4GTT A;  1QQE A;  4J8Y A;  1MYO A;  3ESK A;  3FH7 A;  4I1A A;  5FZR A;  1NW3 A;  5LOZ A;  2AXV A;  1PRU A;  2BNM A;  1ZVV A;  1N95 A;  2OOE A;  3U66 A;  5E76 A;  5DRY A;  2FEZ A;  3UT7 A;  3RSE G;  4QQI A;  1RPE L;  2R5S A;  2PXE A;  3GZS A;  4GZD A;  4OYS A;  3LQX A;  3RJV A;  3UXG A;  4HNA D;  3CHM A;  1U2V G;  2C0L A;  2FFH A;  5M72 A;  1E8W A;  4FU3 A;  4X4I A;  4WNE A;  3ZUV B;  2XS8 A;  3P1U A;  4GQM A;  1JWG A;  1X2L A;  3J5P A;  4GPK A;  3SFY A;  1FVH A;  4LER A;  2AWI A;  1SQM A;  1N4S A;  4GYO A;  3L6A A;  5AIJ A;  5D0O D;  1BI7 B;  3FEY A;  3FUH A;  3GZC A;  2PXT A;  4BX9 A;  2CHZ A;  2P9S G;  2EIM E;  2GW1 A;  3ZRH A;  4GA1 A;  5LCW J;  3LJ3 A;  2LYR A;  2X6J A;  2CG3 A;  3UIO C;  3FU6 A;  2O38 A;  3QWV A;  4LCT A;  2XIU A;  3EUS A;  5G04 C;  2WXQ A;  2DVW A;  3S7D A;  1IHB A;  3PNL B;  4PS8 A;  3HG0 D;  3ENE A;  1E3O C;  5AQB A;  4N3A A;  1K3Z D;  4UWG A;  4XI9 A;  3CEQ A;  3V30 A;  2KBX A;  2UY1 A;  2OVB A;  3ZPJ A;  4A63 B;  3ULE G;  4J8S A;  1YCS B;  2PL2 A;  3S7J A;  3CHO A;  2PUA A;  4GCO A;  3Q79 A;  3KJX A;  1QQB A;  4LNU D;  3TL5 A;  3ZKJ A;  4G11 A;  5JUW A;  2ILR A;  3FUF A;  5JJ7 A;  3UMV A;  2YHC A;  3QQ6 A;  4ILG A;  2UY1 B;  4OVU A;  2DIW A;  3MKR A;  3TWW A;  4EZL A;  5DTR A;  5G05 C;  1QZ2 A;  1Q2Z A;  1OT8 A;  1TEZ A;  5ENT D;  3D9K A;  2MOW A;  5KWD A;  5B3S E;  3DXK G;  5EX0 A;  2PIJ A;  1MX6 A;  3SCG A;  4Z59 A;  1DCE A;  3ASO E;  2VTB B;  2WXN A;  3ZEF A;  3WXX A;  3QK0 A;  2KEJ A;  2H6G A;  4O1O A;  5KCM A;  2DBA A;  4I1M A;  2OV8 A;  4GMR A;  5HS0 A;  5D2M C;  2IY0 C;  1E8Z A;  3FTX A;  5CRU A;  5FQ6 A;  4XI0 A;  5BV1 A;  4U8H A;  1IXV A;  2X6I A;  1QBQ A;  1OWO A;  3ZVV A;  3QOU A;  4K03 A;  4TXP A;  2WXJ A;  2HSG A;  3TAX A;  1WM5 A;  1ZZ7 A;  3QOW A;  4A3V A;  3DNV B;  1HX8 A;  2Y1L E;  3AU5 A;  4AY5 A;  2B5A A;  1OUV A;  4HRL A;  1OWM A;  3FTV A;  3ASN E;  3LVR E;  5EYL A;  3AG4 E;  3FMY A;  2ZIS A;  2OND A;  3T9K A;  4TUU A;  3TRB A;  4X4G A;  4J7W A;  4G24 A;  2QYU A;  4DE8 A;  5AYW D;  4ANW A;  4B94 A;  2F0Y A;  1EDU A;  3VLF A;  2IOL A;  3UWP A;  1QZX A;  1Y9Q A;  4EZJ A;  2ZIR A;  1ZZC A;  5AQ9 A;  5LCW C;  2C2L A;  2RG8 A;  3OKZ A;  2LYQ A;  2BKK B;  3PUK A;  1YA0 A;  4KXK B;  4XEI G;  1NL4 A;  5FQ4 A;  3MEJ A;  2BKG A;  2L6B A;  2X6H A;  3Q15 A;  4TXQ A;  3UM1 A;  3MV2 B;  1NEQ A;  4DE9 A;  2XZT G;  1MQS A;  2O49 A;  3RRU A;  2EWT A;  1TJF A;  3AAA C;  4ANU A;  3ZW3 A;  4DJA A;  5BPP A;  2IUO A;  5B1A E;  3NBN B;  1ZZB A;  1TN8 A;  2H6I A;  3SX0 A;  2BUG A;  2VSN A;  5LP0 A;  1SQ8 A;  3Q7A A;  3JXD L;  1H2T C;  2ION A;  2PE5 A;  4EPZ A;  1ELR A;  2WM9 A;  1NP7 A;  1WET A;  4AP2 A;  2P9P G;  2XCJ A;  2VSX E;  2A5E A;  3NZU A;  4WNG A;  1QP7 A;  4B8A A;  4BEP A;  3B7U X;  1QNF A;  4L2L A;  4AM9 A;  3GZ2 A;  2GRP B;  4MBG A;  3FUM A;  4L23 A;  2P2C P;  2MQK A;  4AY6 A;  1UXC A;  4KT6 B;  5A7D B;  1IYG A;  3JXJ A;  3AS4 A;  3HXC A;  3FTS A;  3P2B A;  1YMP A;  3CVQ A;  1ZPQ A;  3DSS A;  4CT4 A;  1DWK A;  3TWQ A;  3DEO A;  3HXB A;  2X6F A;  2RFA A;  1SVX A;  3SHF A;  5ITZ F;  4R7L A;  4ILH B;  3LYA A;  3EIQ C;  4HOR A;  1JFS A;  2WVI A;  1FT2 A;  1MFQ C;  3TJP A;  3SNX A;  2H8R A;  1Z3X A;  1V55 E;  3U4T A;  4CRW A;  3Q75 A;  4IUL A;  2LYL A;  3IHV A;  3FUD A;  2JQE A;  3G7D A;  2JCG A;  2A4Z A;  3HZI B;  4HXI A;  4MCT A;  2GZU A;  1WAO 1;  1E96 B;  3IXE A;  1SW6 A;  3CHR A;  3DRA A;  4DLO A;  1JFT A;  3IVP A;  4FLH A;  1N4P A;  3PE5 A;  4RG6 A;  3ASF A;  4C9B B;  4HB5 A;  2L8N A;  3SCF A;  4BT9 A;  2QC9 A;  5GAH i;  1DVP A;  1LLI A;  4U0S A;  2I9C A;  1TJC A;  5ANR A;  3TG4 A;  1SZ9 A;  2EIN E;  3D9P A;  2PUF A;  2ZGG A;  2LCV A;  5DTQ A;  2Y4T A;  3QKY A;  1NER A;  5ENO D;  4BFR A;  4I6J A;  4BES A;  2WMN A;  5D66 A;  3A9Z A;  3RO3 A;  3KSL A;  1TYQ G;  3ASH A;  3QYX A;  1UW4 B;  2EF8 A;  3UUX A;  2YNQ A;  4YG1 A;  5DSX A;  2LYJ A;  3F6Q A;  3O48 A;  2XGM A;  3GZ1 A;  4XIF A;  2Y0B G;  3A9Y A;  2PNN A;  3L9T A;  3MA5 A;  4QFV A;  5BUZ A;  3CRO L;  4IRU A;  3ABL E;  1YYH A;  3PRZ A;  3JUI A;  3S8Q A;  1QPZ A;  2PXB A;  5KBA A;  3RKV A;  1E7V A;  1O1T A;  3UM3 A;  3ZYL A;  3SZ7 A;  3TWR A;  4K5C A;  1MHQ A;  4YBA A;  3BS3 A;  3PNT B;  3T5X A;  5EYP F;  2ZGD A;  4GPM A;  4A1S A; 
#chains in the Genus database with same CATH homology
