2GRMA

Crystal structure of prgx/icf10 complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
315
structure length
315
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGCYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVAIENNPIPEIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for control of conjugation by bacterial pheromone and inhibitor peptides.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PrgX
total genus 121
structure length 315
sequence length 315
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2grmA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2grmA02
2KEIA 1R63A 3ZHIA 3G5GA 2IUOA 1POUA 2GZUA 3OP9A 3PXPA 4X4IA 4Z5HA 4JCYA 2LCVA 4X4HA 3F51A 4NDWA 4PU4C 2AW6A 2EF8A 1ZZ8A 1WIZA 4F8DA 2KEKA 2BJCA 4J1WA 2O49A 4X4GA 1OSLA 2PUCA 3KXAA 4JQDA 1LQCA 1LCDA 1X2LA 1NERA 1JH9A 1BDHA 2PE5A 1O4XA 1WH6A 2LYKA 1OCTC 3L1PA 1QP0A 1ZS4A 2R1JL 3CLCA 1SQ8A 1Y9QA 1LMB3 2LYRA 3G7DA 1WH8A 2HINA 1E3OC 3RZZA 3UFDA 2ICTA 2KPJA 1UTXA 4PU7A 3DNVB 3F6WA 1GT0C 3FYAA 2AXZA 3LFPA 1IC8A 2WIUB 2O4AA 1ADRA 3FYMA 2PUDA 4YARA 1QP4A 4YG4A 3SCHA 1XWRA 1HF0A 2LYLA 1JFTA 2PPXA 3LISA 3QWGA 4YBAA 1QQAA 2CROA 4PU3C 1ZUGA 2JVLA 2PIJA 2OR1L 4PU8A 4YG1A 1ZZCA 2PUFA 1B0NA 2KZ8A 3O9XA 2CSFA 4JCXA 2IVGA 2AUWA 4X4FA 3OQMA 4YG7B 3D1NI 1ZZBA 3CROL 1UXCA 1DW9A 1LCCA 2B5AA 2XJ3A 3BDNA 3JXBC 2O38A 1UXDA 2GRMA 2EBYA 3HZIB 2LYSA 2IVBA 4OB4A 3QQ6A 1QP7A 2KEJA 2H8RA 4IWRA 1RZRA 1LLIA 2A6CA 2BNNA 4I6UA 1ZZ7A 3F52A 4Z59A 3OQOA 1JWLA 3TRBA 4MCXA 1JFSA 2XSDC 4Z5DA 3R1FA 2MEZA 1RIOA 1NEQA 2L49A 4GQMA 3KZ3A 1CQTA 1EFAA 3QF3A 4FBIA 4Z5CA 2L8NA 4Z58A 2OFYA 2PUBA 1RZRD 4Y42A 3ZKCA 1CJGA 3VK0A 1RPEL 1ZZ6A 4GHJA 1ZPQA 1PRAA 2IU7A 1Y7YA 3MLFA 3JXCL 2D5VA 3FMYA 2PUAA 2AWIA 2ICPA 5K98B 2FJRA 2GRLA 3ZHMA 2LYPA 1QPZA 3EUSA 2PUEA 4IVZA 4FN3A 2AXUA 4X4DA 2JCGA 3BD1A 3U3WA 1S7EA 2WUSR 1PERL 1ZVVA 3IVPA 1X57A 2EWTA 4J1XA 1L1MA 2IV1A 2MQKA 3S8QA 3BS3A 1BDIA 1QQBA 1VPWA 1WETA 2HSGA 2XI8A 1PRVA 4X4EA 3B7HA 2BNOA 4MCTA 5A7LA 2PUGA 2LYQA 3SCFA 3SCGA 3GN5B 1PNRA 4I8TA 2XCJA 2IVQA 1ZAYA 1ZZ9A 3KJXA 3OMTA 4IA8A 3JXDL 3H5TA 4X4BA 1AU7A 1DWKA 4I6RA 1R69A 3CECA 2R63A 1RZSA 2BNMA 2XIUA 4O8BA 2AXVA 3GBFA 4X4CA 3QYXA 1PRUA 2LYJA 1YSEA 3OQNA 3GN5A 4I6TA
chains in the Genus database with same CATH superfamily
