2GRMA

Crystal structure of prgx/icf10 complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
315
structure length
315
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGCYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVAIENNPIPEIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for control of conjugation by bacterial pheromone and inhibitor peptides.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PrgX
total genus 121
structure length 315
sequence length 315
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2grmA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2grmA02
2IUOA 4I6UA 4IVZA 1ZUGA 3KJXA 1LLIA 1PERL 1L1MA 1Y7YA 1PRUA 3QF3A 3TRBA 1CJGA 1QQBA 1WH6A 2PUDA 2CSFA 4GQMA 1OSLA 4Z58A 4PU4C 3GN5A 3G5GA 1WETA 1QP0A 2AXVA 4YG4A 1DW9A 1B0NA 4YG7B 1QQAA 2PUFA 1X57A 2L8NA 1EFAA 2MEZA 2AUWA 1WIZA 1VPWA 1JFSA 1DWKA 2BNOA 3B7HA 3PXPA 4F8DA 3BD1A 2FJRA 2PIJA 4IA8A 3SCFA 1SQ8A 1WH8A 1BDIA 4I8TA 1UXCA 2GRMA 2XCJA 4FN3A 4X4BA 3JXDL 2KZ8A 3OP9A 2PUAA 1ZVVA 1ZZBA 3HZIB 1PRVA 1QP4A 4Z5CA 2HINA 2O49A 3H5TA 2AXUA 2LYLA 4MCTA 3SCGA 2GZUA 2KEJA 2O4AA 2JCGA 3F52A 2AW6A 1R63A 3BS3A 2A6CA 2EWTA 3FMYA 3RZZA 3JXCL 2KPJA 2PUGA 3GBFA 2IV1A 4JQDA 4J1XA 3QWGA 2LYJA 2ICPA 5K98B 4YBAA 1XWRA 3ZKCA 1RZRD 1ZZ9A 4I6TA 3OQMA 2LYPA 1ZZ8A 2R1JL 2AWIA 2JVLA 1ZPQA 4GHJA 3QQ6A 1LMB3 2IVBA 2L49A 4X4CA 4PU3C 2WUSR 3FYMA 1S7EA 1PNRA 2XIUA 4Z5HA 1GT0C 5A7LA 4X4DA 4J1WA 2OR1L 4JCXA 3VK0A 2XJ3A 1YSEA 2OFYA 3EUSA 4IWRA 1R69A 2IVGA 3S8QA 1RIOA 1JH9A 1JWLA 1AU7A 1CQTA 2PPXA 4I6RA 2IU7A 2ICTA 4PU8A 1ZS4A 2PUEA 2R63A 1NERA 4Z59A 2LYQA 1RZRA 3F51A 2BNNA 2WIUB 3CROL 2PUCA 1PRAA 3JXBC 4Z5DA 2O38A 2LYRA 3IVPA 2AXZA 4YARA 1HF0A 4PU7A 3OQNA 2BNMA 1RPEL 3KXAA 2KEKA 3ZHMA 2LCVA 2PE5A 2EF8A 3G7DA 1NEQA 4FBIA 3FYAA 3D1NI 1LCCA 4O8BA 4X4GA 1QPZA 3R1FA 1LCDA 3OQOA 1O4XA 3KZ3A 2H8RA 1IC8A 1ADRA 1LQCA 4OB4A 3ZHIA 1POUA 3DNVB 2D5VA 2MQKA 4Y42A 1ZZ6A 1QP7A 2IVQA 3QYXA 4MCXA 3LFPA 4X4EA 1BDHA 1UXDA 3GN5B 1X2LA 1OCTC 1Y9QA 2BJCA 2LYSA 3SCHA 2LYKA 3LISA 4YG1A 3L1PA 1ZAYA 2EBYA 1RZSA 2B5AA 4X4IA 2XSDC 3OMTA 3O9XA 4X4FA 1JFTA 3CLCA 4JCYA 1ZZ7A 2CROA 3F6WA 3MLFA 1ZZCA 3UFDA 3U3WA 4X4HA 3CECA 2HSGA 1UTXA 1E3OC 2KEIA 4NDWA 2GRLA 3BDNA 2PUBA 2XI8A
chains in the Genus database with same CATH superfamily
3GZCA 1HH8A 1O1SA 2EIME 4MBGA 1E8ZA 1OSLA 4DI4A 1QP0A 3TELA 1QBQA 2H6HA 1JWFA 1ELWA 3C3RA 3MKQB 4U8HA 1ZVVA 2HM8A 3FUJA 3KAEA 1WG0A 3QKYA 4C0MA 3QWVA 5H7PA 2PXBA 4NQ0A 2ICPA 4YBAA 5DTRA 1XWRA 3CHOA 2NC9A 5ENRD 3BG0B 4TRQA 2A5UA 3QQ6A 2FO1E 2WUSR 3PUJA 3FYMA 5GAHi 4GMRA 3SFXA 5BUZA 1GT0C 3NZLA 3BEEA 3HHMA 4HQDA 5DSXA 2M63A 4EZLA 1AU7A 3MGBA 1HG5A 3FTYA 3PVLA 4OAUC 3CROL 4BWRA 4AOFA 5AAOA 4EHMA 2IO2C 2XXPA 4IN3B 2LXLA 4K5CA 2LCVA 4EKGA 4FBIA 3RRUA 4O60A 4XKBA 1IC8A 2X6KA 2XCBA 2L6JA 1IHGA 4HXIA 5DIZA 1SZAA 5FZQA 4V3IA 4LERA 3CV0A 2CHZA 2F37A 2LNIA 4DLQA 3ZXPA 4BTBA 2MRIA 3TL5A 3B7BA 1N4SA 1E8YA 3SD5A 4CDRA 2KEIA 3Q78A 3FEYA 1UJJA 2DZOA 1PRUA 1QQBA 3TXNA 4YVQC 4U0SA 5ENSD 3FUIA 3UM3A 4ZHBA 2XRZA 4GA0A 3TWRA 2HE0A 2IQCA 4AY6A 2XS8A 3A9XA 2I9CA 3AG1E 3FU3A 1ZZBA 4I2ZA 4LNGA 4EQFA 3S7FA 4EZJA 2Y69E 2V8SE 3F52A 4GTTA 2EILE 4B94A 3CK7A 4N39A 3SBTB 3SFZA 3S7DA 3RO2A 3R7QA 1Z6TA 4GTRA 2H6IA 3QJZA 3E4BA 3ZKJA 2VTBB 3V30A 4WWNA 2PQRA 1PNRA 4DUIA 2YNQA 1TN7A 5AQAA 4P29A 3D9OA 4DJAA 2QZAA 3ASHA 2WXPA 3CVNA 1ZS4A 3ZYKA 4N5CA 3GZ1A 1OY3D 3R9AB 1EDUA 1S64A 5CERB 2IEJA 5JMND 2BTDA 4UWKA 2XPZA 4C48B 4KYOB 3MJWA 3R9MA 4LSZE 4GPKA 5CHEE 3WXXA 4AJWA 5AJLA 4LEUA 4HS2A 1LCCA 2RFAA 5LFAA 2DBAA 4E6HA 4BTAA 5CBOA 2PXFA 4X4EA 2Y3AA 4HOUA 4U95D 1Y9QA 3DSWA 3KL4A 5ENPD 3SCHA 3FH7A 1UN8A 1ZBPA 3OMTA 1JFTA 3HYMB 5T3RA 4UQZA 1PERL 4YNDA 3AS4A 4N3AA 1OCCE 3QF3A 1JUQA 5G04C 1HF8A 4L2YA 1WETA 1E96B 1WY6A 5EKQD 5E75A 1PC2A 2NYJA 3JYSA 3OP9A 1SA4A 2WQ6A 3ZVVA 4X8QA 3CLJA 1R63A 3RZZA 5FTPA 3ZUVB 3MEJA 4A1SA 2R5SA 1HE8A 2WXQA 3OTNA 3HXFA 4FA6A 1ZPQA 1LMB3 3NBNB 4PU3C 2DIWA 3A9YA 4CDMA 3ABKE 3NF1A 1H6OA 2P9SG 2KM4A 4XZ4A 3RRNB 4BY6A 3Q7FA 2WXRA 2IFUA 4J6IA 4UI9J 3FUKA 2WIUB 3CHMA 4I1AA 3TWUA 4BFRA 1TN8A 1RPEL 3SGHA 3ONLA 3ZHMA 4XKCA 3DM5A 1FVHA 5ANLA 3OQOA 2V5FA 2KCVA 4OB4A 3K9IA 1S63A 2MQKA 3UX4A 3B13A 4KT6B 2L6BA 3G0TA 4PS8A 3JXJA 2VGXB 4ACLA 1N4QA 3IHVA 5AYWD 3L1PA 1ZAYA 3ML8A 1KZOA 3MZLB 1BD8A 4N2SA 2CFUA 1K1AA 3KEAA 3KEZA 3ZPJA 3VTXA 4FHJA 2ETBA 2XI8A 4IVZA 1LLIA 3TWQA 4Y6CA 1CJGA 3ZN3A 3Q49B 1WH6A 4XI9A 1E7UA 2VJ8A 2GROB 3HVEA 5BV1A 3I5PA 2AXVA 1DW9A 1EFAA 4F8DA 2FJRA 3SCFA 3QB2A 4DE8A 3EIQC 4AY5A 3NDBB 3E34A 1TEZA 2KATA 5FQ7A 2HYZA 1OWPA 3L13A 1WDYA 1V55E 2R1JL 2DCPA 3E37A 4ILHB 4U0ZA 2FBNA 2L49A 2ETCA 2BKGA 2WXMA 2ZGDA 3CVLA 2KC7A 1H19A 2O4AA 3IXEA 3Q5MA 2ICTA 4JHKA 4BT8A 4UUCA 2XCCA 3FH8A 2X6FA 4Q69A 2XS1A 2IF4A 1K8KG 3EDTB 1SW6A 3S7BA 3PZ3A 3LS8A 2WXKA 1NEQA 3FEXA 3G2TA 3FYAA 4BX9A 5A6CA 4NIKA 3EUVA 2IY0C 2L0TB 4Y42A 3LYAA 4KXKB 3M9LA 2UY1B 3KSQA 4MCXA 4ACKA 2QC9A 5BV0A 2ETAA 1O5MA 5D0OD 4WVLA 3PRZA 3SFYA 2J7WA 3FTVA 1V54E 3MLFA 4JZYA 4NDWA 2J9QA 1IHBA 4MRUA 1FPPA 4ANWA 5BT1A 4XEIG 3EJNA 3G5GA 2WQHA 4YG7B 3HXEA 3FFLA 3Q15A 3PXPA 3CR3A 3WG7E 1WH8A 4FN3A 3J5PA 2OOEA 3PDNA 2PUAA 5EILA 2WXLA 5DRYA 4TXRA 2B6CA 5BXOA 2HINA 2O49A 3G2VA 4MKTA 4MCTA 3UINC 2ZISA 2LO6A 5KNHD 3AG2E 3T8MA 4EBAA 2EWTA 3DSVA 1BI8B 4TXQA 2PXUA 2GRPB 3JXIA 3LY7A 3UXGA 2WB2A 1AP7A 4JA9A 1Z3XA 1HFAA 4FULA 4U04A 2IO3C 3LEWA 4LCTA 4OAVB 1SA5A 2XENA 5A7LA 3S2AA 1G3NB 1FVFA 2FI7A 1NW3A 2XEHA 4I2WA 3SHFA 2IVGA 4GZ6A 1TJFA 3RIBA 4GCOA 5FJYA 4GZ3A 2LYQA 1YMPA 3BG1B 5JJTA 3ASFA 4BEPA 1MX4A 3UWPA 2RD0A 4FLHA 4HI8A 4UI9K 4DE9A 4XX5A 3APFA 5LOZA 4KVMA 1QPZA 3PZ4A 5T8IA 1ADRA 4WUYA 2OVFA 1QNFA 2PL2A 4U0UA 1BDHA 4HBDA 4I9EA 3AS5A 3Q7AA 3U66A 2BJCA 2YBDA 3DBSA 3GYZA 5D2MC 1NFIE 3TWXA 1DCQA 3ASOE 3C5RA 4O1OA 1IXVA 2A4ZA 1AWCB 1HU3A 4JHRA 3APCA 3UPVA 3TXMA 5J08A 3ESKA 4LRZA 1Y7YA 3L08A 1U2VG 1E8WA 2A5EA 4JXTA 2BUGA 3MEKA 4GTOA 3CKBA 2PUFA 3JQ0A 3TEPA 2VSYA 2AUWA 2OVBA 1E8XA 2WXIA 4HOQA 1K1BA 2PIJA 2QYJA 3D9KA 4D10C 3U4TA 3H5TA 3ISMC 5CRUA 4XI0A 2MXDA 3PE5A 5K98B 1ZZ9A 3OQMA 1KPSB 1S0PA 5BW8C 4A3TA 1YCSB 3CVPA 2HO1A 4X4DA 4BERA 5B3SE 3S7JA 1YSEA 3Q9UC 5ENNA 4PUCA 4GTMA 4GYOA 5FINA 1NERA 3CK9A 4KVOA 3IVPA 1HS6A 3KXAA 5KJLA 5G04J 3NZUA 1ZB1A 1UJKA 2OEVA 2J49A 2WMOA 1YA0A 1O1RA 2AJAA 5FZRA 5AQ9A 2WQ7A 1UXDA 4HRNA 3KD7A 5KJKA 3RU0A 3PE4A 4UQYA 3FUMA 2VYIA 4F6RD 3R09A 4BESA 2HFZA 3O9XA 