 2HYZ A;  4PS3 A;  4WWP A;  1RZS A;  5M72 A;  3ZHE B;  1ADR A;  1E8W A;  4HOU A;  3RIB A;  4FU3 A;  4J1X A;  1QP0 A;  2KCV A;  5ENN A;  4CDR A;  1ZAY A;  2WQ7 A;  2WIU B;  4CDM A;  3QC1 A;  3G2S A;  4KVO A;  4X4I A;  4WNE A;  3URZ A;  4MCX A;  1RZR A;  1OWN A;  1N54 A;  3CLC A;  3P1U A;  3U3W A;  1EF1 C;  4Q69 A;  2WUS R;  3CVP A;  4GQM A;  3JQ1 A;  1BPO A;  1X2L A;  1JWG A;  5JJ6 A;  3ZXS A;  5T3R A;  4D10 C;  5CCL A;  2WXR A;  4FC8 A;  4LUN U;  4GPK A;  2V0P A;  3FU5 A;  1FVH A;  2JEK A;  2AWI A;  3DBS A;  4LER A;  4GU5 A;  3ZKC A;  4EZK A;  1B0N A;  3PS6 A;  5JHB A;  1SQM A;  4XX5 A;  4GYO A;  3L6A A;  3D9N A;  4Y6C A;  3APF A;  2KAT A;  3PH0 C;  2I2O A;  4E6H A;  4CGW A;  4EEC A;  5AIJ A;  4CDN A;  5D0O D;  2IV1 A;  3ASD A;  1R69 A;  2WMO A;  3FEY A;  3KXA A;  3IV0 A;  2ZU6 B;  3FUH A;  4PU8 A;  1JUQ A;  3LCA A;  2WXL A;  4Z58 A;  4BX9 A;  2CHZ A;  4PU3 C;  4FHJ A;  2GW1 A;  3K9I A;  3ZRH A;  3G2U A;  5T4Y A;  4GA1 A;  5LCW J;  4G26 A;  3LJ3 A;  2LYR A;  2X6J A;  3CKC A;  2IU7 A;  4GML A;  4Q94 A;  4UWH A;  2BJC A;  4G1T A;  3LFP A;  4I6R A;  4G2V A;  4DI3 A;  3VTY A;  3BG1 B;  3CVU A;  2CG3 A;  4U0U A;  4UQZ A;  5BT1 A;  4GB9 A;  4U04 A;  3FU6 A;  4FJZ A;  3ZIM A;  4YVO A;  2O38 A;  3QWV A;  1QQA A;  2J09 A;  3FHE A;  4LCT A;  1P5Q A;  3KEZ A;  2XIU A;  4JA9 A;  3FP3 A;  1ZZ8 A;  3EUS A;  1L1M A;  2MRI A;  2XGO A;  2CG2 A;  5G04 C;  2WXQ A;  3FU3 A;  2L6J A;  2LSV A;  3S7D A;  2J07 A;  3GN5 B;  3B7R L;  3ZYQ A;  3JXB C;  3PNL B;  4PS8 A;  1YSE A;  4GYY A;  1DW9 A;  3ENE A;  4PH4 B;  2AVP A;  2KCK A;  3I4G A;  1E3O C;  1E90 A;  4JQD A;  4RG9 A;  5J08 A;  1H2U A;  2LSU A;  2XCC A;  5A6C A;  3PZD A;  4GZ5 A;  4N3A A;  3SFZ A;  4XI9 A;  4UWG A;  4DI4 A;  3CEQ A;  3IKO B;  1JWL A;  4ILI A;  1RZR D;  5CMW A;  4MS6 A;  2UY1 A;  5FZQ A;  3F6W A;  2OVB A;  4WND A;  5CHE E;  3ZGQ A;  3ZPJ A;  4BSX A;  2J49 A;  3QNK A;  4B89 A;  3AU4 A;  3HHM A;  2LYS A;  3UFD A;  2J4D A;  4J8S A;  5KJK A;  3H5T A;  2R59 A;  2PL2 A;  2UWJ G;  2PM6 A;  3FDH A;  3S7J A;  4YAR A;  1OWP A;  3CHO A;  2PUA A;  3HVE B;  4GCO A;  4JA7 A;  5BNW A;  4I2Z A;  2XI8 A;  4CT0 A;  4U0Z A;  4GHJ A;  1XWR A;  2QY7 A;  3KJX A;  3AS5 A;  3SI5 A;  1QQB A;  1WY6 A;  2JVL A;  4B8C B;  2KZ8 A;  4KBQ A;  3TL5 A;  2XSD C;  