3NQPA 3MYVA 4J8YA 2VTBA 1NA0A 4H7XA 3F51A 4GTSA 2QYUA 3FUEA 2PUCA 3L08A 1X2LA 5JUWA 3CHPA 1OUVA 3SD5A 2M4HA 2R1JL 1UN8A 1QNFA 1EYHA 4ANUA 4EZJA 2XRYA 3M9LA 4J8DA 2XXAA 3DNVB 2GROB 3LFPA 2O4AA 2BEDA 3IKOB 2PNNA 3KSQA 4JHKA 2L9BA 2IQCA 4PU8A 5LOZA 2QC9A 4C9BB 1XNFA 4JCXA 2R02A 2P9IG 3PNLB 1S63A 2WXOA 1SZ9A 1LCCA 3HXBA 2GRMA 1U2ZA 1K8KG 4DX2A 2I6HA 1LLIA 2A6CA 1FT2A 1JWLA 3Q9UC 3TWXA 4I6EA 2XS8A 2YHCA 2ZGGA 3VK0A 2EIME 3B7TA 3QFIA 3UIOC 4Q2JA 3Q4AB 4EQFA 4AVXA 2ILRA 3R09A 1FCHA 3ZKJA 1S7EA 3FTSA 4GTOA 1OY3D 3R7QA 4TXPA 3APDA 3FUMA 2LYQA 3TG5A 3L22A 1PAQA 4WNDA 4BSZB 3ZN3A 1BD8A 4ATZD 3CVPA 4GTTA 4RVBA 1R69A 1N52A 5LCWC 3PRZA 2R63A 3QWVA 2KC7A 4BWRA 1FVFA 3ZHIA 4MLPA 2RD0A 3CSTA 4ZFHA 4PU4C 2V0PA 1MZCA 3SGHA 3ZFWA 1TR4A 4NRHB 5KJNA 1LTXA 5BPPA 1NERA 3S7JA 4XE0A 3JUEA 3D9IA 1Y9QA 3PNTB 5LX8A 3EHNA 1QYMA 3TEPA 1PC2A 2XGOA 4GPMA 4K5AB 4EHMA 3GZ1A 2X6IA 2KPJA 3E32A 3NF1A 3GZ2A 3FYAA 1B89A 1YA0A 3J5PA 1JUQA 4ATGA 3LISA 5HRYA 4ER0A 3OKZA 2P9LG 5LP0A 3ASDA 4HLLA 3S7DA 3MEJA 4Q94A 2XEHA 3PZ3A 4ER3A 2EBYA 2IVBA 1ZB1A 5EX0A 2QYJA 4YDWA 3SFZA 2A5EA 4U7EB 5HKPA 1N4RA 4JD2G 2L49A 4DLQA 4FU3A 4DI4A 3FUDA 5CERB 1MFQC 2CHZA 3G2TA 4GZ6A 3UM1A 3DPDA 4MRUA 3JXIA 1ZPQA 2IU7A 4UI9C 1QQEA 4N3CA 4IVZA 3Q73A 3F6QA 4G8KA 5AQ9A 3HG0D 2MQKA 3HXDA 4W9RA 3HVEB 5A7LA 4DX7D 4JA7A 2IVQA 2RFMA 4BFRA 2WMOA 5CMYA 3JYSA 1ZBPA 1AU7A 4A3VA 3SFXA 4O8BA 1LD7A 4U8YD 1D8EA 3B7RL 4JC8A 2J4DA 2GRRB 4X4HA 5KNHD 4X4GA 4JQDA 1Z5SC 3QWPA 2H6FA 4KMOA 3L1PA 1A17A 3LJ3A 1XGWA 2IF4A 1ELRA 1O1RA 3C3RA 2P58C 3FDHA 1QZ2A 2Y1LE 3FYMA 5FQ8A 3D9NA 4NACA 4YG4A 3OXFA 3QARA 4KZCA 2E0IA 2OEVA 5FZQA 3TWVA 4OBMA 5ENOD 4GTMA 3LYAA 2P9UG 4A55A 4CT0A 5D0OD 2LLWA 4G23A 4DRXE 3UM3A 4AV7A 4U0ZA 4HOUA 1RIOA 4GQMA 3PVLA 1SW6A 2PXQA 2OFYA 4HRMB 4CGVA 3DXKG 1SA4A 5KBAA 3MX3A 5A23A 3TWUA 1X81A 3DSWA 1NP7A 2LNIA 4FN3A 2AXUA 3BU8A 5AJLA 2MOWA 2FO1E 2YNQA 3BD1A 5CRUA 2LUHA 3ML8A 3IVPA 2B0OE 2IV1A 1VPWA 3HIZA 1WDYA 2C0MA 2PXLA 3OMTA 3JXDL 5AQBA 4GZCA 3IEGA 3QOWA 1IHGA 3CVQA 3B7UX 2AXVA 2CHWA 4U96D 2LCVA 4OYSA 4NDWA 3BUAA 2BJCA 1UOHA 4I17A 5CEAA 1NI1A 1ZS4A 1ZU2A 3CSFA 3L9TA 5B3SE 1Y6IA 3TWQA 4NURA 3LVQE 3RZZA 3B13A 3ONLA 2WXPA 1N54A 3ULYA 3DWLG 2OEWA 5DTRA 3AS8A 2I1JA 1HH8A 2KCKA 5ENPD 3VWSA 2KATA 1HQ1A 4JA9A 4TUMA 2YBDA 1MX2A 3FUNA 3D1NI 4G2VA 3NOCD 4K0RA 2O38A 3HZIB 2Y4TA 4J0UA 3ME5A 3AAAC 3C72A 2LO6A 3CVVA 3B95A 5CCMA 1N95A 4KVOA 4N3BA 3CHSA 3PZ4A 4PDXA 4XEIG 5C2YA 1E8YA 1EDUA 2PUAA 3KEZA 3A9XA 1UW4B 4CCAA 2PL2A 5HI7A 2HFZA 1DVPA 1FPPA 1JCQA 5AN8A 2WUSR 2WPVA 1X57A 2MYOA 1FT1A 2HSGA 3GZSA 4ILHB 1ZAYA 2BKKB 4UWKA 4U8VD 3TJPA 1MQSA 3IBEA 3CVYA 1DWKA 3CVWA 5T3RA 3U9WA 5J90A 4N3AA 4U8HA 4BT8A 4B0ZA 3QYXA 3ZGQA 3G5GA 3UTMA 4L9PA 5LFAA 2EQXA 3UMVA 5CEDB 3ZYQA 5M72A 1L5JA 2NYJA 