1E90A 1XGWA 3TJPA 3SY2A 3B7SA 4FJYA 4Y6WA 4X4HA 3NROA 2UWJG 3V31A 3A9ZA 2FULA 3EHQA 3FHEA 5KJMA 2HR2A 1TJCA 1HG2A 3APDA 3LJ3A 2J08A 2HCSA 2IU1A 3W9FA 5T4YA 2XXQA 1SQ8A 2GRMA 1NA0A 3C72A 4DI3A 5AENA 2J8SD 4JC8A 1EF1C 2Y4TA 4B8CB 3MX3A 2IOSA 4WWPA 1IKND 5KNGA 2EINE 3JXCL 5HS0A 2PUGA 4ILGA 3MA5A 2LYPA 4DX2A 3ME5A 3FDHA 3FTWA 3CVYA 2PXDA 2I2OA 2WMNA 1P5QA 3Q79A 4A63B 4UQXA 3ML9A 3IEGA 3UT4A 3CVVA 4WAFA 2R2LA 2ZIRA 3EUSA 5EDSA 1JH9A 4QQIA 2EIKE 3URZA 3Q73A 1RZRA 2J4BA 2BNNA 5FZSA 1PRAA 3L9TA 3JXBC 3ONKA 2C0LA 3IBEA 5CCMA 3DSSA 2J7UA 4AVXA 5ENTD 3UQ3A 3JCKC 4O8BA 4DRXE 2V4HC 1O4XA 5CEDB 3T9KA 3MV3B 3ZHEB 2J4DA 3LFPA 5E76A 3UKUG 3PREA 3GN5B 4JL0A 3ZHEA 3HIZA 4B0ZA 5DTQA 3X2QE 5AARA 4X4FA 1UN9A 2OCCE 2HSGA 1UTXA 3UIPC 3KS2A 2IUOA 1A5EA 3VWSA 2DZNA 3EHNA 2GRQB 1ELRA 5KWDA 2WPVA 1B0NA 2JQEA 1VPWA 4HFGA 1DNPA 4AV7A 3AU5A 3JXDL 5GAGi 4EK9A 4Z5CA 4L9PA 3ASNE 1H2VC 2WXFA 2X6HA 4OBMA 2LYJA 1BPOA 4E85A 3B7TA 3FTXA 3E32A 2R05A 4DK5A 2GRRB 2JVLA 4F3VA 3G2UA 2AVPA 2RKKA 2IVBA 2XHEA 1X5BA 4BT9A 1JCRA 4JCXA 2ODRD 3ABLE 3QOUA 5ARFA 2OFYA 4EPZA 3B7UX 3T5VA 3HVEB 3DEPA 1K3ZD 2E2EA 2KCKA 3OXFA 4U8VD 2C0MA 4I6GA 5J90A 4HRLA 3G7DA 4G26A 3ZXSA 4B89A 5IY5E 4FLBA 3GZ2A 5HKPA 3FUDA 2H8RA 3DXMG 1ZZ6A 3CHSA 4JW1A 3ZRHA 1QZ2A 1TNOA 3ASGA 3DRAA 4GTVA 3SQVA 2I1JA 2LYKA 3ENEA 3ZPXA 4BETA 1N0RA 3CLCA 2CROA 4DX6D 3GZDA 2DVWA 3BDNA 1X81A 1SQMA 2XPYA 4OVUA 3EU9A 2P9PG 4AM9A 4XIFA 3CVUA 4CGWA 4GZCA 4M7CA 4UWLA 2P58C 3P1UA 3RAUA 1WAO1 4GA2A 2L8NA 1JFSA 2PNNA 3CKCA 4O6FA 2QYUA 5D0QD 4G8LA 3LCAA 4OVVA 4WNDA 4ER0A 1HXIA 2LUHA 1KZPA 3PZ2A 3AG3E 2LYLA 2GZUA 2XGOA 1TN6A 3QWGA 4KBQA 2BKKB 3ZYMA 3L22A 1SZ9A 5DRTA 3ZEFA 3EHMA 1D9SA 1ZZ8A 1D8DA 4N3BA 4M3OA 5AN8A 3UKRG 2JLBA 2X6IA 3UI2A 4U63A 2WXJA 4MLPA 1NI1A 3AAAC 3SR4A 3EU5A 5G05J 1TYQG 5AIJA 1JWGA 4J8SA 4N2QA 1UW4B 3V2XA 2PXTA 1QQEA 3L6AA 3OAWA 2O38A 3PEVB 4YARA 2KEKA 4YDEA 3CSTA 1OCOE 3D1NI 4J0UA 1MX2A 1OWLA 1HZ4A 3ABME 4GYYA 4N3CA 3SBSA 3V79K 3VLEA 4RG9A 3AU4A 4A55A 2X6JA 3CEQA 2MOWA 4AP2A 4ATGA 4ER7A 2L9BA 1H2UA 2VQ2A 1ZZ7A 3SI5A 4APOA 2WXGA 2ILRA 4RQIA 4LNUD 2YHEA 4JD2G 4W9RA 5CRVA 2PUDA 2CSFA 3GN5A 2PXPA 1UG3A 4N5QA 4MS6A 3D9PA 2OV8A 1JPLA 3LVQE 2XCJA 1HO8A 4LG6A 1MHQA 5ANRA 2JABA 3FUHA 3DSUA 2AW6A 4KZCA 3ASDA 2LXMA 1XNFA 1Z3YA 1BI7B 2FFHA 3TG4A 4CGVA 4I6TA 2E0IA 3D9JA 2KZTA 4JA7A 4ANVA 4X4CA 3ZYLA 3GUUA 4CT0A 2YQ8A 2VSNA 3MKRA 2OR1L 3TAXA 3QK0A 3VK0A 2XJ3A 5CEAA 2I1KA 2PXKA 4NRHB 4I6RA 2PUEA 2YINA 2Q7FA 4HOTA 4Z59A 3F51A 5DBKA 1U3DA 1KT1A 3ZNGA 1FCHA 3HXBA 4EQZA 3CQCB 4YDOA 2AXZA 1HF0A 1MZCA 1UOHA 4PH4B 3CIAA 4G23A 3SNXA 4R7LA 3UM0A 5JHBA 2YHCA 4X4GA 4I1OB 3LVRE 1LCDA 3KZ3A 4TUMA 3Q4AB 1LQCA 3RK6A 3NB2A 5CBNA 4C9BB 2IVQA 4UWFA 4WWOA 1MJ0A 1X2LA 3NXHA 5LCWC 4LUNU 4ME2A 3FY4A 3PUKA 4X4IA 2LSVA 1TNZA 3SZ7A 5FT9A 4DX1A 1H2TC 3GZDC 3VTYA 3NOGD 2WXHA 4WNEA 2L1PA 3KJXA 2P9NG 3ZYQA 3T8KA 4URKA 3UT8A 4J8YA 3EIJA 2XRYA 1KT0A 1QQAA 4CDNA 3BD1A 2IONA 4GCNA 4LNBA 1KLXA 2KZ8A 3F6QA 2BF0X 1QP4A 4Q96A 3SCGA 2GGFA 3CGHA 4YVOA 1NZNA 4G11A 3ZU7B 2WXOA 5ARGA 3AG4E 3GW4A 3CVQA 3ZKCA 3C3OA 1IQUA 3LXUX 4H7XA 1N94A 3MKQA 2P2CP 5FQ6A 1BLXB 5C2YA 1JWLA 2PPXA 3FU5A 1QB2A 1Q2ZA 3B95A 4G2VA 3PZ1A 5C1DA 3CK8A 3HXDA 3CHQA 3TG5A 4GB9A 1N4PA 4CYMD 2CHXA 3PE3A 2IJGX 2GW1A 1U2ZA 3R1FA 3UMVA 4AXHA 3ESLA 2D5VA 1MYOA 2DYRE 4RLYA 2CHWA 5ENQD 4C0EA 5AQ7A 4B8AA 4HVBA 3L16A 3LISA 2B5AA 3DPYA 1OUVA 5JHAA 2XSDC 2HCNA 4I6EA 3BU8A 4BSZB 4GZ5A 4GU5A 3L54A 3G2SA 2H6GA 2V3CC 2MYOA 3QC1A 2FF4A 3FUFA 1NL4A 2NXPA 1L1MA 2F8YA 1RW2A 3QWPA 2Y4UA 4UI9C 3VLDA 4YG4A 2V4LA 1LD8A 1TR4A 4GMLA 2KXPC 4ER6A 1E7VA 3B7RL 1WIZA 5EYLA 4CEMA 2FEZA 2L0IA 2NSZA 3ULEG 4L2LA 1BDIA 3E33A 1UXCA 4I9CA 2R59A 3C98A 1N95A 2V5QC 1SVXA 3FMYA 3P2BA 4GTQA 2KPJA 4JQDA 4HI9A 2B0OE 4CCAA 1INZA 5B1AE 3D9HA 3Q9NC 1H6PA 4FC8A 3OXLA 4CRWA 4GHJA 3TWTA 4HRAA 4GTPA 2XIUA 1WM5A 5G55A 3FUEA 4APFA 3NOCD 4GA1A 3RRMB 3LKUA 3Q47B 4ER3A 4IWRA 1R69A 3S8QA 3EHRA 4EZIA 4ER5A 3PNLB 4XE0A 4OYSA 5G05C 1N11A 1LTXA 3RSEG 4JB8P 1PAQA 4FJZA 4PDXA 4PU7A 4G25A 4A3VA 3FTUA 1D8EA 2EF8A 3QAQA 4WNGA 5ITZF 3FULA 4JVSA 2M4HA 1RZ4A 5KCMA 2R03A 1POUA 4QFVA 2R02A 3O48A 3LY8A 4B93B 2LSUA 2XPIA 1GW6A 4HOSA 3IV0A 2RG8A 1QYMA 3LJNA 1N0QA 3RJVA 5KJNA 1Y8MA 4IULA 3DXKG 2LAIA 2PM6A 3D9LA 3VLFA 2H6FA 1ZZCA 3LPZA 3SF4A 1N4RA 5HI7A 2PUBA 3U64A 3NAWA 4I6UA 2LNMA 5LP0A 3PEUB 4ZFHA 3C3QA 4YDWA 4RVBA 4PU4C 4RG6A 3TWWA 1W3BA 1NP7A 5EYPF 1DWKA 2BNOA 1LF8A 4J7WA 4IA8A 3UIOC 4GTSA 4DLOA 4HLEA 2ZGGA 4NACA 3HRAA 1Z5SC 3MV2B 2AXUA 5JJ7A 1DC2A 3MYVA 2DYSE 4KMOA 3R7RA 1NA3A 4UWHA 5EN5D 3KSLA 1YYHA 5JA4D 5HRYA 3ZIMA 5FQ8A 2DWZA 4ABNA 5EIDA 2VSXE 2XXAA 4I1MA 2OEWA 1CQTA 4PU8A 1TNUA 2R63A 4AIFA 2KZTB 3FP3A 3RKVA 3OQNA 2PXQA 2J09A 5FIOA 2PE5A 1MFQC 2I6HA 5CECB 3GZSA 2ONDA 2QY7A 3ZHIA 4TV3A 2VSOE 3MCXA 3RO3A 3QYXA 3PZDA 3QNKA 4L7TA 2LAHA 4RSYA 1ELKA 1OCZE 2KBXA 1N54A 2XZTG 3FU6A 5EX0A 2XGMA 3QOXA 2JEKA 3D9MA 1TNYA 3W9GA 4U8YD 2R17C 3DWLG 3LY9A 4YDYA 3CSFA 4K03A 5EIBE 1OT8A 3PNTB 3V2OA 3E30A 1MX6A 3FH5A 5CCLA 4I43A 2EIJE 2MEZA 3CQGB 4TUUA 4I8TA 3FTSA 5KBAA 3HXCA 3NZSA 3Q75A 1L5JA 3QWWA 4FADA 3ZW3A 3N71A 1PY1A 3BQOA 2JCGA 3OKZA 2J07A 4I17A 2ZU6B 3HG0D 3J5QB 3QDNA 5HQ8A 4J1XA 4K5AB 2BEDA 1RZRD 1OXJA 3DPDA 4FP7A 4A1GA 4TXPA 4Z5HA 4HB5A 1HX8A 3TWVA 2GRNB 3UM2A 1DVPA 4K5BA 1RIOA 1LD7A 4Q94A 2XEVA 2RFMA 3UT7A 4J8EA 4G1TA 4CZ2D 1OCRE 1B89A 3AS8A 4HRMB 4WNFA 2LYRA 3ZGQA 1MQSA 2PXLA 1EPUA 1H0AA 1DULA 5A7DB 4EZKA 3DSTA 2P9KG 4F7AA 4ATZD 2MHKA 2WVIA 1OCTC 4G24A 4L1BA 4HLLA 1BU9A 3CVXA 5BXUA 5LX8A 5LCWJ 3I3NA 4NURA 4YG1A 4EBAG 3AJIA 2Y0BG 4JCYA 3QOWA 3PH0C 3U3WA 5A23A 3CHPA 4BX8A 3OXGA 2VGXA 4U7EB 3TRBA 4KZ0A 4Q2JA 1N9AA 3LDZA 5JUWA 3L82A 5DT2A 2PXVA 1X57A 2XZDG 3QFIA 1HQ1A 1EYHA 4EKIA 3U9WA 3PS6A 2WM9A 2C2LA 3UTMA 2XEEA 4IYPA 4FU3A 3HZIB 2IOLA 1PRVA 3UM1A 1FT1A 1TNBA 3GBFA 3CHRA 3FU0A 1O1TA 1DCEA 2VGEA 3UUXA 4ANXA 4JEHA 2PZIA 2QFCA 3DEOA 3QARA 5BNWA 3IKOB 4U96D 4J1WA 3FWVA 4DPRA 4K0RA 4ILIA 5M72A 3TFLA 4CT4A 4F53A 3I4RB 4FHKA 2IU7A 5BPPA 5DTMA 3JQ1A 4JHJA 1FT2A 2VTBA 2PUCA 5AJDA 1QZXA 2CFZA 4J8DA 3ULQA 2BNMA 4L23A 3TGOA 2X3MA 5JJ6A 1JCSA 2LLVA 3DNVB 3FTZA 1QP7A 4GPMA 4EECA 2EQXA 4U07A 4HORA 2KCLA 4PS3A 2ZXWE 4GZDA 5G2NA 1RZSA 3ULYA 3HDXA 3F6WA 1Y6IA 2CG2A 2LLWA 2PXEA 4DX7D 1JCQA 4F1SA 1ZUGA 5EX3A 1ZU2A 4GQMA 4Z58A 2P9IG 5FWQA 1IQRA 3B7HA 5CMWA 5ENOD 2VEOA 3BUAA 2VGYA 1N52A 4X4BA 5B1BE 1S70B 3JUIA 3SX0A 1OWMA 2P9UG 4Z68A 2KEJA 3JUEA 1OWNA 1A17A 3BS3A 2A6CA 2F0YA 1VDYA 2XQ0A 2IV1A 2P9LG 3OWQA 2PQNA 2UY1A 4J8FA 3FUNA 4AEZC 2AWIA 4DX5D 1S7EA 4ANUA 2PM7A 2F8XK 3D9NA 4PS7A 2V0PA 4I6JA 4F1PA 4JPSA 4IRUA 1IYGA 3IHYA 4GAAA 4JEUA 3L17A 5FQ4A 2WXNA 4H7YA 5D66A 4Z5DA 4GMJA 2X38A 3D9IA 3TWSA 3D3MA 4HNAD 2CG3A 3LQXA 4BSXA 1OWOA 3CVWA 4UWGA 2XGSA 1H6KA 4O1PA 3O4ZA 4G8KA 3ZFWA 2FO7A 3NQPA 3G2WA 3I4GA 2LYSA 2EBYA 1U3CA 5AQBA 3UFDA 3SO8A 3CECA 4GYWA 1E3OC 2GRLA 3DSXA 2Y1LE 3T5XA 5CMYA