1HZ4 A;  3T5V A;  3CHP A;  4NRH B;  1ZZ9 A;  2XJ3 A;  1HFA A;  2XRZ A;  3QF3 A;  4G11 A;  1PC2 A;  2FO7 A;  4G23 A;  4AOF A;  3LS8 A;  1JH9 A;  2CSF A;  3FYM A;  2PUB A;  2ILR A;  3FUF A;  3GW4 A;  4L2Y A;  5JJ7 A;  2ICP A;  2LAH A;  3R9A B;  3UMV A;  4AV7 A;  4O8B A;  2YHC A;  4H7Y A;  3QQ6 A;  2V4L A;  4ILG A;  5AJD A;  1CJG A;  3S2A A;  2UY1 B;  3E4B A;  4G25 A;  4I2W A;  4OVU A;  4DK5 A;  2DIW A;  3MKR A;  4EZL A;  4GCN A;  4A3T A;  1O4X A;  2M63 A;  3B7T A;  3LKU A;  4W9R A;  5G05 C;  2BF0 X;  1QZ2 A;  3NZS A;  4E85 A;  5A23 A;  3D9K A;  1TEZ A;  2MOW A;  3ZN3 A;  3CKB A;  2HM8 A;  2PZI A;  3ZHE A;  4HOS A;  3TXN A;  1KLX A;  3LY8 A;  3EIJ A;  4F8D A;  3U9W A;  3UT8 A;  3ZFW A;  2LAI A;  3CHQ A;  4I6E A;  3ZYK A;  3ONK A;  3CIA A;  3PDN A;  4X4E A;  4N2S A;  3QDN A;  3CEC A;  4B0Z A;  3MLF A;  5BW8 C;  3PE3 A;  5EX0 A;  3SGH A;  2PIJ A;  1CQT A;  4GZC A;  5HQ8 A;  3SCH A;  3SCG A;  4Z59 A;  2WPV A;  2PUC A;  2VQ2 A;  3L16 A;  4GMJ A;  2LYP A;  3EJN A;  2VTB B;  3L13 A;  3QWG A;  2WXN A;  3FTY A;  3NQP A;  1HXI A;  3ZEF A;  1L5J A;  3WXX A;  4U07 A;  1ELK A;  3FH8 A;  2A6C A;  3QK0 A;  2VJ8 A;  2KEJ A;  4PUC A;  5KCM A;  2IF4 A;  3ZHI A;  2DBA A;  4I1M A;  2PPX A;  2FI7 A;  3ML9 A;  2OV8 A;  5KJN A;  3FTZ A;  4UI9 K;  1LF8 A;  3B7S A;  2XQ0 A;  3LY9 A;  1OWL A;  3Q47 B;  2PQR A;  4NUR A;  4I6U A;  3PRE A;  2KC7 A;  3OP9 A;  3FUI A;  4IYP A;  3RO2 A;  1E8Z A;  2WXF A;  1UXD A;  4DPR A;  3MX3 A;  3FTX A;  3I3N A;  3FUL A;  3QWW A;  5ANL A;  5CCM A;  4ACK A;  2X6K A;  4UI9 J;  3LXU X;  2NC9 A;  2XPZ A;  5FQ6 A;  3G2W A;  4NDW A;  4PU7 A;  1R63 A;  4XZ4 A;  4XI0 A;  1Y6I A;  3L08 A;  1SZA A;  3LDZ A;  4WAF A;  5BV1 A;  2YIN A;  4N3B A;  4U8H A;  2VSO E;  3GN5 A;  1LCC A;  2X6I A;  3EDT B;  4JPS A;  3GBF A;  3FUE A;  4WWO A;  2IVQ A;  1HH8 A;  1OWO A;  4BX8 A;  3T8M A;  2WB2 A;  3ZVV A;  3QOU A;  4K03 A;  4TV3 A;  2WXJ A;  1WH8 A;  2HSG A;  3D9M A;  2KPJ A;  3DPD A;  3FFL A;  3SD5 A;  3TAX A;  1WM5 A;  1ZZ7 A;  1UJK A;  3CQG B;  5K98 B;  3UX4 A;  4A3V A;  1NA3 A;  3RZZ A;  3CVX A;  3LEW A;  3RU0 A;  5A7L A;  3DNV B;  1HX8 A;  3AU5 A;  4AY5 A;  2LO6 A;  3IBE A;  2B5A A;  3PEU B;  4C0M