5ARFA 3CK7A 4APOA 5CBOA 3ZEFA 2X38A 2VGEA 3FU0A 3ASOE 2L0TB 1IC8A 2R05A 4GU5A 4JXTA 2JVLA 1MHQA 1INZA 2P9PG 3AS4A 3IHYA 2JABA 2J07A 2V8SE 4WNGA 3TAXA 4GMLA 4CRWA 4GZDA 2LYSA 4G8LA 3QQ6A 4XKBA 3DM5A 2DZNA 1S64A 3FTXA 1N4QA 3V2XA 3JQ0A 4L23A 3RSEG 2HE0A 3CLJA 3ULQA 1NEQA 3KZ3A 3PE3A 1ELWA 3ONKA 2FEZA 3ZKCA 2NXPA 2DYRE 2IJGX 3AJIA 3FEXA 3ZXSA 5K98B 2JEKA 4N5CA 1GW6A 2PUEA 1KZPA 1QZXA 3URZA 3FTUA 5E75A 2DYSE 1IQRA 3HHMA 3S8QA 4HI8A 2X6FA 1VDYA 1OCRE 4E85A 3U64A 3ZU7B 3NBNB 3TFLA 3OXGA 3S7FA 5KJLA 3ISMC 2KBXA 3CHQA 4YDEA 4OAVB 5T4YA 1YSEA 2I1KA 1BPOA 2UWJG 5EYPF 4JCYA 4Q69A 3OXLA 2AW6A 1ZZ8A 4EKGA 2KEKA 1O1TA 3CK8A 4O1OA 2VSYA 4JEUA 3TWTA 3CLCA 3MKQA 4N5QA 4TXRA 2LSVA 2HINA 1N0RA 2ICTA 4DX5D 3FUIA 2PXFA 3P2BA 4LCTA 4A1SA 2F8XK 4RSYA 2EIJE 3PEUB 2IO3C 4GPKA 3QAQA 2AJAA 2ETCA 3T8MA 4MKTA 4LNBA 1TN6A 1OCZE 4GB9A 2IVGA 2MRIA 4KT6B 4J8FA 2Q7FA 2J8SD 3ZNGA 1YCSB 2HM8A 3GZCA 2VSXE 1H6OA 2KEJA 3ABKE 3ZPXA 3NB2A 1DC2A 2VJ8A 3FUJA 3NZLA 1EFAA 4FBIA 4A1GA 3KAEA 1RPEL 3QB2A 1NA3A 3HRAA 3JXCL 3FMYA 3QK0A 2HR2A 3TWSA 3LPZA 4C0EA 2XCBA 2FBNA 4ME2A 4G24A 2JCGA 3U3WA 3EU9A 4K5CA 5BW8C 3EDTB 4XKCA 2AVPA 3ABLE 3BS3A 4GTPA 3Q47B 4EKIA 3SCFA 2WXNA 3QDNA 5B1BE 5KJMA 3T5VA 3G2SA 2LXLA 4PS7A 5FT9A 2LYJA 1RZRD 2FULA 3B7BA 2PQRA 2WXHA 2NSZA 4GA1A 3TL5A 4X4IA 3JQ1A 3LDZA 4APFA 2DIWA 2X6HA 4URKA 4HB5A 4O60A 2XENA 4RG6A 4YDYA 4BTAA 1LCDA 3UX4A 4HOTA 1OXJA 5AARA 5FTPA 1LMB3 3BG0B 3G7DA 4WWNA 3DXMG 4ILIA 3TGOA 2R2LA 3G0TA 3CVXA 4WNFA 1OWLA 5AQAA 3VLFA 4BX9A 4A3TA 3L16A 3PZDA 5EIBE 4G11A 5G2NA 1D9SA 2ZXWE 1ZUGA 2LLVA 2R59A 4YG1A 2PUFA 5BUZA 1TEZA 1W3BA 2WXFA 3C5RA 3W9FA 3OQMA 4HQDA 3CROL 5FZSA 3ZYMA 1TJFA 2LAHA 3BDNA 3S2AA 4OB4A 2DWZA 4FJYA 5JJ6A 2YINA 3PUKA 3U4TA 5IY5E 1BU9A 1O5MA 3FH7A 2L6JA 5ENTD 3PUJA 3FWVA 3R9AB 4M3OA 1U2VG 2PXTA 3ZW3A 1CJGA 5CRVA 5DSXA 4JW1A 2KCLA 3DSXA 2GW1A 3K9IA 5ITZF 4EZLA 3FY4A 1QQBA 4KBQA 3FTWA 2RG8A 3J5QB 3DSVA 2V4HC 4HOQA 3UIPC 4EZKA 2J08A 1DULA 5EDSA 4X4BA 4CDNA 1RZSA 5D0QD 4AOFA 3FULA 3R7RA 3TG4A 4I6TA 4L1BA 2GZUA 4U0UA 1E90A 2V5FA 1OSLA 1BDHA 3ZXPA 4WWPA 4GA2A 3AG3E 3DSUA 2MXDA 3C98A 1SA5A 4EBAA 2FF4A 2IEJA 2QZAA 3NDBB 4GMJA 3NAWA 1X5BA 1K1BA 2IOSA 2PUDA 4J7WA 4HRAA 4GCNA 1JFTA 5FJYA 2VSOE 4DX1A 2PQNA 2ZGDA 4UWHA 3VLEA 2OV8A 2V4LA 1KZOA 3ABME 3MCXA 3LY9A 5BNWA 2BF0X 3GW4A 3RO3A 3QOXA 4MCXA 4IN3B 2OVFA 2XZDG 4Z5DA 3KL4A 2IFUA 3FTZA 2HCNA 2XPYA 1N4SA 4NIKA 3HXCA 3HXFA 3ESKA 4FJZA 3EIQC 5J08A 3ZPJA 4PS8A 2WQ6A 4X4DA 2IU1A 5DTMA 2XI8A 1PRVA 3CIAA 4JL0A 4MCTA 4GCOA 2ZIRA 3Q75A 1UJKA 2XRZA 