chains in the Genus database with same CATH topology
4ANWA 4I6UA 4AM9A 4XIFA 5BT1A 1HH8A 5LP0A 3CVUA 1E8ZA 4CGWA 3PEUB 4RVBA 1OSLA 3EJNA 4DI4A 4PU4C 4GZCA 3G5GA 4UWLA 2P58C 3P1UA 1QP0A 4RG6A 2WQHA 4YG7B 1WAO1 4GA2A 2L8NA 1W3BA 3FFLA 3Q15A 1NP7A 1JFSA 1DWKA 2BNOA 3PXPA 3CR3A 1JWFA 1LF8A 3CKCA 4O6FA 4IA8A 1ELWA 5D0QD 1WH8A 3LCAA 4OVVA 4DLOA 4FN3A 3MKQB 4WNDA 4HLEA 2OOEA 1HXIA 3PDNA 2PUAA 4NACA 1ZVVA 2WXLA 4U8HA 2HM8A 3FUJA 3MV2B 3KAEA 2HINA 2O49A 3G2VA 2AXUA 2LYLA 4MCTA 3QKYA 3QWVA 2GZUA 4MKTA 2LO6A 4C0MA 5JJ7A 3T8MA 4EBAA 2EWTA 4NQ0A 3MYVA 2XGOA 4KMOA 3QWGA 3LY7A 4KBQA 2ICPA 3R7RA 4YBAA 1XWRA 3ZYMA 3L22A 1SZ9A 3CHOA 3ZEFA 1NA3A 2NC9A 3EHMA 1ZZ8A 4JA9A 1Z3XA 4UWHA 3BG0B 1HFAA 4N3BA 4FULA 4M3OA 4TRQA 2A5UA 2JLBA 2X6IA 3QQ6A 4U04A 3LEWA 4LCTA 2WUSR 3PUJA 3FYMA 4U63A 3ZIMA 5BUZA 1GT0C 5A7LA 2WXJA 4MLPA 3S2AA 5FQ8A 3BEEA 4ABNA 3HHMA 1FVFA 2M63A 5CMYA 2FI7A 5G05J 2VSXE 4I2WA 4I1MA 3SHFA 2IVGA 4EZLA 5AIJA 1JWGA 1AU7A 1TJFA 1CQTA 4PU8A 3MGBA 4GZ6A 4J8SA 4GCOA 1HG5A 3RIBA 1UW4B 4N2QA 2R63A 3FTYA 3PVLA 5FJYA 4GZ3A 4AIFA 2LYQA 1QQEA 2KZTB 3L6AA 3BG1B 3OAWA 3CROL 5JJTA 4BWRA 3ASFA 4AOFA 3FP3A 2O38A 3PEVB 4IN3B 4YARA 3RKVA 3OQNA 2RD0A 2J09A 4FLHA 2KEKA 3CSTA 4UI9K 2LCVA 4XX5A 2PE5A 3APFA 2I6HA 4FBIA 5LOZA 3D1NI 4KVMA 3RRUA 3GZSA 1QPZA 4J0UA 2ONDA 1OWLA 2QY7A 5T8IA 1HZ4A 1IC8A 2X6KA 1ADRA 4GYYA 4N3CA 2OVFA 4WUYA 3ZHIA 1QNFA 2XCBA 3SBSA 3VLEA 2PL2A 4TV3A 2L6JA 1IHGA 2VSOE 3AU4A 3MCXA 4HXIA 4RG9A 4U0UA 3RO3A 4A55A 3QYXA 1BDHA 3PZDA 3QNKA 5DIZA 1SZAA 2X6JA 3AS5A 4I9EA 2LAHA 4L7TA 3CV0A 4LERA 4RSYA 3CEQA 4V3IA 2CHZA 3U66A 3U64A 1ELKA 2LNIA 4DLQA 2BJCA 3DBSA 2MOWA 3GYZA 1N54A 3FU6A 5EX0A 4BTBA 2XGMA 2MRIA 4AP2A 4ATGA 2JEKA 3D9MA 2L9BA 1H2UA 2VQ2A 1ZZ7A 3SI5A 3TL5A 4APOA 2WXGA 2ILRA 2R17C 1E8YA 3LY9A 3SD5A 4CDRA 2A4ZA 2KEIA 2YHEA 1HU3A 3CSFA 4JHRA 3APCA 3UPVA 3TXMA 3FEYA 5J08A 1UJJA 4K03A 3ESKA 4LRZA 3PNTB 1Y7YA 3L08A 1PRUA 4W9RA 1QQBA 4MRUA 2PUDA 2CSFA 3TXNA 4YVQC 3GN5A 1E8WA 4U0SA 4JXTA 2BUGA 1UG3A 3FH5A 3FUIA 3MEKA 4MS6A 5CCLA 2OV8A 2PUFA 3CKBA 1JPLA 3D9PA 2VSYA 3JQ0A 2MEZA 2AUWA 2OVBA 4I43A 2XRZA 1E8XA 2WXIA 4HOQA 4GA0A 2IQCA 2PIJA 3LVQE 4AY6A 3CQGB 4TUUA 4I8TA 2XCJA 2I9CA 3FTSA 3NZSA 3D9KA 1HO8A 3FU3A 1ZZBA 1L5JA 4I2ZA 4D10C 3U4TA 4EQFA 3QWWA 4FADA 1MHQA 3H5TA 3ZW3A 3N71A 1PY1A 3S7FA 5ANRA 4EZJA 2V8SE 3FUHA 2JCGA 3F52A 2AW6A 4KZCA 2J07A 3ASDA 4I17A 2ZU6B 3CK7A 4B94A 4N39A 3SBTB 3QDNA 4XI0A 4J1XA 3S7DA 1XNFA 3SFZA 5HQ8A 1Z3YA 5K98B 1RZRD 3RO2A 3R7QA 1Z6TA 1ZZ9A 3TG4A 4I6TA 3OQMA 4CGVA 2E0IA 3D9JA 1S0PA 3QJZA 5BW8C 3E4BA 3DPDA 4FP7A 2VTBB 4A3TA 4WWNA 2KZTA 4JA7A 4A1GA 2PQRA 4X4CA 3ZYLA 4ANVA 3CVPA 2HO1A 1PNRA 4Z5HA 4CT0A 2YQ8A 4X4DA 2VSNA 3MKRA 2OR1L 3TAXA 2YNQA 3QK0A 3VK0A 1HX8A 2XJ3A 3S7JA 1YSEA 4P29A 3D9OA 4DJAA 1DVPA 5ENNA 1RIOA 3ASHA 2WXPA 4NRHB 4PUCA 2XEVA 4I6RA 1ZS4A 2PUEA 2YINA 3CVNA 4Q94A 3UT7A 2Q7FA 4N5CA 3ZYKA 4GYOA 4J8EA 3GZ1A 1NERA 4G1TA 4HOTA 3R9AB 4Z59A 3F51A 1EDUA 1B89A 1U3DA 1KT1A 3AS8A 5DBKA 3CK9A 1FCHA 2BTDA 4KVOA 2XPZA 4UWKA 4WNFA 2LYRA 3CQCB 3IVPA 2AXZA 3MJWA 1HF0A 4KYOB 3ZGQA 1MQSA 4PH4B 1HS6A 3KXAA 3CIAA 5KJLA 4G23A 3NZUA 4R7LA 1EPUA 5G04J 3SNXA 5CHEE 3WXXA 4GPKA 4AJWA 5AJLA 4LEUA 2YHCA 4HS2A 5JHBA 1LCCA 4X4GA 1H0AA 1UJKA 1LCDA 3LVRE 4I1OB 3KZ3A 2J49A 2WMOA 5LFAA 3Q4AB 1LQCA 5A7DB 3RK6A 4EZKA 1YA0A 2DBAA 5FZRA 4E6HA 4F7AA 2WQ7A 4BTAA 4C9BB 2IVQA 4UWFA 4X4EA 4WWOA 1UXDA 2MHKA 2Y3AA 3KD7A 2WVIA 5KJKA 4HOUA 1X2LA 1OCTC 4G24A 4L1BA 3RU0A 3CVXA 1Y9QA 5LX8A 3PE4A 4UQYA 5LCWC 3FUMA 3SCHA 2VYIA 3I3NA 4LUNU 5LCWJ 4NURA 3FH7A 4ME2A 4YG1A 3FY4A 4EBAG 1UN8A 1ZBPA 3PUKA 4X4IA 2LSVA 3OMTA 3O9XA 1JFTA 1E90A 1XGWA 3HYMB 4JCYA 5FT9A 3SZ7A 3TJPA 1H2TC 3PH0C 3U3WA 3B7SA 4FJYA 4Y6WA 4X4HA 5T3RA 5A23A 3CHPA 3VTYA 4UQZA 4BX8A 2UWJG 2WXHA 3OXGA 1PERL 3KJXA 2VGXA 3AS4A 4WNEA 4YNDA 4N3AA 3ZYQA 3QF3A 3TRBA 1JUQA 5G04C 1HF8A 2FULA 4KZ0A 4L2YA 4URKA 3UT8A 3EIJA 3LDZA 3FHEA 1WETA 2XRYA 5KJMA 1E96B 1KT0A 1QQAA 1WY6A 2HR2A 1TJCA 1X57A 1HG2A 5EKQD 3APDA 5E75A 3LJ3A 4CDNA 2J08A 1PC2A 1EYHA 2IU1A 3U9WA 3BD1A 2IONA 3JYSA 3PS6A 5T4YA 2WM9A 1SQ8A 4GCNA 2C2LA 2GRMA 1KLXA 1NA0A 2KZ8A 3OP9A 4IYPA 4DI3A 5AENA 4FU3A 3HZIB 2BF0X 2IOLA 1PRVA 1QP4A 2WQ6A 3ZVVA 4JC8A 4Q96A 3SCGA 1EF1C 2GGFA 2Y4TA 3CGHA 4YVOA 3MX3A 4B8CB 2IOSA 3CLJA 4WWPA 1NZNA 4G11A 1R63A 2WXOA 3RZZA 5ARGA 5FTPA 3GW4A 3JXCL 2PUGA 3GBFA 3CHRA 3FU0A 4A1SA 2R5SA 3CVQA 4ILGA 3ZKCA 1HE8A 1IQUA 3MA5A 2LYPA 3LXUX 4H7XA 2WXQA 3OTNA 3FDHA 3FTWA 3CVYA 4FA6A 1ZPQA 3UUXA 4ANXA 4JEHA 1LMB3 2PZIA 2QFCA 3QARA 2I2OA 2WB2A 4PU3C 5BNWA 2DIWA 2WMNA 3IKOB 4CDMA 1P5QA 3MKQA 4J1WA 3FWVA 3NF1A 4UQXA 4BSXA 3ML9A 3IEGA 3UT4A 4DPRA 3CVVA 5FQ6A 4WAFA 4K0RA 2KM4A 4XZ4A 4ILIA 5M72A 3EUSA 3RRNB 5C2YA 4BY6A 4CT4A 4F53A 5EDSA 1JH9A 2WXRA 1JWLA 3I4RB 4FHKA 2PPXA 2IU7A 2IFUA 3FU5A 3URZA 5BPPA 4J6IA 4UI9J 1RZRA 3FUKA 2J4BA 3JQ1A 2BNNA 4JHJA 2WIUB 4G2VA 5FZSA 3CHMA 2VTBA 2PUCA 4I1AA 1PRAA 4BFRA 3JXBC 5AJDA 5C1DA 3CK8A 3ONKA 2CFZA 3CHQA 1RPEL 2C0LA 2BNMA 3IBEA 4J8DA 3SGHA 3ONLA 3ULQA 3ZHMA 3TG5A 5CCMA 4L23A 4GB9A 4XKCA 4AVXA 4XKBA 3TGOA 1FVHA 2CHXA 3PE3A 3JCKC 5ANLA 3UQ3A 2IJGX 2GW1A 4O8BA 2X3MA 3R1FA 3OQOA 1O4XA 2V5FA 3UMVA 4AXHA 5JJ6A 2KCVA 3ESLA 4OB4A 2D5VA 3DNVB 3K9IA 3MV3B 2MQKA 2CHWA 3FTZA 1QP7A 3UX4A 3ZHEB 4EECA 3B13A 4KT6B 2J4DA 3LFPA 5E76A 2EQXA 3PREA 4C0EA 4B8AA 3GN5B 4PS8A 4U07A 4JL0A 4HORA 4HVBA 2VGXB 4ACLA 3ZHEA 3L16A 3IHVA 3HIZA 4B0ZA 2KCLA 3LISA 3L1PA 4PS3A 1ZAYA 4GZDA 5AYWD 1RZSA 2B5AA 3ML8A 1OUVA 5G2NA 5JHAA 3MZLB 3HDXA 2XSDC 4X4FA 4I6EA 1UN9A 4N2SA 2CFUA 3F6WA 4GZ5A 4GU5A 3L54A 3G2SA 1Y6IA 2HSGA 1UTXA 3KEZA 3ZPJA 2CG2A 3VTXA 3KS2A 4F1SA 4FHJA 3QC1A 2XI8A 2IUOA 2FF4A 4IVZA 1ZUGA 3FUFA 1LLIA 2NXPA 1L1MA 3EHNA 4Y6CA 1CJGA 3ZN3A 3Q49B 1WH6A 1ELRA 3QWPA 5EX3A 2Y4UA 1ZU2A 4XI9A 1E7UA 2VJ8A 4GQMA 4UI9C 4Z58A 2WPVA 3HVEA 3VLDA 3I5PA 5BV1A 2AXVA 4YG4A 1DW9A 1B0NA 2V4LA 4GMLA 5FWQA 3B7RL 