A;  4HVB A;  3R7Q A;  2ICT A;  4UQX A;  3S7B A;  1QP4 A;  1H6K A;  1OUV A;  4GZ6 A;  2HIN A;  2WXO A;  2WXG A;  5LX8 A;  1PER L;  1OWM A;  4YND A;  3LVQ E;  4N5C A;  4M3O A;  4UQY A;  2IFU A;  3FTV A;  3FUJ A;  3QB2 A;  1N52 A;  4CGV A;  3RK6 A;  3JCK C;  4AVX A;  4ANX A;  4HLE A;  3IEG A;  1HS6 A;  2CHX A;  3HVE A;  2PUG A;  3LVR E;  4FHK A;  2AW6 A;  2VGY A;  2YQ8 A;  3FMY A;  5ARF A;  3CLJ A;  2OND A;  1NZN A;  1INZ A;  2WXI A;  3UT4 A;  4TUU A;  4FLB A;  3TRB A;  3PE4 A;  4X4G A;  2R1J L;  1PNR A;  1AU7 A;  4JC8 A;  4XKB A;  4N2Q A;  4HFG A;  4APO A;  4BTA A;  4G24 A;  3RRN B;  3OXL A;  1GW6 A;  2LYK A;  2I1J A;  2WXP A;  4KZ0 A;  2IOS A;  2WXH A;  3MYV A;  1ZBP A;  5AYW D;  4ANW A;  2IVG A;  5AJL A;  4B94 A;  2PUE A;  3ULQ A;  2GGF A;  1PRV A;  4RSY A;  1EDU A;  2R17 C;  4RVB A;  3VLF A;  3ONL A;  2IOL A;  2GRL A;  3JYS A;  4PU4 C;  3L17 A;  4AIF A;  1BDI A;  1Y9Q A;  2LNI A;  1VPW A;  4JZY A;  4FUL A;  3CV0 A;  3HDX A;  3JQ0 A;  1KT1 A;  3MV3 B;  4EZJ A;  1IC8 A;  3CVY A;  5E75 A;  3SBT B;  1ZZC A;  3Q5M A;  4UWL A;  5LCW C;  3Q4A B;  4OB4 A;  1HU3 A;  2C2L A;  3VK0 A;  1PAQ A;  2J9Q A;  2RG8 A;  5G05 J;  1WIZ A;  2MHK A;  1LQC A;  2XGS A;  1IHG A;  2PUD A;  2LYQ A;  3D9O A;  4J8D A;  3PUK A;  3O9X A;  1YA0 A;  4KXK B;  1UG3 A;  2VGX A;  3D3M A;  5FQ4 A;  2E2E A;  3HIZ A;  2X6H A;  3Q15 A;  2CFZ A;  5LFA A;  4Z5D A;  2FJR A;  3MV2 B;  4IVZ A;  1NEQ A;  4X4B A;  4L7T A;  2WQ6 A;  1E7U A;  2VTB A;  3KS2 A;  4JHJ A;  1MQS A;  1GT0 C;  4BWR A;  4EBA A;  2O49 A;  3CK7 A;  4GA2 A;  3RRU A;  2I6H A;  1S7E A;  2EWT A;  3EHN A;  3I4R B;  2L49 A;  3PEV B;  4JEU A;  4WNF A;  2BNN A;  4X4H A;  1TJF A;  1HF8 A;  4ANU A;  3OQM A;  3S7F A;  3ZW3 A;  4I17 A;  3CSF A;  4DJA A;  1UTX A;  2IUO A;  4ANV A;  3NF1 A;  5BPP A;  5BV0 A;  5T8I A;  1S0P A;  1ZZB A;  2FF4 A;  4KMO A;  3QAR A;  3G5G A;  2AXU A;  2BUG A;  1NA0 A;  1HG2 A;  4KZC A;  1OCT C;  3CVW A;  3O4Z A;  4LEU A;  3MKQ B;  2VSN A;  1U3C A;  2OFY A;  5C1D A;  5LP0 A;  1SQ8 A;  4MKT A;  2V5F A;  1B89 A;  3B7H A;  4O6F A;  4I9C A;  3L54 A;  3CGH A;  5FQ7 A;  5J90 A;  3AS8 A;  3JXD L;  2VGX B;  1H2T C;  4ME2 A;  2ION A;  4JHR A;  2PE5 A;  