3O48A 2XXQA 1H6KA 3BQOA 4I6RA 1HX8A 3CECA 2WXIA 2XGMA 3DSTA 4ILGA 3D9MA 3EU5A 1H19A 4F7AA 2PXPA 2PXEA 1TNBA 4I6GA 4I1AA 3NXHA 2HCSA 1KT1A 3SFYA 4QFVA 1SQMA 4DK5A 4G1TA 3V30A 1LQCA 2XEVA 3OAWA 2PE5A 1WH6A 4J8EA 3KEAA 1V55E 3G2WA 3FEYA 3EHRA 3WXXA 1HG5A 4G26A 2JLBA 3UM2A 3F6WA 5AYWD 4A63B 5EILA 3UT7A 3D3MA 1NL4A 1DCQA 3E30A 2XQ0A 3QWGA 4RLYA 4H7YA 2PXKA 4BETA 1ZZCA 2KZ8A 3NOGD 4JZYA 4EK9A 1MX6A 2P2CP 4YVOA 4WVLA 4X4FA 2GRQB 5FQ6A 4BSXA 5CCLA 4GMRA 3SR4A 2XJ3A 1QBQA 4RQIA 2KCVA 5G04J 3UUXA 3FTYA 2WB2A 1RZRA 1UG3A 2BNNA 3LVRE 3RK6A 4PUCA 4DPRA 3TXNA 3RU0A 3CR3A 2WMNA 3HVEA 1SZAA 3CQGB 4Y6WA 4I6JA 1Q2ZA 5FIOA 4O1PA 2UY1B 5HS0A 2CG2A 2XEEA 3CGHA 4TUUA 2PM7A 5JHAA 1L1MA 2EWTA 4CZ2D 1KPSB 4D10C 3B7HA 2CHXA 4LG6A 4X8QA 2CFUA 4GTQA 4GYWA 1MJ0A 5E76A 5C1DA 3AU4A 3DRAA 4N39A 3LS8A 4I9EA 1WM5A 4YDOA 2J4BA 2XGSA 2RKKA 3AG1E 3GUUA 1NFIE 2XHEA 5EIDA 2E2EA 3ZYKA 4DE9A 3FHEA 4UQXA 3RIBA 1JH9A 5DTQA 2FI7A 4FHKA 1E3OC 1TN8A 3TWRA 2Y4UA 1UN9A 2L1PA 5EYLA 4YARA 4MBGA 3FH5A 3VTYA 4JHJA 1N11A 3GZDC 4AIFA 2IY0C 2PIJA 2UY1A 3HYMB 2H6GA 4B89A 1B0NA 5BXOA 1E8ZA 4FP7A 4YG7B 1DW9A 3JXBC 3EHQA 4G25A 5EX3A 3UT4A 1WY6A 4EPZA 4UQYA 5G55A 4F53A 1P5QA 1FVHA 3A9ZA 3OQOA 4AJWA 3CHOA 2MEZA 4XI0A 2VYIA 3MGBA 4AEZC 4LNGA 3UXGA 1ZZ6A 2F37A 4GHJA 3PEVB 3JUIA 4AM9A 3IXEA 5CECB 4HOSA 3AS5A 2QFCA 1A5EA 2FJRA 3EJNA 3VLDA 5ANLA 1Z3YA 3EUSA 4F1PA 3QJZA 4XI9A 1HZ4A 2JQEA 2XPZA 2ETAA 1AP7A 2VEOA 4X4EA 5ENRD 2KZTA 2PUGA 5D2MC 2XCJA 3HDXA 2WQ7A 3LY7A 3NZUA 5GAHi 5B1AE 3D9PA 2BNMA 2XIUA 5G05J 3ZVVA 3GBFA 4X4CA 3L6AA 2V3CC 3GYZA 3FU3A 4N2SA 2J7WA 3UKRG 2O49A 1N0QA 3BG1B 4IULA 1OCTC 3RRUA 1Z6TA 2WQHA 3DEPA 2PZIA 1SQ8A 3CVUA 2EILE 3CKBA 5A7DB 1U3CA 2XCCA 1GT0C 2AXZA 4TXQA 2VSNA 3SCHA 2Y3AA 1PY1A 1Y8MA 2CROA 3ZUVB 4RG9A 5D66A 3O9XA 2CSFA 1TYQG 4GYOA 5CHEE 2AUWA 3L13A 1SVXA 3A9YA 3W9GA 4ER7A 2HO1A 4CT4A 5ANRA 2WXLA 4GZ3A 4P29A 3OWQA 1QP7A 1EF1C 2DBAA 1QB2A 2H8RA 4IWRA 3HXEA 3RO2A 2XSDC 3ZYLA 1K1AA 5FWQA 4BERA 4QQIA 3QC1A 3V2OA 2GGFA 3LY8A 1V54E 2AWIA 3B7SA 2LNMA 2GRLA 4WAFA 1HS6A 1E7UA 2PXDA 2KM4A 2ZISA 4ACKA 4JHRA 1ZVVA 1RW2A 5ARGA 5FQ7A 5AAOA 2P9SG 3C3OA 5BV1A 2I2OA 4I8TA 2C0LA 1NZNA 4DE8A 3ZIMA 2WXRA 4IA8A 3H5TA 1HO8A 3SQVA 3CEQA 4HS2A 5JJTA 4L2YA 2KEIA 1R63A 1TN7A 1Z3XA 4B94A 3QKYA 1MYOA 4U07A 4AY5A 4DJAA 2Y0BG 2MHKA 3DSSA 4BEPA 3G2VA 3WG7E 1H0AA 3ASNE 2GRPB 3DBSA 3E4BA 4IRUA 4J6IA 2R17C 4Y6CA 4TV3A 1H6PA 2Y69E 3UWPA 5G04C 4B93B 4LSZE 2WIUB 2F8YA 4CDRA 2YHEA 2PPXA 3ENEA 4PU3C 4AY6A 3I5PA 4EBAG 3C3QA 3APCA 3L82A 4ANXA 2VGXA 4B8CB 