1EFAA 1E7VA 1IQRA 1VPWA 1WIZA 4CEMA 4HFGA 1DNPA 3B7HA 2FEZA 2L0IA 4AV7A 3AU5A 5CMWA 4F8DA 2NSZA 2FJRA 1BDIA 2VGYA 3SCFA 3QB2A 4L2LA 1N52A 1UXCA 4X4BA 3JXDL 4I9CA 3EIQC 4AY5A 3JUIA 2R59A 3C98A 1OWMA 1TEZA 4Z5CA 2KATA 2KEJA 1OWNA 1H2VC 2WXFA 1A17A 3BS3A 2A6CA 3FMYA 5FQ7A 3P2BA 2X6HA 1VDYA 2KPJA 4JQDA 2XQ0A 2IV1A 2LYJA 1BPOA 2HYZA 4E85A 2PQNA 2UY1A 3B7TA 4CCAA 3FTXA 1OWPA 1INZA 4J8FA 3FUNA 3L13A 2R1JL 2DCPA 4FC8A 4AEZC 2AWIA 3OXLA 2JVLA 4CRWA 4DK5A 4GHJA 4F3VA 4ILHB 3G2UA 2AVPA 4U0ZA 2IVBA 2FBNA 2L49A 2XHEA 1S7EA 2XIUA 4ANUA 1WM5A 1X5BA 2PM7A 5G55A 2WXMA 3FUEA 4BT9A 3CVLA 4JCXA 4APFA 3D9NA 3QOUA 2KC7A 4GA1A 5ARFA 1H19A 3RRMB 3LKUA 2OFYA 3Q47B 4IWRA 5FZQA 4EPZA 1R69A 3B7UX 4PS7A 3T5VA 3S8QA 2O4AA 2V0PA 4I6JA 3HVEB 3Q5MA 4IRUA 4JPSA 2ICTA 1IYGA 4JHKA 4BT8A 3IHYA 3PNLB 4GAAA 4XE0A 4OYSA 4JEUA 5G05C 3L17A 2XCCA 5FQ4A 2E2EA 3FH8A 2KCKA 2X6FA 3OXFA 2WXNA 4Q69A 1PAQA 4H7YA 4FJZA 2IF4A 4Z5DA 2C0MA 4GMJA 4I6GA 2X38A 3EDTB 3S7BA 4PDXA 4PU7A 3LS8A 5J90A 4G25A 4A3VA 3D9IA 2WXKA 3FTUA 3QAQA 2EF8A 3G7DA 3D3MA 4G26A 1NEQA 3ZXSA 4WNGA 2CG3A 3FEXA 3FYAA 3G2TA 3FULA 4B89A 4FLBA 3GZ2A 4JVSA 4BX9A 1OWOA 3CVWA 5A6CA 4UWGA 2XGSA 1H6KA 5KCMA 3FUDA 2H8RA 2L0TB 1POUA 4QFVA 4Y42A 1ZZ6A 3LYAA 3CHSA 3O4ZA 4KXKB 3O48A 4JW1A 3LY8A 3ZRHA 1QZ2A 2UY1B 4MCXA 4ACKA 5BV0A 3ZFWA 2LSUA 2XPIA 3ASGA 1GW6A 5D0OD 4HOSA 2FO7A 3NQPA 3G2WA 3IV0A 2RG8A 3I4GA 2LYSA 2I1JA 2LYKA 3PRZA 2EBYA 3ENEA 3RJVA 5KJNA 1Y8MA 4IULA 1U3CA 3FTVA 2LAIA 3CLCA 2PM6A 3D9LA 3VLFA 2CROA 3MLFA 3UFDA 1ZZCA 3LPZA 4JZYA 3CECA 4GYWA 1E3OC 3SF4A 4NDWA 2GRLA 3BDNA 2J9QA 1SQMA 5HI7A 2XPYA 2PUBA 3T5XA 4OVUA 2I1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUO A;  4I6U A;  4IVZ A;  1ZUG A;  3KJX A;  1LLI A;  1PER L;  1L1M A;  1Y7Y A;  1PRU A;  3QF3 A;  3TRB A;  1CJG A;  1QQB A;  1WH6 A;  2PUD A;  2CSF A;  4GQM A;  1OSL A;  4Z58 A;  4PU4 C;  3GN5 A;  3G5G A;  1WET A;  1QP0 A;  2AXV A;  4YG4 A;  1DW9 A;  1B0N A;  4YG7 B;  1QQA A;  2PUF A;  1X57 A;  2L8N A;  1EFA A;  2MEZ A;  2AUW A;  1WIZ A;  1VPW A;  1JFS A;  1DWK A;  2BNO A;  3B7H A;  3PXP A;  4F8D A;  3BD1 A;  2FJR A;  2PIJ A;  4IA8 A;  3SCF A;  1SQ8 A;  1WH8 A;  1BDI A;  4I8T A;  1UXC A;  2GRM A;  2XCJ A;  4FN3 A;  4X4B A;  3JXD L;  2KZ8 A;  3OP9 A;  2PUA A;  1ZVV A;  1ZZB A;  3HZI B;  1PRV A;  1QP4 A;  4Z5C A;  2HIN A;  2O49 A;  3H5T A;  2AXU A;  2LYL A;  4MCT A;  3SCG A;  2GZU A;  2KEJ A;  2O4A A;  2JCG A;  3F52 A;  2AW6 A;  1R63 A;  3BS3 A;  2A6C A;  2EWT A;  3FMY A;  3RZZ A;  3JXC L;  2KPJ A;  2PUG A;  3GBF A;  2IV1 A;  4JQD A;  4J1X A;  3QWG A;  2LYJ A;  2ICP A;  5K98 B;  4YBA A;  1XWR A;  3ZKC A;  1RZR D;  1ZZ9 A;  4I6T A;  3OQM A;  2LYP A;  1ZZ8 A;  2R1J L;  2AWI A;  2JVL A;  1ZPQ A;  4GHJ A;  3QQ6 A;  1LMB 3;  2IVB A;  2L49 A;  4X4C A;  4PU3 C;  2WUS R;  3FYM A;  1S7E A;  1PNR A;  2XIU A;  4Z5H A;  1GT0 C;  5A7L A;  4X4D A;  4J1W A;  2OR1 L;  4JCX A;  3VK0 A;  2XJ3 A;  1YSE A;  2OFY A;  3EUS A;  4IWR A;  1R69 A;  2IVG A;  3S8Q A;  1RIO A;  1JH9 A;  1JWL A;  1AU7 A;  1CQT A;  2PPX A;  4I6R A;  2IU7 A;  2ICT A;  4PU8 A;  1ZS4 A;  2PUE A;  2R63 A;  1NER A;  4Z59 A;  2LYQ A;  1RZR A;  3F51 A;  2BNN A;  2WIU B;  3CRO L;  2PUC A;  1PRA A;  3JXB C;  4Z5D A;  2O38 A;  2LYR A;  3IVP A;  2AXZ A;  4YAR A;  1HF0 A;  4PU7 A;  3OQN A;  2BNM A;  1RPE L;  3KXA A;  2KEK A;  3ZHM A;  2LCV A;  2PE5 A;  2EF8 A;  3G7D A;  1NEQ A;  4FBI A;  3FYA A;  3D1N I;  1LCC A;  4O8B A;  4X4G A;  1QPZ A;  3R1F A;  1LCD A;  3OQO A;  1O4X A;  3KZ3 A;  2H8R A;  1IC8 A;  1ADR A;  1LQC A;  4OB4 A;  3ZHI A;  1POU A;  3DNV B;  2D5V A;  2MQK A;  4Y42 A;  1ZZ6 A;  1QP7 A;  2IVQ A;  3QYX A;  4MCX A;  3LFP A;  4X4E A;  1BDH A;  1UXD A;  3GN5 B;  1X2L A;  1OCT C;  1Y9Q A;  2BJC A;  2LYS A;  3SCH A;  2LYK A;  3LIS A;  4YG1 A;  3L1P A;  1ZAY A;  2EBY A;  1RZS A;  2B5A A;  4X4I A;  2XSD C;  3OMT A;  3O9X A;  4X4F A;  1JFT A;  3CLC A;  4JCY A;  1ZZ7 A;  2CRO A;  3F6W A;  3MLF A;  1ZZC A;  3UFD A;  3U3W A;  4X4H A;  3CEC A;  2HSG A;  1UTX A;  1E3O C;  2KEI A;  4NDW A;  2GRL A;  3BDN A;  2PUB A;  2XI8 A; 
#chains in the Genus database with same CATH topology
 3GZC A;  1HH8 A;  1O1S A;  2EIM E;  4MBG A;  1E8Z A;  1OSL A;  4DI4 A;  1QP0 A;  3TEL A;  1QBQ A;  2H6H A;  1JWF A;  1ELW A;  3C3R A;  3MKQ B;  4U8H A;  1ZVV A;  2HM8 A;  3FUJ A;  3KAE A;  1WG0 A;  3QKY A;  4C0M A;  3QWV A;  5H7P A;  2PXB A;  4NQ0 A;  2ICP A;  4YBA A;  5DTR A;  1XWR A;  3CHO A;  2NC9 A;  5ENR D;  3BG0 B;  4TRQ A;  2A5U A;  3QQ6 A;  2FO1 E;  2WUS R;  3PUJ A;  3FYM A;  5GAH i;  4GMR A;  3SFX A;  5BUZ A;  1GT0 C;  3NZL A;  3BEE A;  3HHM A;  4HQD A;  5DSX A;  2M63 A;  4EZL A;  1AU7 A;  3MGB A;  1HG5 A;  3FTY A;  3PVL A;  4OAU C;  3CRO L;  4BWR A;  4AOF A;  5AAO A;  4EHM A;  2IO2 C;  2XXP A;  4IN3 B;  2LXL A;  4K5C A;  2LCV A;  4EKG A;  4FBI A;  3RRU A;  4O60 A;  4XKB A;  1IC8 A;  2X6K A;  2XCB A;  2L6J A;  1IHG A;  4HXI A;  5DIZ A;  1SZA A;  5FZQ A;  4V3I A;  4LER A;  3CV0 A;  2CHZ A;  2F37 A;  2LNI A;  4DLQ A;  3ZXP A;  4BTB A;  2MRI A;  3TL5 A;  3B7B A;  1N4S A;  1E8Y A;  3SD5 A;  4CDR A;  2KEI A;  3Q78 A;  3FEY A;  1UJJ A;  2DZO A;  1PRU A;  1QQB A;  3TXN A;  4YVQ C;  4U0S A;  5ENS D;  3FUI A;  3UM3 A;  4ZHB A;  2XRZ A;  4GA0 A;  3TWR A;  2HE0 A;  2IQC A;  4AY6 A;  2XS8 A;  3A9X A;  2I9C A;  3AG1 E;  3FU3 A;  1ZZB A;  4I2Z A;  4LNG A;  4EQF A;  3S7F A;  4EZJ A;  2Y69 E;  2V8S E;  3F52 A;  4GTT A;  2EIL E;  4B94 A;  3CK7 A;  4N39 A;  3SBT B;  3SFZ A;  3S7D A;  3RO2 A;  3R7Q A;  1Z6T A;  4GTR A;  2H6I A;  3QJZ A;  3E4B A;  3ZKJ A;  2VTB B;  3V30 A;  4WWN A;  2PQR A;  1PNR A;  4DUI A;  2YNQ A;  1TN7 A;  5AQA A;  4P29 A;  3D9O A;  4DJA A;  2QZA A;  3ASH A;  2WXP A;  3CVN A;  1ZS4 A;  3ZYK A;  4N5C A;  3GZ1 A;  1OY3 D;  3R9A B;  1EDU A;  1S64 A;  5CER B;  2IEJ A;  5JMN D;  2BTD A;  4UWK A;  2XPZ A;  4C48 B;  4KYO B;  3MJW A;  3R9M A;  4LSZ E;  4GPK A;  5CHE E;  3WXX A;  4AJW A;  5AJL A;  4LEU A;  4HS2 A;  1LCC A;  2RFA A;  5LFA A;  2DBA A;  4E6H A;  4BTA A;  5CBO A;  2PXF A;  4X4E A;  2Y3A A;  4HOU A;  4U95 D;  1Y9Q A;  3DSW A;  3KL4 A;  5ENP D;  3SCH A;  3FH7 A;  1UN8 A;  1ZBP A;  3OMT A;  1JFT A;  3HYM B;  5T3R A;  4UQZ A;  1PER L;  4YND A;  3AS4 A;  4N3A A;  1OCC E;  3QF3 A;  1JUQ A;  5G04 C;  1HF8 A;  4L2Y A;  1WET A;  1E96 B;  1WY6 A;  5EKQ D;  5E75 