1JWF A;  5G55 A;  2KM4 A;  2P58 C;  1ZUG A;  4Q96 A;  4EPZ A;  1ELR A;  1Z3Y A;  2WM9 A;  1NP7 A;  4GZ3 A;  1WET A;  4JCX A;  4FJY A;  3ZHM A;  4F53 A;  3IHY A;  4K0R A;  4AP2 A;  2IU1 A;  5C2Y A;  2WQH A;  2XCJ A;  4X4F A;  2VSX E;  3NZU A;  1ELW A;  3U64 A;  2R63 A;  2L0T B;  2PQN A;  4WNG A;  5KJL A;  1QP7 A;  2HO1 A;  2XRY A;  4WWN A;  4OVV A;  4B8A A;  4H7X A;  4HOT A;  3JXC L;  3FUN A;  5FJY A;  3B7U X;  1QNF A;  2V8S E;  3LPZ A;  4I1O B;  4L2L A;  5FT9 A;  3GZ2 A;  4AM9 A;  5CMY A;  3PXP A;  1A17 A;  3FUM A;  3I5P A;  4L23 A;  2NXP A;  2MQK A;  1EPU A;  1UXC A;  1X57 A;  4KT6 B;  5A7D B;  4AY6 A;  1IYG A;  4FN3 A;  4FAD A;  3AS4 A;  2RD0 A;  4HOQ A;  2DCP A;  3FTS A;  3P2B A;  4JXT A;  2BNO A;  3CVQ A;  3L22 A;  3SBS A;  3F52 A;  2Q7F A;  4J6I A;  5DBK A;  1ZPQ A;  4PDX A;  4TRQ A;  5JHA A;  2I1K A;  1IQR A;  3GYZ A;  3OTN A;  3Q49 B;  2Y3A A;  4J0U A;  4ABN A;  3N71 A;  1DWK A;  4JHK A;  4CT4 A;  3ASG A;  2CFU A;  3FWV A;  4EQF A;  2L9B A;  1BDH A;  1HG5 A;  4I6G A;  3OXG A;  3F51 A;  3D9L A;  3FH5 A;  2X6F A;  4YG4 A;  5DIZ A;  3ESL A;  3SHF A;  3D9I A;  2D5V A;  4N3C A;  4J1W A;  3OQN A;  4BTB A;  4X4D A;  5G04 J;  3MEK A;  5EDS A;  4R7L A;  5FTP A;  3TXM A;  1FVF A;  3KAE A;  5FZS A;  3KZ3 A;  3LYA A;  4ILH B;  3EIQ C;  1HE8 A;  4HOR A;  1JFS A;  1E8Y A;  1LCD A;  2KZT A;  2KEK A;  1E8X A;  2WVI A;  1X5B A;  4GYW A;  4Y6W A;  3TJP A;  4AJW A;  5HI7 A;  3UPV A;  3SNX A;  2H8R A;  1Z3X A;  4ACL A;  2O4A A;  2XHE A;  4Y42 A;  2J08 A;  3TGO A;  3U4T A;  4CRW A;  2E0I A;  4EBA G;  3MGB A;  4A1G A;  4IUL A;  4I9E A;  4WUY A;  4URK A;  4IWR A;  2LYL A;  3IHV A;  4F3V A;  3FUD A;  2AXZ A;  5AEN A;  5ARG A;  1ZS4 A;  3G7D A;  4FP7 A;  2JCG A;  2A4Z A;  4XE0 A;  3HZI B;  3APD A;  4HXI A;  4UWF A;  4MCT A;  5FQ8 A;  3BD1 A;  2XCB A;  2GZU A;  2L0I A;  4BT8 A;  1WAO 1;  1OSL A;  3OXF A;  4UI9 C;  3BG0 B;  2Y4U A;  1JPL A;  1E96 B;  2CRO A;  2OR1 L;  3R7R A;  5JJT A;  1Y7Y A;  2IJG X;  2KZT B;  3CHR A;  2AUW A;  4PS7 A;  4JL0 A;  2X38 A;  4DLO A;  3MCX A;  1LMB 3;  4YVQ C;  2FUL A;  4A55 A;  1PRA A;  3IVP A;  1JFT A;  3EHM A;  4UWK A;  1ZZ6 A;  1XGW A;  4FLH A;  4KYO B;  1UN9 A;  3B13 A;  