1H2TC 4K03A 3DEOA 3PE5A 4I6UA 3V79K 1S70B 3LKUA 3PDNA 1JFSA 4AXHA 3EUVA 4UQZA 2DZOA 3UQ3A 4LRZA 1HG2A 2L8NA 4Z58A 3MZLB 4GYYA 1OCOE 1HFAA 1S0PA 1YYHA 2ICPA 4I2ZA 1OWPA 5AENA 2LYPA 2J7UA 3LQXA 5FINA 1DCEA 3ML9A 4PH4B 3KS2A 4I1OB 1PERL 1EPUA 1D8DA 3Q7AA 4I43A 3Q15A 5KNGA 4C0MA 3GN5B 3LEWA 1H2VC 2LAIA 4DI3A 3G2UA 4K5BA 3CKCA 4HNAD 4FADA 5KWDA 2BTDA 2PXUA 5ENQD 4I1MA 2EIKE 2IUOA 3PXPA 1N94A 3Q79A 3OTNA 4PS3A 5EN5D 3UPVA 3BEEA 3SY2A 2V5QC 2L6BA 1UJJA 2WM9A 4LERA 3Q5MA 4FLHA 4KXKB 4FHJA 3E37A 3QNKA 1ADRA 1XWRA 2IO2C 3Q9NC 3E34A 3JXJA 5JHBA 4FA6A 4LEUA 4R7LA 3ZHEB 3PS6A 3DPYA 3D9KA 4ACLA 4WUYA 1DNPA 3ULEG 1N4PA 4FLBA 1YMPA 3IHVA 4ZHBA 3MKQB 3FU5A 3AG2E 4J8SA 2KZTB 4OVVA 4Z5CA 3QOUA 1IYGA 3LJNA 3PZ1A 3CVLA 3UINC 3D9OA 2IOLA 1PRAA 4AP2A 3MLFA 2XS1A 4UUCA 2BKGA 4U63A 4F6RD 4YVQC 5G05C 2LXMA 4NQ0A 4HLEA 3I3NA 3CVNA 3PH0C 2WVIA 4U04A 4JVSA 2FFHA 1BLXB 2XXPA 3U66A 3TWWA 1WETA 1N9AA 4HFGA 4UWFA 1PNRA 5BXUA 3D9LA 4CYMD 3KJXA 3UI2A 4F1SA 3FFLA 3NZSA 3ZHEA 4L2LA 3SI5A 1BI8B 1JWGA 2X6JA 3TELA 3OP9A 4ER6A 3MKRA 3ESLA 5CMWA 1O4XA 2LYKA 1E8XA 4TRQA 3UT8A 2VGYA 4FULA 2PM6A 2LYRA 1JPLA 4C48B 3O4ZA 3MV2B 1UTXA 4PU7A 1OWMA 1MX4A 1QP4A 2R5SA 2VTBB 2ZU6B 1HXIA 1HF0A 4YBAA 5BT1A 2OR1L 3R9MA 2BUGA 3L54A 2FO7A 5HQ8A 3D9JA 5FQ4A 4XX5A 4MS6A 5KJKA 1HE8A 2X3MA 1UXCA 4GA0A 5DRYA 2B5AA 3PE4A 4JB8P 2RFAA 3RRMB 5CBNA 2WXGA 1ZZ7A 3F52A 3T8KA 3TRBA 1JWFA 1JCSA 2CFZA 3MA5A 4JEHA 4KZ0A 1TNYA 4Y42A 4L7TA 4HVBA 3FUFA 1Y7YA 3P1UA 2M63A 1TNZA 3SNXA 4ANVA 2PXBA 1OWOA 2IONA 4BX8A 4EQZA 2X6KA 4HRNA 1BDIA 4U0SA 3RAUA 2NC9A 3SX0A 4FC8A 1IKND 4UWLA 1ZZ9A 1OT8A 3EIJA 4BESA 3MJWA 1TJCA 4ER5A 3VTXA 2CG3A 4GAAA 1PRUA 2QY7A 3GN5A 2XZTG 3KSLA 3CHMA 1IHBA 5FZRA 3MV3B 2EF8A 3APFA 5A6CA 2J49A 2P9NG 5KCMA 3PZ2A 4J1WA 2VQ2A 4LUNU 4EECA 5AQ7A 2VGXB 1WG0A 2OOEA 3SZ7A 1QP0A 5JMND 2DVWA 1WH8A 3UFDA 3CK9A 4ANWA 3SBTB 4WNEA 5ENNA 3V31A 1ELKA 2LYLA 2P9KG 4GTVA 2KXPC 4GZ5A 3Q7FA 1RZ4A 1E96B 4KVMA 2WXMA 4OAUC 4CDMA 4GTRA 2WXQA 1ZZBA 2ODRD 3IV0A 3AG4E 3SHFA 3EHMA 4Z59A 2GRNB 4DUIA 1HU3A 3FP3A 1KLXA 1OCCE 5DRTA 3UM0A 1TNUA 3RRNB 2OVBA 4CEMA 4HBDA 4DX6D 4XIFA 4HORA 3RKVA 4OVUA 4HI9A 2DCPA 4DLOA 3FUHA 4JPSA 4XZ4A 3ASGA 2BNOA 3PREA 3SO8A 2H6HA 1K3ZD 2C2LA 1WAO1 4O6FA 3MEKA 3FH8A 4UI9J 4Z68A 2WXKA 3FUKA 3T9KA 1LF8A 2XPIA 4N2QA 5GAGi 2YQ8A 5AJDA 1POUA 4LNUD 2EINE 4Z5HA 3ASFA 1G3NB 1E7VA 1WIZA 4F8DA 2PXVA 3X2QE 3KXAA 5H7PA 4E6HA 3CHRA 2B6CA 3UKUG 4I9CA 3L17A 2I9CA 3CQCB 1LD8A 3SF4A 3RJVA 1O1SA 3Q78A 3LCAA 4WWOA 5DIZA 4UI9K 5AIJA 5DT2A 1BI7B 4BT9A 3ASHA 