A;  1PC2 A;  2NYJ A;  3JYS A;  3OP9 A;  1SA4 A;  2WQ6 A;  3ZVV A;  4X8Q A;  3CLJ A;  1R63 A;  3RZZ A;  5FTP A;  3ZUV B;  3MEJ A;  4A1S A;  2R5S A;  1HE8 A;  2WXQ A;  3OTN A;  3HXF A;  4FA6 A;  1ZPQ A;  1LMB 3;  3NBN B;  4PU3 C;  2DIW A;  3A9Y A;  4CDM A;  3ABK E;  3NF1 A;  1H6O A;  2P9S G;  2KM4 A;  4XZ4 A;  3RRN B;  4BY6 A;  3Q7F A;  2WXR A;  2IFU A;  4J6I A;  4UI9 J;  3FUK A;  2WIU B;  3CHM A;  4I1A A;  3TWU A;  4BFR A;  1TN8 A;  1RPE L;  3SGH A;  3ONL A;  3ZHM A;  4XKC A;  3DM5 A;  1FVH A;  5ANL A;  3OQO A;  2V5F A;  2KCV A;  4OB4 A;  3K9I A;  1S63 A;  2MQK A;  3UX4 A;  3B13 A;  4KT6 B;  2L6B A;  3G0T A;  4PS8 A;  3JXJ A;  2VGX B;  4ACL A;  1N4Q A;  3IHV A;  5AYW D;  3L1P A;  1ZAY A;  3ML8 A;  1KZO A;  3MZL B;  1BD8 A;  4N2S A;  2CFU A;  1K1A A;  3KEA A;  3KEZ A;  3ZPJ A;  3VTX A;  4FHJ A;  2ETB A;  2XI8 A;  4IVZ A;  1LLI A;  3TWQ A;  4Y6C A;  1CJG A;  3ZN3 A;  3Q49 B;  1WH6 A;  4XI9 A;  1E7U A;  2VJ8 A;  2GRO B;  3HVE A;  5BV1 A;  3I5P A;  2AXV A;  1DW9 A;  1EFA A;  4F8D A;  2FJR A;  3SCF A;  3QB2 A;  4DE8 A;  3EIQ C;  4AY5 A;  3NDB B;  3E34 A;  1TEZ A;  2KAT A;  5FQ7 A;  2HYZ A;  1OWP A;  3L13 A;  1WDY A;  1V55 E;  2R1J L;  2DCP A;  3E37 A;  4ILH B;  4U0Z A;  2FBN A;  2L49 A;  2ETC A;  2BKG A;  2WXM A;  2ZGD A;  3CVL A;  2KC7 A;  1H19 A;  2O4A A;  3IXE A;  3Q5M A;  2ICT A;  4JHK A;  4BT8 A;  4UUC A;  2XCC A;  3FH8 A;  2X6F A;  4Q69 A;  2XS1 A;  2IF4 A;  1K8K G;  3EDT B;  1SW6 A;  3S7B A;  3PZ3 A;  3LS8 A;  2WXK A;  1NEQ A;  3FEX A;  3G2T A;  3FYA A;  4BX9 A;  5A6C A;  4NIK A;  3EUV A;  2IY0 C;  2L0T B;  4Y42 A;  3LYA A;  4KXK B;  3M9L A;  2UY1 B;  3KSQ A;  4MCX A;  4ACK A;  2QC9 A;  5BV0 A;  2ETA A;  1O5M A;  5D0O D;  4WVL A;  3PRZ A;  3SFY A;  2J7W A;  3FTV A;  1V54 E;  3MLF A;  4JZY A;  4NDW A;  2J9Q A;  1IHB A;  4MRU A;  1FPP A;  4ANW A;  5BT1 A;  4XEI G;  3EJN A;  3G5G A;  2WQH A;  4YG7 B;  3HXE A;  3FFL A;  3Q15 A;  3PXP A;  3CR3 A;  3WG7 E;  1WH8 A;  4FN3 A;  3J5P A;  2OOE A;  3PDN A;  2PUA A;  5EIL A;  2WXL A;  5DRY A;  4TXR A;  2B6C A;  5BXO A;  2HIN A;  2O49 A;  3G2V A;  4MKT A;  4MCT A;  3UIN C;  2ZIS A;  2LO6 A;  5KNH D;  3AG2 E;  3T8M A;  4EBA A;  2EWT A;  3DSV A;  1BI8 B;  4TXQ A;  2PXU A;  2GRP B;  3JXI A;  3LY7 A;  3UXG A;  2WB2 A;  1AP7 A;  4JA9 A;  1Z3X A;  1HFA A;  4FUL A;  4U04 A;  2IO3 C;  3LEW A;  4LCT A;  4OAV B;  1SA5 A;  2XEN A;  5A7L A;  3S2A A;  1G3N B;  1FVF A;  2FI7 A;  1NW3 A;  2XEH A;  4I2W A;  3SHF A;  2IVG A;  4GZ6 A;  1TJF A;  3RIB A;  4GCO A;  5FJY A;  4GZ3 A;  2LYQ A;  1YMP A;  3BG1 B;  5JJT A;  3ASF A;  4BEP A;  1MX4 A;  3UWP A;  2RD0 A;  4FLH A;  4HI8 A;  4UI9 K;  4DE9 A;  4XX5 A;  3APF A;  5LOZ A;  4KVM A;  1QPZ A;  3PZ4 A;  5T8I A;  1ADR A;  4WUY A;  2OVF A;  1QNF A;  2PL2 A;  4U0U A;  1BDH A;  4HBD A;  4I9E A;  3AS5 A;  3Q7A A;  3U66 A;  2BJC A;  2YBD A;  3DBS A;  3GYZ A;  5D2M C;  1NFI E;  3TWX A;  1DCQ A;  3ASO E;  3C5R A;  4O1O A;  1IXV A;  2A4Z A;  1AWC B;  1HU3 A;  4JHR A;  3APC A;  3UPV A;  3TXM A;  5J08 A;  3ESK A;  4LRZ A;  1Y7Y A;  3L08 A;  1U2V G;  1E8W A;  2A5E A;  4JXT A;  2BUG A;  3MEK A;  4GTO A;  3CKB A;  2PUF A;  3JQ0 A;  3TEP A;  2VSY A;  2AUW A;  2OVB A;  1E8X A;  2WXI A;  4HOQ A;  1K1B A;  2PIJ A;  2QYJ A;  3D9K A;  4D10 C;  3U4T A;  3H5T A;  3ISM C;  5CRU A;  4XI0 A;  2MXD A;  3PE5 A;  5K98 B;  1ZZ9 A;  3OQM A;  1KPS B;  1S0P A;  5BW8 C;  4A3T A;  1YCS B;  3CVP A;  2HO1 A;  4X4D A;  4BER A;  5B3S E;  3S7J A;  1YSE A;  3Q9U C;  5ENN A;  4PUC A;  4GTM A;  4GYO A;  5FIN A;  1NER A;  3CK9 A;  4KVO A;  3IVP A;  1HS6 A;  3KXA A;  5KJL A;  5G04 J;  3NZU A;  1ZB1 A;  1UJK A;  2OEV A;  2J49 A;  2WMO A;  1YA0 A;  1O1R A;  2AJA A;  5FZR A;  5AQ9 A;  2WQ7 A;  1UXD A;  4HRN A;  3KD7 A;  5KJK A;  3RU0 A;  3PE4 A;  4UQY A;  3FUM A;  2VYI A;  4F6R D;  3R09 A;  4BES A;  2HFZ A;  3O9X A;  1E90 A;  1XGW A;  3TJP A;  3SY2 A;  3B7S A;  4FJY A;  4Y6W A;  4X4H A;  3NRO A;  2UWJ G;  3V31 A;  3A9Z A;  2FUL A;  3EHQ A;  3FHE A;  5KJM A;  2HR2 A;  1TJC A;  1HG2 A;  3APD A;  3LJ3 A;  2J08 A;  2HCS A;  2IU1 A;  3W9F A;  5T4Y A;  2XXQ A;  1SQ8 A;  2GRM A;  1NA0 A;  3C72 A;  4DI3 A;  5AEN A;  2J8S D;  4JC8 A;  1EF1 C;  2Y4T A;  4B8C B;  3MX3 A;  2IOS A;  4WWP A;  1IKN D;  5KNG A;  2EIN E;  3JXC L;  5HS0 A;  2PUG A;  4ILG A;  3MA5 A;  2LYP A;  4DX2 A;  3ME5 A;  3FDH A;  3FTW A;  3CVY A;  2PXD A;  2I2O A;  2WMN A;  1P5Q A;  3Q79 A;  4A63 B;  4UQX A;  3ML9 A;  3IEG A;  3UT4 A;  3CVV A;  4WAF A;  2R2L A;  2ZIR A;  3EUS A;  5EDS A;  1JH9 A;  4QQI A;  2EIK E;  3URZ A;  3Q73 A;  1RZR A;  2J4B A;  2BNN A;  5FZS A;  1PRA A;  3L9T A;  3JXB C;  3ONK A;  2C0L A;  3IBE A;  5CCM A;  3DSS A;  2J7U A;  4AVX A;  5ENT D;  3UQ3 A;  3JCK C;  4O8B A;  4DRX E;  2V4H C;  1O4X A;  5CED B;  3T9K A;  3MV3 B;  3ZHE B;  2J4D A;  3LFP A;  5E76 A;  3UKU G;  3PRE A;  3GN5 B;  4JL0 A;  3ZHE A;  3HIZ A;  4B0Z A;  5DTQ A;  3X2Q E;  5AAR A;  4X4F A;  1UN9 A;  2OCC E;  2HSG A;  1UTX A;  3UIP C;  3KS2 A;  2IUO A;  1A5E A;  3VWS A;  2DZN A;  3EHN A;  2GRQ B;  1ELR A;  5KWD A;  2WPV A;  1B0N A;  2JQE A;  1VPW A;  4HFG A;  1DNP A;  4AV7 A;  3AU5 A;  3JXD L;  5GAG i;  4EK9 A;  4Z5C A;  4L9P A;  3ASN E;  1H2V C;  2WXF A;  2X6H A;  4OBM A;  2LYJ A;  1BPO A;  4E85 A;  3B7T A;  3FTX A;  3E32 A;  2R05 A;  4DK5 A;  2GRR B;  2JVL A;  4F3V A;  3G2U A;  2AVP A;  2RKK A;  2IVB A;  2XHE A;  1X5B A;  4BT9 A;  1JCR A;  4JCX A;  2ODR D;  3ABL E;  3QOU A;  5ARF A;  2OFY A;  4EPZ A;  3B7U X;  3T5V A;  3HVE B;  3DEP A;  1K3Z D;  2E2E A;  2KCK A;  3OXF A;  4U8V D;  2C0M A;  4I6G A;  5J90 A;  4HRL A;  3G7D A;  4G26 A;  3ZXS A;  4B89 A;  5IY5 E;  4FLB A;  3GZ2 A;  5HKP A;  3FUD A;  2H8R A;  3DXM G;  1ZZ6 A;  3CHS A;  4JW1 A;  3ZRH A;  1QZ2 A;  1TNO A;  3ASG A;  3DRA A;  4GTV A;  3SQV A;  2I1J A;  2LYK A;  3ENE A;  3ZPX A;  4BET A;  1N0R A;  3CLC A;  2CRO A;  4DX6 D;  3GZD A;  2DVW A;  3BDN A;  1X81 A;  1SQM A;  2XPY A;  4OVU A;  3EU9 A;  2P9P G;  4AM9 A;  4XIF A;  3CVU A;  4CGW A;  4GZC A;  4M7C A;  4UWL A;  2P58 C;  3P1U A;  3RAU A;  1WAO 1;  4GA2 A;  2L8N A;  1JFS A;  2PNN A;  3CKC A;  4O6F A;  2QYU A;  5D0Q D;  4G8L A;  3LCA A;  4OVV A;  4WND A;  4ER0 A;  1HXI A;  2LUH A;  1KZP A;  3PZ2 A;  3AG3 E;  2LYL A;  2GZU A;  2XGO A;  1TN6 A;  3QWG A;  4KBQ A;  2BKK B;  3ZYM A;  3L22 