4RG6 A;  3ASF A;  5EX3 A;  4C9B B;  1H0A A;  1H2V C;  1UN8 A;  4F1S A;  4ATG A;  1U3D A;  1RIO A;  2L8N A;  4JCY A;  2OVF A;  2KCL A;  4IN3 B;  4GA0 A;  2WXM A;  3ZYM A;  5G2N A;  3CST A;  4YG7 B;  2A5U A;  3MKQ A;  3SCF A;  3TG5 A;  3VTX A;  4BT9 A;  3SF4 A;  2QFC A;  3ML8 A;  4MLP A;  3CVL A;  1HO8 A;  3C98 A;  4JEH A;  3OAW A;  1PY1 A;  1DVP A;  4XKC A;  4CCA A;  4Z5H A;  3D1N I;  1LLI A;  4U0S A;  2I9C A;  4AEZ C;  5FWQ A;  1TJC A;  1EYH A;  1XNF A;  2C0M A;  1Y8M A;  4NQ0 A;  5D0Q D;  2EBY A;  4APF A;  2YHE A;  3APC A;  3VLE A;  4BY6 A;  5ANR A;  2J4B A;  1HF0 A;  2VSY A;  3TG4 A;  3FTW A;  3R1F A;  3FYA A;  1FCH A;  3CVN A;  3CK8 A;  4U63 A;  1SZ9 A;  4DLQ A;  4N39 A;  5KJM A;  4FBI A;  2XPY A;  3FY4 A;  3D9P A;  2WXK A;  2KEI A;  2PUF A;  2IQC A;  4JW1 A;  4KVM A;  2LCV A;  4CEM A;  2Y4T A;  3QKY A;  1NER A;  2MEZ A;  4Z5C A;  1EFA A;  4BFR A;  4IA8 A;  3RRM B;  3UQ3 A;  1H19 A;  4I8T A;  3QAQ A;  4I6J A;  2WMN A;  2X3M A;  4J8F A;  4V3I A;  4P29 A;  4GAA A;  3BEE A;  4HS2 A;  3RO3 A;  3QJZ A;  2IVB A;  1UJJ A;  2GRM A;  2NSZ A;  3CHS A;  4FA6 A;  3OMT A;  3ASH A;  3QYX A;  3CK9 A;  3MZL B;  2EQX A;  1UW4 B;  3CQC B;  1ZU2 A;  2CHW A;  2EF8 A;  3BDN A;  3UUX A;  2YNQ A;  1DNP A;  4YG1 A;  2JLB A;  2LYJ A;  4NAC A;  1VDY A;  3O48 A;  3OQO A;  2XGM A;  3GZ1 A;  2XEV A;  4I43 A;  4XIF A;  3PUJ A;  1W3B A;  1QQE A;  4MRU A;  2HR2 A;  3FUK A;  3HYM B;  3MA5 A;  2PM7 A;  4QFV A;  5BUZ A;  3ESK A;  3CRO L;  2FBN A;  3FH7 A;  4I1A A;  4I6T A;  3QWP A;  4IRU A;  3LIS A;  5FZR A;  3G2V A;  5LOZ A;  1WH6 A;  1PRU A;  2AXV A;  2BNM A;  3PRZ A;  3JUI A;  3S8Q A;  4AXH A;  5EKQ D;  1IQU A;  3PVL A;  1QPZ A;  4X4C A;  1ZVV A;  2BTD A;  2OOE A;  3U66 A;  5E76 A;  4C0E A;  3FEX A;  2FEZ A;  3KD7 A;  3UT7 A;  1Z6T A;  3RKV A;  1E7V A;  2XPI A;  1RPE L;  1KT0 A;  4F7A A;  1POU A;  2R5S A;  3GZS A;  3LY7 A;  3MJW A;  4GZD A;  4LRZ A;  4OYS A;  3SZ7 A;  3ZYL A;  3RJV A;  4L1B A;  3VLD A;  3CHM A;  3L1P A;  1MHQ A;  3FTU A;  4JVS A;  4YBA A;  2C0L A;  3BS3 A;  3D9J A;  3G2T A;  3CR3 A;  3PNT B;  3T5X A;  3CVV A;  3FU0 A;  4J8E A;  2VYI A;  4A1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...