1U3DA 3FTVA 2R03A 4Q96A 1QQAA 4ABNA 3FU6A 2WXJA 5ENSD 3JCKC 1OWNA 4IYPA 4CGWA 1H2UA 1UXDA 1HF8A 3D9HA 1IQUA 4I2WA 4YNDA 4KYOB 4HXIA 3R1FA 4B8AA 3I4RB 1CQTA 2ONDA 4UWGA 2OCCE 3QF3A 2PUBA 5EKQD 3GZDA 4EZIA 4BTBA 1JCRA 2J9QA 5T8IA 4F3VA 1AWCB 2D5VA 2A4ZA 4M7CA 3TXMA 5LCWJ 3NROA 3ZHMA 3T5XA 2H6IA 1QPZA 2L0IA 1E8WA 4HRLA 2HYZA 2J09A 1KT0A 2F0YA 3N71A 3I4GA 3KD7A 3ZRHA 4J1XA 1NW3A 1TNOA 2ETBA 4BY6A 3SCGA 5DBKA 3SBSA 4U95D 2A5UA 3S7BA 3E33A 3QWWA 5JA4D 3CV0A 4V3IA 5BV0A 1IXVA 3LXUX 2LSUA 3Q49B 5JJ7A 3AU5A 3OQNA
chains in the Genus database with same CATH topology
4I1MA 3D9MA 3NQPA 3ZGQA 1H19A 3MYVA 3G5GA 2IUOA 4F7AA 2VTBA 3PXPA 4I6GA 4I1AA 1NA0A 4H7XA 3F51A 1KT1A 3OTNA 4QFVA 4PS3A 3UPVA 5LFAA 3BEEA 3FUEA 1SQMA 2EQXA 4G1TA 4DK5A 3UMVA 2PUCA 5JJTA 1LQCA 3L08A 1X2LA 2XEVA 3CHPA 3OAWA 2PE5A 3ZYQA 1WH6A 1UJJA 1OUVA 3SD5A 5M72A 2R1JL 4J8EA 1L5JA 1QNFA 1UN8A 1EYHA 2WM9A 3Q5MA 4FLHA 4LERA 3FEYA 3G2WA 5ARFA 3CK7A 3WXXA 4APOA 4KXKB 4ANUA 1HG5A 3ZEFA 2X38A 4FHJA 4EZJA 4G26A 2JLBA 2XRYA 4J8DA 3FU0A 2L0TB 3QNKA 3DNVB 3F6WA 1IC8A 3LFPA 1ADRA 2O4AA 3IKOB 5AYWD 4GU5A 3UT7A 3D3MA 4JHKA 1XWRA 4JXTA 2L9BA 2XQ0A 3QWGA 2IQCA 5JHBA 4H7YA 2JVLA 1MHQA 4FA6A 1INZA 4LEUA 4PU8A 4R7LA 3ZHEB 1ZZCA 5LOZA 2KZ8A 4C9BB 1XNFA 3AS4A 3PS6A 3IHYA 4JZYA 4JCXA 4YVOA 4X4FA 2J07A 2V8SE 5FQ6A 3D9KA 3PNLB 4WNGA 3TAXA 4BSXA 2WXOA 1SZ9A 1LCCA 4ACLA 5CCLA 4WUYA 1DNPA 4GMLA 4CRWA 2XJ3A 2KCVA 4FLBA 2GRMA 5G04J 3UUXA 3FTYA 4GZDA 2LYSA 2WB2A 3QQ6A 3IHVA 2I6HA 1RZRA 1LLIA 2A6CA 2BNNA 1UG3A 3FTXA 3LVRE 3MKQB 4PUCA 3FU5A 3RK6A 4DPRA 1JWLA 3JQ0A 4J8SA 4L23A 3TXNA 3RU0A 3CLJA 3CR3A 3ULQA 2KZTB 1NEQA 4OVVA 3KZ3A 2WMNA 3PE3A 3HVEA 4I6EA 1ELWA 4Z5CA 3ONKA 2FEZA 2YHCA 3QOUA 1SZAA 1IYGA 3CQGB 4Y6WA 3ZKCA 3VK0A 2NXPA 3CVLA 3D9OA 3B7TA 2IOLA 2IJGX 1PRAA 4I6JA 4AP2A 3MLFA 3FEXA 3ZXSA 5K98B 2JEKA 4U63A 3Q4AB 4EQFA 2UY1B 4N5CA 4YVQC 5G05C 4AVXA 1GW6A 2CG2A 2ILRA 4NQ0A 3CGHA 2PUEA 4TUUA 1FCHA 3URZA 2PM7A 3FTUA 3I3NA 3CVNA 4HLEA 3PH0C 5E75A 5JHAA 1IQRA 2WVIA 1S7EA 4U04A 4JVSA 3HHMA 2EWTA 1L1MA 3U66A 3S8QA 5J90A 4D10C 1WETA 3FTSA 3R7QA 3B7HA 4HFGA 2CHXA 3APDA 4UWFA 3FUMA 2LYQA 2X6FA 1PNRA 1VDYA 3TG5A 3L22A 4E85A 3D9LA 3U64A 1PAQA 4WNDA 3KJXA 2CFUA 5LX8A 4GYWA 5E76A 3ZN3A 3AU4A 5C1DA 4F1SA 3OXGA 3S7FA 3FFLA 3NZSA 3CVPA 4N39A 5KJLA 3ZHEA 4RVBA 5LCWC 1R69A 1N52A 3LS8A 3CHQA 3PRZA 2R63A 3QWVA 2KC7A 4I9EA 1WM5A 4BWRA 4L2LA 2J4BA 1FVFA 2XGSA 5T4YA 1YSEA 3SI5A 1JWGA 2I1KA 2X6JA 3ZHIA 3OP9A 4MLPA 2RD0A 3MKRA 3CSTA 1BPOA 2UWJG 4Q69A 4JCYA 3ESLA 3OXLA 2XHEA 