A;  1SZ9 A;  5DRT A;  3ZEF A;  3EHM A;  1D9S A;  1ZZ8 A;  1D8D A;  4N3B A;  4M3O A;  5AN8 A;  3UKR G;  2JLB A;  2X6I A;  3UI2 A;  4U63 A;  2WXJ A;  4MLP A;  1NI1 A;  3AAA C;  3SR4 A;  3EU5 A;  5G05 J;  1TYQ G;  5AIJ A;  1JWG A;  4J8S A;  4N2Q A;  1UW4 B;  3V2X A;  2PXT A;  1QQE A;  3L6A A;  3OAW A;  2O38 A;  3PEV B;  4YAR A;  2KEK A;  4YDE A;  3CST A;  1OCO E;  3D1N I;  4J0U A;  1MX2 A;  1OWL A;  1HZ4 A;  3ABM E;  4GYY A;  4N3C A;  3SBS A;  3V79 K;  3VLE A;  4RG9 A;  3AU4 A;  4A55 A;  2X6J A;  3CEQ A;  2MOW A;  4AP2 A;  4ATG A;  4ER7 A;  2L9B A;  1H2U A;  2VQ2 A;  1ZZ7 A;  3SI5 A;  4APO A;  2WXG A;  2ILR A;  4RQI A;  4LNU D;  2YHE A;  4JD2 G;  4W9R A;  5CRV A;  2PUD A;  2CSF A;  3GN5 A;  2PXP A;  1UG3 A;  4N5Q A;  4MS6 A;  3D9P A;  2OV8 A;  1JPL A;  3LVQ E;  2XCJ A;  1HO8 A;  4LG6 A;  1MHQ A;  5ANR A;  2JAB A;  3FUH A;  3DSU A;  2AW6 A;  4KZC A;  3ASD A;  2LXM A;  1XNF A;  1Z3Y A;  1BI7 B;  2FFH A;  3TG4 A;  4CGV A;  4I6T A;  2E0I A;  3D9J A;  2KZT A;  4JA7 A;  4ANV A;  4X4C A;  3ZYL A;  3GUU A;  4CT0 A;  2YQ8 A;  2VSN A;  3MKR A;  2OR1 L;  3TAX A;  3QK0 A;  3VK0 A;  2XJ3 A;  5CEA A;  2I1K A;  2PXK A;  4NRH B;  4I6R A;  2PUE A;  2YIN A;  2Q7F A;  4HOT A;  4Z59 A;  3F51 A;  5DBK A;  1U3D A;  1KT1 A;  3ZNG A;  1FCH A;  3HXB A;  4EQZ A;  3CQC B;  4YDO A;  2AXZ A;  1HF0 A;  1MZC A;  1UOH A;  4PH4 B;  3CIA A;  4G23 A;  3SNX A;  4R7L A;  3UM0 A;  5JHB A;  2YHC A;  4X4G A;  4I1O B;  3LVR E;  1LCD A;  3KZ3 A;  4TUM A;  3Q4A B;  1LQC A;  3RK6 A;  3NB2 A;  5CBN A;  4C9B B;  2IVQ A;  4UWF A;  4WWO A;  1MJ0 A;  1X2L A;  3NXH A;  5LCW C;  4LUN U;  4ME2 A;  3FY4 A;  3PUK A;  4X4I A;  2LSV A;  1TNZ A;  3SZ7 A;  5FT9 A;  4DX1 A;  1H2T C;  3GZD C;  3VTY A;  3NOG D;  2WXH A;  4WNE A;  2L1P A;  3KJX A;  2P9N G;  3ZYQ A;  3T8K A;  4URK A;  3UT8 A;  4J8Y A;  3EIJ A;  2XRY A;  1KT0 A;  1QQA A;  4CDN A;  3BD1 A;  2ION A;  4GCN A;  4LNB A;  1KLX A;  2KZ8 A;  3F6Q A;  2BF0 X;  1QP4 A;  4Q96 A;  3SCG A;  2GGF A;  3CGH A;  4YVO A;  1NZN A;  4G11 A;  3ZU7 B;  2WXO A;  5ARG A;  3AG4 E;  3GW4 A;  3CVQ A;  3ZKC A;  3C3O A;  1IQU A;  3LXU X;  4H7X A;  1N94 A;  3MKQ A;  2P2C P;  5FQ6 A;  1BLX B;  5C2Y A;  1JWL A;  2PPX A;  3FU5 A;  1QB2 A;  1Q2Z A;  3B95 A;  4G2V A;  3PZ1 A;  5C1D A;  3CK8 A;  3HXD A;  3CHQ A;  3TG5 A;  4GB9 A;  1N4P A;  4CYM D;  2CHX A;  3PE3 A;  2IJG X;  2GW1 A;  1U2Z A;  3R1F A;  3UMV A;  4AXH A;  3ESL A;  2D5V A;  1MYO A;  2DYR E;  4RLY A;  2CHW A;  5ENQ D;  4C0E A;  5AQ7 A;  4B8A A;  4HVB A;  3L16 A;  3LIS A;  2B5A A;  3DPY A;  1OUV A;  5JHA A;  2XSD C;  2HCN A;  4I6E A;  3BU8 A;  4BSZ B;  4GZ5 A;  4GU5 A;  3L54 A;  3G2S A;  2H6G A;  2V3C C;  2MYO A;  3QC1 A;  2FF4 A;  3FUF A;  1NL4 A;  2NXP A;  1L1M A;  2F8Y A;  1RW2 A;  3QWP A;  2Y4U A;  4UI9 C;  3VLD A;  4YG4 A;  2V4L A;  1LD8 A;  1TR4 A;  4GML A;  2KXP C;  4ER6 A;  1E7V A;  3B7R L;  1WIZ A;  5EYL A;  4CEM A;  2FEZ A;  2L0I A;  2NSZ A;  3ULE G;  4L2L A;  1BDI A;  3E33 A;  1UXC A;  4I9C A;  2R59 A;  3C98 A;  1N95 A;  2V5Q C;  1SVX A;  3FMY A;  3P2B A;  4GTQ A;  2KPJ A;  4JQD A;  4HI9 A;  2B0O E;  4CCA A;  1INZ A;  5B1A E;  3D9H A;  3Q9N C;  1H6P A;  4FC8 A;  3OXL A;  4CRW A;  4GHJ A;  3TWT A;  4HRA A;  4GTP A;  2XIU A;  1WM5 A;  5G55 A;  3FUE A;  4APF A;  3NOC D;  4GA1 A;  3RRM B;  3LKU A;  3Q47 B;  4ER3 A;  4IWR A;  1R69 A;  3S8Q A;  3EHR A;  4EZI A;  4ER5 A;  3PNL B;  4XE0 A;  4OYS A;  5G05 C;  1N11 A;  1LTX A;  3RSE G;  4JB8 P;  1PAQ A;  4FJZ A;  4PDX A;  4PU7 A;  4G25 A;  4A3V A;  3FTU A;  1D8E A;  2EF8 A;  3QAQ A;  4WNG A;  5ITZ F;  3FUL A;  4JVS A;  2M4H A;  1RZ4 A;  5KCM A;  2R03 A;  1POU A;  4QFV A;  2R02 A;  3O48 A;  3LY8 A;  4B93 B;  2LSU A;  2XPI A;  1GW6 A;  4HOS A;  3IV0 A;  2RG8 A;  1QYM A;  3LJN A;  1N0Q A;  3RJV A;  5KJN A;  1Y8M A;  4IUL A;  3DXK G;  2LAI A;  2PM6 A;  3D9L A;  3VLF A;  2H6F A;  1ZZC A;  3LPZ A;  3SF4 A;  1N4R A;  5HI7 A;  2PUB A;  3U64 A;  3NAW A;  4I6U A;  2LNM A;  5LP0 A;  3PEU B;  4ZFH A;  3C3Q A;  4YDW A;  4RVB A;  4PU4 C;  4RG6 A;  3TWW A;  1W3B A;  1NP7 A;  5EYP F;  1DWK A;  2BNO A;  1LF8 A;  4J7W A;  4IA8 A;  3UIO C;  4GTS A;  4DLO A;  4HLE A;  2ZGG A;  4NAC A;  3HRA A;  1Z5S C;  3MV2 B;  2AXU A;  5JJ7 A;  1DC2 A;  3MYV A;  2DYS E;  4KMO A;  3R7R A;  1NA3 A;  4UWH A;  5EN5 D;  3KSL A;  1YYH A;  5JA4 D;  5HRY A;  3ZIM A;  5FQ8 A;  2DWZ A;  4ABN A;  5EID A;  2VSX E;  2XXA A;  4I1M A;  2OEW A;  1CQT A;  4PU8 A;  1TNU A;  2R63 A;  4AIF A;  2KZT B;  3FP3 A;  3RKV A;  3OQN A;  2PXQ A;  2J09 A;  5FIO A;  2PE5 A;  1MFQ C;  2I6H A;  5CEC B;  3GZS A;  2OND A;  2QY7 A;  3ZHI A;  4TV3 A;  2VSO E;  3MCX A;  3RO3 A;  3QYX A;  3PZD A;  3QNK A;  4L7T A;  2LAH A;  4RSY A;  1ELK A;  1OCZ E;  2KBX A;  1N54 A;  2XZT G;  3FU6 A;  5EX0 A;  2XGM A;  3QOX A;  2JEK A;  3D9M A;  1TNY A;  3W9G A;  4U8Y D;  2R17 C;  3DWL G;  3LY9 A;  4YDY A;  3CSF A;  4K03 A;  5EIB E;  1OT8 A;  3PNT B;  3V2O A;  3E30 A;  1MX6 A;  3FH5 A;  5CCL A;  4I43 A;  2EIJ E;  2MEZ A;  3CQG B;  4TUU A;  4I8T A;  3FTS A;  5KBA A;  3HXC A;  3NZS A;  3Q75 A;  1L5J A;  3QWW A;  4FAD A;  3ZW3 A;  3N71 A;  1PY1 A;  3BQO A;  2JCG A;  3OKZ A;  2J07 A;  4I17 A;  2ZU6 B;  3HG0 D;  3J5Q B;  3QDN A;  5HQ8 A;  4J1X A;  4K5A B;  2BED A;  1RZR D;  1OXJ A;  3DPD A;  4FP7 A;  4A1G A;  4TXP A;  4Z5H A;  4HB5 A;  1HX8 A;  3TWV A;  2GRN B;  3UM2 A;  1DVP A;  4K5B A;  1RIO A;  1LD7 A;  4Q94 A;  2XEV A;  2RFM A;  3UT7 A;  4J8E A;  4G1T A;  4CZ2 D;  1OCR E;  1B89 A;  3AS8 A;  4HRM B;  4WNF A;  2LYR A;  3ZGQ A;  1MQS A;  2PXL A;  1EPU A;  1H0A A;  1DUL A;  5A7D B;  4EZK A;  3DST A;  2P9K G;  4F7A A;  4ATZ D;  2MHK A;  2WVI A;  1OCT C;  4G24 A;  4L1B A;  4HLL A;  1BU9 A;  3CVX A;  5BXU A;  5LX8 A;  5LCW J;  3I3N A;  4NUR A;  4YG1 A;  4EBA G;  3AJI A;  2Y0B G;  4JCY A;  3QOW A;  3PH0 C;  3U3W A;  5A23 A;  3CHP A;  4BX8 A;  3OXG A;  2VGX A;  4U7E B;  3TRB A;  4KZ0 A;  4Q2J A;  1N9A A;  3LDZ A;  5JUW A;  3L82 A;  5DT2 A;  2PXV A;  1X57 A;  2XZD G;  3QFI A;  1HQ1 A;  1EYH A;  4EKI A;  3U9W A;  3PS6 A;  2WM9 A;  2C2L A;  3UTM A;  2XEE A;  4IYP A;  4FU3 A;  3HZI B;  2IOL A;  1PRV A;  3UM1 A;  1FT1 A;  1TNB A;  3GBF A;  3CHR A;  3FU0 A;  1O1T A;  1DCE A;  2VGE A;  3UUX A;  4ANX A;  4JEH A;  2PZI A;  2QFC A;  3DEO A;  3QAR A;  5BNW A;  3IKO B;  4U96 D;  4J1W