4PU4C 2V0PA 2AW6A 2E2EA 3ZYKA 1ZZ8A 3SGHA 3ZFWA 3ZYLA 2KEKA 4NRHB 3FHEA 4UQXA 5CMWA 5KJNA 3CK8A 5BPPA 3RIBA 1NERA 1JH9A 2VSYA 4JEUA 1O4XA 2LYKA 2FI7A 4XE0A 1E8XA 3D9IA 4TRQA 3UT8A 4FHKA 3CLCA 2VGYA 3MKQA 1Y9QA 4FULA 2PM6A 2LYRA 3EHNA 1JPLA 3PNTB 2LSVA 2HINA 1E3OC 1PC2A 3O4ZA 2XGOA 2ICTA 3MV2B 3GZ1A 2X6IA 2KPJA 1UTXA 3FUIA 3P2BA 2Y4UA 4PU7A 3NF1A 4LCTA 3GZ2A 1OWMA 1UN9A 3FYAA 4A1SA 4RSYA 1B89A 1YA0A 3PEUB 4YARA 1QP4A 1JUQA 2R5SA 3FH5A 2ZU6B 3VTYA 2VTBB 1HXIA 4ATGA 4GPKA 1HF0A 3QAQA 4JHJA 3LISA 4AIFA 4YBAA 5BT1A 2PIJA 2OR1L 2UY1A 2BUGA 3HYMB 5LP0A 3T8MA 4B89A 1B0NA 3L54A 4MKTA 1E8ZA 2FO7A 2IVGA 4GB9A 4FP7A 5HQ8A 2MRIA 3ASDA 3D9JA 4KT6B 5FQ4A 4YG7B 4J8FA 4XX5A 4MS6A 3S7DA 5KJKA 1HE8A 2Q7FA 1UXCA 1DW9A 2X3MA 4GA0A 4Q94A 2B5AA 2HM8A 3PE4A 3JXBC 4G25A 2VSXE 5EX3A 2EBYA 2IVBA 3UT4A 1WY6A 2KEJA 4EPZA 4UQYA 3RRMB 5EX0A 2WXGA 5G55A 4F53A 1ZZ7A 3F52A 1P5QA 1FVHA 2VJ8A 3OQOA 3SFZA 3FUJA 3TRBA 4AM9A 4AJWA 1JWFA 3CHOA 2CFZA 2MEZA 4XI0A 3MA5A 2L49A 4DLQA 2VYIA 4FU3A 1EFAA 4JEHA 4DI4A 3FUDA 3MGBA 4KZ0A 4AEZC 4FBIA 2CHZA 4A1GA 3G2TA 3KAEA 4Y42A 3DPDA 4GZ6A 1RPEL 4L7TA 4MRUA 1ZZ6A 3QB2A 4HVBA 1NA3A 4GHJA 1ZPQA 2IU7A 1Y7YA 3JXCL 3FUFA 3JUIA 3P1UA 3FMYA 3QK0A 4UI9C 2M63A 4HOSA 3AS5A 1QQEA 2HR2A 2QFCA 2FJRA 3EJNA 3SNXA 3VLDA 4ANVA 5ANLA 1Z3YA 4N3CA 3LPZA 4C0EA 3EUSA 1OWOA 4IVZA 2FBNA 2IONA 2XCBA 1HZ4A 3QJZA 4ME2A 4XI9A 4BX8A 4G24A 2JCGA 2X6KA 3U3WA 2XPZA 5BW8C 3EDTB 1BDIA 4U0SA 2MQKA 2AVPA 4XKCA 3BS3A 4W9RA 4X4EA 2KZTA 3HVEB 5A7LA 2NC9A 3Q47B 2PUGA 3SCFA 2WXNA 3QDNA 4FC8A 4JA7A 5KJMA 2XCJA 4UWLA 2IVQA 4BFRA 3T5VA 1ZZ9A 3HDXA 2WMOA 3EIJA 3G2SA 5CMYA 2WQ7A 3MJWA 3LY7A 1TJCA 3JYSA 1ZBPA 3VTXA 3NZUA 1AU7A 4A3VA 2CG3A 4PS7A 3D9PA 4GAAA 2BNMA 2XIUA 4O8BA 5G05J 3ZVVA 3GBFA 4X4CA 5FT9A 3L6AA 1PRUA 2LYJA 1RZRD 2FULA 2QY7A 3GN5A 2PQRA 2WXHA 3B7RL 3CHMA 2NSZA 4GA1A 3TL5A 4X4IA 2J4DA 3GYZA 3JQ1A 3FU3A 4X4HA 3LDZA 4JC8A 5FZRA 3MV3B 2EF8A 3APFA 4APFA 2DIWA 5A6CA 4N2SA 2J49A 2X6HA 5KCMA 4URKA 4J1WA 2VQ2A 4LUNU 2O49A 4X4GA 4RG6A 3BG1B 4JQDA 3QWPA 4EECA 4BTAA 4IULA 1LCDA 2VGXB 1OCTC 4KMOA 3UX4A 2OOEA 3SZ7A 3RRUA 1Z6TA 3L1PA 1QP0A 2WQHA 4HOTA 1A17A 3LJ3A 5FTPA 2PZIA 3S7JA 1SQ8A 1LMB3 1XGWA 2IF4A 3BG0B 3G7DA 4WWNA 1WH8A 3CVUA 4ILIA 3UFDA 1ELRA 3TGOA 3CKBA 3CVXA 4WNFA 5A7DB 1OWLA 1U3CA 3CK9A 2XCCA 3VLFA 4ANWA 4BX9A 1GT0C 3SBTB 2P58C 2AXZA 3FDHA 4WNEA 4A3TA 1QZ2A 2VSNA 3L16A 3FYMA 3PZDA 4G11A 5ENNA 5FQ8A 5G2NA 3D9NA 4NACA 4YG4A 3OXFA 3SCHA 3QARA 1ELKA 2Y3AA 2LYLA 4KZCA 2E0IA 1PY1A 1Y8MA 5FZQA 2CROA 1ZUGA 4GZ5A 4RG9A 