A;  3FWV A;  4DPR A;  4K0R A;  4ILI A;  5M72 A;  3TFL A;  4CT4 A;  4F53 A;  3I4R B;  4FHK A;  2IU7 A;  5BPP A;  5DTM A;  3JQ1 A;  4JHJ A;  1FT2 A;  2VTB A;  2PUC A;  5AJD A;  1QZX A;  2CFZ A;  4J8D A;  3ULQ A;  2BNM A;  4L23 A;  3TGO A;  2X3M A;  5JJ6 A;  1JCS A;  2LLV A;  3DNV B;  3FTZ A;  1QP7 A;  4GPM A;  4EEC A;  2EQX A;  4U07 A;  4HOR A;  2KCL A;  4PS3 A;  2ZXW E;  4GZD A;  5G2N A;  1RZS A;  3ULY A;  3HDX A;  3F6W A;  1Y6I A;  2CG2 A;  2LLW A;  2PXE A;  4DX7 D;  1JCQ A;  4F1S A;  1ZUG A;  5EX3 A;  1ZU2 A;  4GQM A;  4Z58 A;  2P9I G;  5FWQ A;  1IQR A;  3B7H A;  5CMW A;  5ENO D;  2VEO A;  3BUA A;  2VGY A;  1N52 A;  4X4B A;  5B1B E;  1S70 B;  3JUI A;  3SX0 A;  1OWM A;  2P9U G;  4Z68 A;  2KEJ A;  3JUE A;  1OWN A;  1A17 A;  3BS3 A;  2A6C A;  2F0Y A;  1VDY A;  2XQ0 A;  2IV1 A;  2P9L G;  3OWQ A;  2PQN A;  2UY1 A;  4J8F A;  3FUN A;  4AEZ C;  2AWI A;  4DX5 D;  1S7E A;  4ANU A;  2PM7 A;  2F8X K;  3D9N A;  4PS7 A;  2V0P A;  4I6J A;  4F1P A;  4JPS A;  4IRU A;  1IYG A;  3IHY A;  4GAA A;  4JEU A;  3L17 A;  5FQ4 A;  2WXN A;  4H7Y A;  5D66 A;  4Z5D A;  4GMJ A;  2X38 A;  3D9I A;  3TWS A;  3D3M A;  4HNA D;  2CG3 A;  3LQX A;  4BSX A;  1OWO A;  3CVW A;  4UWG A;  2XGS A;  1H6K A;  4O1P A;  3O4Z A;  4G8K A;  3ZFW A;  2FO7 A;  3NQP A;  3G2W A;  3I4G A;  2LYS A;  2EBY A;  1U3C A;  5AQB A;  3UFD A;  3SO8 A;  3CEC A;  4GYW A;  1E3O C;  2GRL A;  3DSX A;  2Y1L E;  3T5X A;  5CMY A; 
#chains in the Genus database with same CATH homology
 4ANW A;  4I6U A;  4AM9 A;  4XIF A;  5BT1 A;  1HH8 A;  5LP0 A;  3CVU A;  1E8Z A;  4CGW A;  3PEU B;  4RVB A;  1OSL A;  3EJN A;  4DI4 A;  4PU4 C;  4GZC A;  3G5G A;  4UWL A;  2P58 C;  3P1U A;  1QP0 A;  4RG6 A;  2WQH A;  4YG7 B;  1WAO 1;  4GA2 A;  2L8N A;  1W3B A;  3FFL A;  3Q15 A;  1NP7 A;  1JFS A;  1DWK A;  2BNO A;  3PXP A;  3CR3 A;  1JWF A;  1LF8 A;  3CKC A;  4O6F A;  4IA8 A;  1ELW A;  5D0Q D;  1WH8 A;  3LCA A;  4OVV A;  4DLO A;  4FN3 A;  3MKQ B;  4WND A;  4HLE A;  2OOE A;  1HXI A;  3PDN A;  2PUA A;  4NAC A;  1ZVV A;  2WXL A;  4U8H A;  2HM8 A;  3FUJ A;  3MV2 B;  3KAE A;  2HIN A;  2O49 A;  3G2V A;  2AXU A;  2LYL A;  4MCT A;  3QKY A;  3QWV A;  2GZU A;  4MKT A;  2LO6 A;  4C0M A;  5JJ7 A;  3T8M A;  4EBA A;  2EWT A;  4NQ0 A;  3MYV A;  2XGO A;  4KMO A;  3QWG A;  3LY7 A;  4KBQ A;  2ICP A;  3R7R A;  4YBA A;  1XWR A;  3ZYM A;  3L22 A;  1SZ9 A;  3CHO A;  3ZEF A;  1NA3 A;  2NC9 A;  3EHM A;  1ZZ8 A;  4JA9 A;  1Z3X A;  4UWH A;  3BG0 B;  1HFA A;  4N3B A;  4FUL A;  4M3O A;  4TRQ A;  2A5U A;  2JLB A;  2X6I A;  3QQ6 A;  4U04 A;  3LEW A;  4LCT A;  2WUS R;  3PUJ A;  3FYM A;  4U63 A;  3ZIM A;  5BUZ A;  1GT0 C;  5A7L A;  2WXJ A;  4MLP A;  3S2A A;  5FQ8 A;  3BEE A;  4ABN A;  3HHM A;  1FVF A;  2M63 A;  5CMY A;  2FI7 A;  5G05 J;  2VSX E;  4I2W A;  4I1M A;  3SHF A;  2IVG A;  4EZL A;  5AIJ A;  1JWG A;  1AU7 A;  1TJF A;  1CQT A;  4PU8 A;  3MGB A;  4GZ6 A;  4J8S A;  4GCO A;  1HG5 A;  3RIB A;  1UW4 B;  4N2Q A;  2R63 A;  3FTY A;  3PVL A;  5FJY A;  4GZ3 A;  4AIF A;  2LYQ A;  1QQE A;  2KZT B;  3L6A A;  3BG1 B;  3OAW A;  3CRO L;  5JJT A;  4BWR A;  3ASF A;  4AOF A;  3FP3 A;  2O38 A;  3PEV B;  4IN3 B;  4YAR A;  3RKV A;  3OQN A;  2RD0 A;  2J09 A;  4FLH A;  2KEK A;  3CST A;  4UI9 K;  2LCV A;  4XX5 A;  2PE5 A;  3APF A;  2I6H A;  4FBI A;  5LOZ A;  3D1N I;  4KVM A;  3RRU A;  3GZS A;  1QPZ A;  4J0U A;  2OND A;  1OWL A;  2QY7 A;  5T8I A;  1HZ4 A;  1IC8 A;  2X6K A;  1ADR A;  4GYY A;  4N3C A;  2OVF A;  4WUY A;  3ZHI A;  1QNF A;  2XCB A;  3SBS A;  3VLE A;  2PL2 A;  4TV3 A;  2L6J A;  1IHG A;  2VSO E;  3AU4 A;  3MCX A;  4HXI A;  4RG9 A;  4U0U A;  3RO3 A;  4A55 A;  3QYX A;  1BDH A;  3PZD A;  3QNK A;  5DIZ A;  1SZA A;  2X6J A;  3AS5 A;  4I9E A;  2LAH A;  4L7T A;  3CV0 A;  4LER A;  4RSY A;  3CEQ A;  4V3I A;  2CHZ A;  3U66 A;  3U64 A;  1ELK A;  2LNI A;  4DLQ A;  2BJC A;  3DBS A;  2MOW A;  3GYZ A;  1N54 A;  3FU6 A;  5EX0 A;  4BTB A;  2XGM A;  2MRI A;  4AP2 A;  4ATG A;  2JEK A;  3D9M A;  2L9B A;  1H2U A;  2VQ2 A;  1ZZ7 A;  3SI5 A;  3TL5 A;  4APO A;  2WXG A;  2ILR A;  2R17 C;  1E8Y A;  3LY9 A;  3SD5 A;  4CDR A;  2A4Z A;  2KEI A;  2YHE A;  1HU3 A;  3CSF A;  4JHR A;  3APC A;  3UPV A;  3TXM A;  3FEY A;  5J08 A;  1UJJ A;  4K03 A;  3ESK A;  4LRZ A;  3PNT B;  1Y7Y A;  3L08 A;  1PRU A;  4W9R A;  1QQB A;  4MRU A;  2PUD A;  2CSF A;  3TXN A;  4YVQ C;  3GN5 A;  1E8W A;  4U0S A;  4JXT A;  2BUG A;  1UG3 A;  3FH5 A;  3FUI A;  3MEK A;  4MS6 A;  5CCL A;  2OV8 A;  2PUF A;  3CKB A;  1JPL A;  3D9P A;  2VSY A;  3JQ0 A;  2MEZ A;  2AUW A;  2OVB A;  4I43 A;  2XRZ A;  1E8X A;  2WXI A;  4HOQ A;  4GA0 A;  2IQC A;  2PIJ A;  3LVQ E;  4AY6 A;  3CQG B;  4TUU A;  4I8T A;  2XCJ A;  2I9C A;  3FTS A;  3NZS A;  3D9K A;  1HO8 A;  3FU3 A;  1ZZB A;  1L5J A;  4I2Z A;  4D10 C;  3U4T A;  4EQF A;  3QWW A;  4FAD A;  1MHQ A;  3H5T A;  3ZW3 A;  3N71 A;  1PY1 A;  3S7F A;  5ANR A;  4EZJ A;  2V8S E;  3FUH A;  2JCG A;  3F52 A;  2AW6 A;  4KZC A;  2J07 A;  3ASD A;  4I17 A;  2ZU6 B;  3CK7 A;  4B94 A;  4N39 A;  3SBT B;  3QDN A;  4XI0 A;  4J1X A;  3S7D A;  1XNF A;  3SFZ A;  5HQ8 A;  1Z3Y A;  5K98 B;  1RZR D;  3RO2 A;  3R7Q A;  1Z6T A;  1ZZ9 A;  3TG4 A;  4I6T A;  3OQM A;  4CGV A;  2E0I A;  3D9J A;  1S0P A;  3QJZ A;  5BW8 C;  3E4B A;  3DPD A;  4FP7 A;  2VTB B;  4A3T A;  4WWN A;  2KZT A;  4JA7 A;  4A1G A;  2PQR A;  4X4C A;  3ZYL A;  4ANV A;  3CVP A;  2HO1 A;  1PNR A;  4Z5H A;  4CT0 A;  2YQ8 A;  4X4D A;  2VSN A;  3MKR A;  2OR1 L;  3TAX A;  2YNQ A;  3QK0 A;  3VK0 A;  1HX8 A;  2XJ3 A;  3S7J A;  1YSE A;  4P29 A;  3D9O A;  4DJA A;  1DVP A;  5ENN A;  1RIO A;  3ASH A;  2WXP A;  4NRH B;  4PUC A;  2XEV A;  4I6R A;  1ZS4 A;  2PUE A;  2YIN A;  3CVN A;  4Q94 A;  3UT7 A;  2Q7F A;  4N5C A;  3ZYK A;  4GYO A;  4J8E A;  3GZ1 A;  1NER A;  4G1T A;  4HOT A;  3R9A B;  4Z59 A;  3F51 A;  1EDU A;  1B89 A;  1U3D A;  1KT1 A;  3AS8 A;  5DBK A;  3CK9 A;  1FCH A;  2BTD A;  4KVO A;  2XPZ A;  4UWK A;  4WNF A;  2LYR A;  3CQC B;  3IVP A;  2AXZ A;  3MJW A;  1HF0 A;  4KYO B;  3ZGQ A;  1MQS A;  4PH4 B;  1HS6 A;  3KXA A;  3CIA A;  5KJL A;  4G23 A;  3NZU A;  4R7L A;  1EPU A;  5G04 J;  3SNX A;  5CHE E;  3WXX A;  4GPK A;  4AJW A;  5AJL A;  4LEU A;  2YHC A;  4HS2 A;  5JHB A;  1LCC A;  4X4G A;  1H0A A;  1UJK A;  1LCD A;  3LVR E;  4I1O B;  3KZ3 A;  2J49 A;  2WMO A;  5LFA A;  3Q4A B;  1LQC A;  5A7D B;  3RK6 A;  4EZK A;  1YA0 A;  2DBA A;  5FZR A;  4E6H A;  4F7A A;  2WQ7 A;  4BTA A;  4C9B B;  2IVQ A;  4UWF A;  4X4E A;  4WWO A;  1UXD A;  2MHK A;  2Y3A A;  3KD7 A;  2WVI A;  5KJK A;  4HOU A;  1X2L A;  1OCT C;  4G24 A;  4L1B A;  3RU0 A;  3CVX A;  1Y9Q A;  5LX8 A;  3PE4 A;  4UQY A;  5LCW C;  3FUM A;  3SCH A;  2VYI A;  3I3N A;  4LUN U;  5LCW J;  4NUR A;  3FH7 A;  4ME2 A;  4YG1 A;  3FY4 A;  4EBA G;  1UN8 A;  1ZBP A;  3PUK A;  4X4I A;  2LSV A;  3OMT A;  3O9X A;  1JFT A;  1E90 A;  1XGW A;  3HYM B;  4JCY A;  5FT9 A;  3SZ7 A;  3TJP A;  1H2T C;  3PH0 C;  3U3W A;  3B7S A;  4FJY A;  4Y6W A;  4X4H A;  5T3R A;  5A23 A;  3CHP A;  3VTY A;  4UQZ A;  4BX8 A;  2UWJ G;  2WXH A;  3OXG A;  1PER L;  3KJX A;  2VGX A;  3AS4 A;  4WNE A;  4YND A;  4N3A A;  3ZYQ A;  3QF3 A;  3TRB A;  1JUQ A;  5G04 C;  1HF8 A;  2FUL A;  4KZ0 A;  4L2Y A;  4URK A;  3UT8 A;  3EIJ A;  3LDZ A;  3FHE A;  1WET A;  2XRY A;  5KJM A;  1E96 B;  1KT0 A;  1QQA A;  1WY6 A;  2HR2 A;  1TJC A;  1X57 A;  1HG2 A;  5EKQ D;  3APD A;  5E75 A;  3LJ3 A;  4CDN A;  2J08 A;  1PC2 A;  1EYH A;  2IU1 A;  3U9W A;  3BD1 A;  2ION A;  3JYS A;  3PS6 A;  5T4Y A;  2WM9 A;  1SQ8 A;  4GCN A;  2C2L A;  2GRM A;  1KLX A;  1NA0 A;  2KZ8 A;  3OP9 A;  4IYP A;  4DI3 A;  5AEN A;  4FU3 A;  3HZI B;  2BF0 X;  2IOL A;  1PRV A;  1QP4 A;  2WQ6 A;  3ZVV A;  4JC8 A;  4Q96 A;  3SCG A;  1EF1 C;  2GGF A;  2Y4T A;  3CGH A;  4YVO A;  3MX3 A;  4B8C B;  2IOS A;  3CLJ A;  4WWP A;  1NZN A;  4G11 A;  1R63 A;  2WXO A;  3RZZ A;  5ARG A;  5FTP A;  3GW4 A;  3JXC L;  2PUG A;  3GBF A;  3CHR A;  3FU0 A;  4A1S A;  2R5S A;  3CVQ A;  4ILG A;  3ZKC A;  1HE8 A;  1IQU A;  3MA5 A;  2LYP A;  3LXU X;  4H7X A;  2WXQ A;  3OTN A;  3FDH A;  3FTW A;  3CVY A;  4FA6 A;  1ZPQ A;  3UUX A;  4ANX A;  4JEH A;  1LMB 3;  2PZI A;  2QFC A;  3QAR A;  2I2O A;  2WB2 A;  4PU3 C;  5BNW A;  2DIW A;  2WMN A;  3IKO B;  4CDM A;  1P5Q A;  3MKQ A;  4J1W A;  3FWV A;  3NF1 A;  4UQX A;  4BSX A;  3ML9 A;  3IEG A;  3UT4 A;  4DPR A;  3CVV A;  5FQ6 A;  4WAF A;  4K0R A;  2KM4 A;  4XZ4 A;  4ILI A;  5M72 A;  3EUS A;  3RRN B;  5C2Y A;  4BY6 A;  4CT4 A;  4F53 A;  5EDS A;  1JH9 A;  2WXR A;  1JWL A;  3I4R B;  4FHK A;  2PPX A;  2IU7 A;  2IFU A;  3FU5 A;  3URZ A;  5BPP A;  4J6I A;  4UI9 J;  1RZR A;  3FUK A;  2J4B A;  3JQ1 A;  2BNN A;  4JHJ A;  2WIU B;  4G2V A;  5FZS A;  3CHM A;  2VTB A;  2PUC A;  4I1A A;  1PRA A;  4BFR A;  3JXB C;  5AJD A;  5C1D A;  3CK8 A;  3ONK A;  2CFZ A;  3CHQ A;  1RPE L;  2C0L A;  2BNM A;  3IBE A;  4J8D A;  3SGH A;  3ONL A;  3ULQ A;  3ZHM A;  3TG5 A;  5CCM A;  4L23 A;  4GB9 A;  4XKC A;  4AVX A;  4XKB A;  3TGO A;  1FVH A;  2CHX A;  3PE3 A;  3JCK C;  5ANL A;  3UQ3 A;  2IJG X;  2GW1 A;  4O8B A;  2X3M A;  3R1F A;  3OQO A;  1O4X A;  2V5F A;  3UMV A;  4AXH A;  5JJ6 A;  2KCV A;  3ESL A;  4OB4 A;  2D5V A;  3DNV B;  3K9I A;  3MV3 B;  2MQK A;  2CHW A;  3FTZ A;  1QP7 A;  3UX4 A;  3ZHE B;  4EEC A;  3B13 A;  4KT6 B;  2J4D A;  3LFP A;  5E76 A;  2EQX A;  3PRE A;  4C0E A;  4B8A A;  3GN5 B;  4PS8 A;  4U07 A;  4JL0 A;  4HOR A;  4HVB A;  2VGX B;  4ACL A;  3ZHE A;  3L16 A;  3IHV A;  3HIZ A;  4B0Z A;  2KCL A;  3LIS A;  3L1P A;  4PS3 A;  1ZAY A;  4GZD A;  5AYW D;  1RZS A;  2B5A A;  3ML8 A;  1OUV A;  5G2N A;  5JHA A;  3MZL B;  3HDX A;  2XSD C;  4X4F A;  4I6E A;  1UN9 A;  4N2S A;  2CFU A;  3F6W A;  4GZ5 A;  4GU5 A;  3L54 A;  3G2S A;  1Y6I A;  2HSG A;  1UTX A;  3KEZ A;  3ZPJ A;  2CG2 A;  3VTX A;  3KS2 A;  4F1S A;  4FHJ A;  3QC1 A;  2XI8 A;  2IUO A;  2FF4 A;  4IVZ A;  1ZUG A;  3FUF A;  1LLI A;  2NXP A;  1L1M A;  3EHN A;  4Y6C A;  1CJG A;  3ZN3 A;  3Q49 B;  1WH6 A;  1ELR A;  3QWP A;  5EX3 A;  2Y4U A;  1ZU2 A;  4XI9 A;  1E7U A;  2VJ8 A;  4GQM A;  4UI9 C;  4Z58 A;  2WPV A;  3HVE A;  3VLD A;  3I5P A;  5BV1 A;  2AXV A;  4YG4 A;  1DW9 A;  1B0N A;  2V4L A;  4GML A;  5FWQ A;  3B7R L;  1EFA A;  1E7V A;  1IQR A;  1VPW A;  1WIZ A;  4CEM A;  4HFG A;  1DNP A;  3B7H A;  2FEZ A;  2L0I A;  4AV7 A;  3AU5 A;  5CMW A;  4F8D A;  2NSZ A;  2FJR A;  1BDI A;  2VGY A;  3SCF A;  3QB2 A;  4L2L A;  1N52 A;  1UXC A;  4X4B A;  3JXD L;  4I9C A;  3EIQ C;  4AY5 A;  3JUI A;  2R59 A;  3C98 A;  1OWM A;  1TEZ A;  4Z5C A;  2KAT A;  2KEJ A;  1OWN A;  1H2V C;  2WXF A;  1A17 A;  3BS3 A;  2A6C A;  3FMY A;  5FQ7 A;  3P2B A;  2X6H A;  1VDY A;  2KPJ A;  4JQD A;  2XQ0 A;  2IV1 A;  2LYJ A;  1BPO A;  2HYZ A;  4E85 A;  2PQN A;  2UY1 A;  3B7T A;  4CCA A;  3FTX A;  1OWP A;  1INZ A;  4J8F A;  3FUN A;  3L13 A;  2R1J L;  2DCP A;  4FC8 A;  4AEZ C;  2AWI A;  3OXL A;  2JVL A;  4CRW A;  4DK5 A;  4GHJ A;  4F3V A;  4ILH B;  3G2U A;  2AVP A;  4U0Z A;  2IVB A;  2FBN A;  2L49 A;  2XHE A;  1S7E A;  2XIU A;  4ANU A;  1WM5 A;  1X5B A;  2PM7 A;  5G55 A;  2WXM A;  3FUE A;  4BT9 A;  3CVL A;  4JCX A;  4APF A;  3D9N A;  3QOU A;  2KC7 A;  4GA1 A;  5ARF A;  1H19 A;  3RRM B;  3LKU A;  2OFY A;  3Q47 B;  4IWR A;  5FZQ A;  4EPZ A;  1R69 A;  3B7U X;  4PS7 A;  3T5V A;  3S8Q A;  2O4A A;  2V0P A;  4I6J A;  3HVE B;  3Q5M A;  4IRU A;  4JPS A;  2ICT A;  1IYG A;  4JHK A;  4BT8 A;  3IHY A;  3PNL B;  4GAA A;  4XE0 A;  4OYS A;  4JEU A;  5G05 C;  3L17 A;  2XCC A;  5FQ4 A;  2E2E A;  3FH8 A;  2KCK A;  2X6F A;  3OXF A;  2WXN A;  4Q69 A;  1PAQ A;  4H7Y A;  4FJZ A;  2IF4 A;  4Z5D A;  2C0M A;  4GMJ A;  4I6G A;  2X38 A;  3EDT B;  3S7B A;  4PDX A;  4PU7 A;  3LS8 A;  5J90 A;  4G25 A;  4A3V A;  3D9I A;  2WXK A;  3FTU A;  3QAQ A;  2EF8 A;  3G7D A;  3D3M A;  4G26 A;  1NEQ A;  3ZXS A;  4WNG A;  2CG3 A;  3FEX A;  3FYA A;  3G2T A;  3FUL A;  4B89 A;  4FLB A;  3GZ2 A;  4JVS A;  4BX9 A;  1OWO A;  3CVW A;  5A6C A;  4UWG A;  2XGS A;  1H6K A;  5KCM A;  3FUD A;  2H8R A;  2L0T B;  1POU A;  4QFV A;  4Y42 A;  1ZZ6 A;  3LYA A;  3CHS A;  3O4Z A;  4KXK B;  3O48 A;  4JW1 A;  3LY8 A;  3ZRH A;  1QZ2 A;  2UY1 B;  4MCX A;  4ACK A;  5BV0 A;  3ZFW A;  2LSU A;  2XPI A;  3ASG A;  1GW6 A;  5D0O D;  4HOS A;  2FO7 A;  3NQP A;  3G2W A;  3IV0 A;  2RG8 A;  3I4G A;  2LYS A;  2I1J A;  2LYK A;  3PRZ A;  2EBY A;  3ENE A;  3RJV A;  5KJN A;  1Y8M A;  4IUL A;  1U3C A;  3FTV A;  2LAI A;  3CLC A;  2PM6 A;  3D9L A;  3VLF A;  2CRO A;  3MLF A;  3UFD A;  1ZZC A;  3LPZ A;  4JZY A;  3CEC A;  4GYW A;  1E3O C;  3SF4 A;  4NDW A;  2GRL A;  3BDN A;  2J9Q A;  1SQM A;  5HI7 A;  2XPY A;  2PUB A;  3T5X A;  4OVU A;  2I1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...