2R59A 4YG1A 3LYAA 2PUFA 3O9XA 5BUZA 2CSFA 1E96B 4GYOA 4A55A 1W3BA 4KVMA 2WXFA 2WXMA 1TEZA 5CHEE 2AUWA 3OQMA 3L13A 4CDMA 4CT0A 5D0OD 2WXQA 1ZZBA 3CROL 5FZSA 3ZYMA 1TJFA 2HO1A 2LAHA 4G23A 3BDNA 4CT4A 5ANRA 2WXLA 3IV0A 4GZ3A 4P29A 3S2AA 4OB4A 1QP7A 1EF1C 2DBAA 3SHFA 2H8RA 4IWRA 3EHMA 4FJYA 4AV7A 5JJ6A 2YINA 4Z59A 3PEVB 3PUKA 3U4TA 4U0ZA 4HOUA 3RO2A 2XSDC 1HU3A 2L6JA 3FH7A 3PUJA 3FP3A 3FWVA 1RIOA 1KLXA 4M3OA 5FWQA 3R9AB 4GQMA 3PVLA 3QC1A 2GGFA 2OFYA 4CGVA 3LY8A 3RRNB 1CJGA 3ZW3A 2OVBA 3MX3A 5A23A 4CEMA 4XKBA 2AWIA 3B7SA 4JW1A 1NP7A 2KCLA 2GRLA 4XIFA 4WAFA 1HS6A 4HORA 3RKVA 2LNIA 4OVUA 4FN3A 2AXUA 5AJLA 1E7UA 2MOWA 2DCPA 4DLOA 2YNQA 3BD1A 2GW1A 2KM4A 3K9IA 4EZLA 4ACKA 3ML8A 4JHRA 1ZVVA 3IVPA 3FY4A 3FUHA 4JPSA 4XZ4A 1QQBA 2IV1A 4KBQA 1VPWA 5ARGA 3FTWA 5FQ7A 3ASGA 5BV1A 2I2OA 2BNOA 3HIZA 3PREA 4I8TA 2C0LA 2C0MA 1NZNA 2RG8A 3ZIMA 2WXRA 3OMTA 4HOQA 4IA8A 3JXDL 2J08A 3H5TA 2C2LA 1WAO1 4O6FA 1HO8A 4EZKA 5EDSA 4X4BA 3MEKA 3FH8A 4GZCA 4UI9J 3IEGA 4CDNA 2WXKA 3CEQA 1IHGA 3CVQA 1RZSA 3FUKA 4HS2A 5D0QD 3FULA 3B7UX 2AXVA 4L2YA 3R7RA 2CHWA 3TG4A 4AOFA 1LF8A 2XPIA 4N2QA 4I6TA 2KEIA 2YQ8A 1R63A 5AJDA 4L1BA 4B94A 1POUA 2GZUA 1Z3XA 3QKYA 4Z5HA 2LCVA 4U07A 4U0UA 4AY5A 4OYSA 4DJAA 2MHKA 4NDWA 3ASFA 1E7VA 3G2VA 1H0AA 1E90A 1WIZA 4F8DA 2BJCA 3DBSA 3E4BA 4I17A 2V5FA 1OSLA 3KXAA 4IRUA 4J6IA 1BDHA 4E6HA 3CHRA 4I9CA 1ZS4A 3L17A 2I9CA 2R17C 1ZU2A 3CSFA 4Y6CA 3CQCB 4WWPA 4GA2A 4TV3A 1Y6IA 3LVQE 4NURA 3RZZA 3C98A 3B13A 3SF4A 3ONLA 3RJVA 4EBAA 2FF4A 3LCAA 2WXPA 1N54A 4WWOA 5DIZA 5G04C 4UI9K 5AIJA 4GMJA 4BT9A 3AS8A 1X5BA 2WIUB 2IOSA 3ASHA 2PUDA 1U3DA 2I1JA 1HH8A 2KCKA 4CDRA 3FTVA 2YHEA 4GCNA 2KATA 4Q96A 1JFTA 2PPXA 5FJYA 2VSOE 3ENEA 1QQAA 4PU3C 2PQNA 4AY6A 3I5PA 4EBAG 4UWHA 4ABNA 4JA9A 3VLEA 2OV8A 3APCA 2WXJA 2V4LA 3FU6A 4ANXA 3JCKC 2VGXA 1OWNA 4B8CB 4IYPA 1H2TC 4CGWA 3FUNA 3D1NI 4G2VA 4K0RA 3MCXA 3LY9A 2O38A 1H2UA 1UXDA 1HF8A 4K03A 5BNWA 3HZIB 1IQUA 2Y4TA 2BF0X 4I2WA 3GW4A 3RO3A 4J0UA 4I6UA 4KYOB 4YNDA 4HXIA 3LKUA 2LO6A 3PDNA 4MCXA 1JFSA 2OVFA 4IN3B 4AXHA 3CVVA 4Z5DA 3R1FA 4B8AA 4UQZA 3I4RB 5CCMA 4KVOA 4N3BA 3UQ3A 1CQTA 2ONDA 3CHSA 4UWGA 4LRZA 2IFUA 3QF3A 1HG2A 2L8NA 4Z58A 2PUBA 5EKQD 4BTBA 3FTZA 3MZLB 4PDXA 4GYYA 1HFAA 5C2YA 2XPYA 2J9QA 5T8IA 1E8YA 4F3VA 1EDUA 2D5VA 2A4ZA 2PUAA 1S0PA 2ICPA 3KEZA 3ESKA 1UW4B 4FJZA 3TXMA 3EIQC 4I2ZA 4CCAA 5LCWJ 3ZHMA 1OWPA 2PL2A 2LYPA 3T5XA 5HI7A 5AENA 1QPZA 5J08A 3ZPJA 2L0IA 1E8WA 2HYZA 4PS8A 1DVPA 2WQ6A 2J09A 1KT0A 4X4DA 2IU1A 3ML9A 3N71A 4PH4B 3KS2A 4I1OB 2WUSR 1PERL 2WPVA 3I4GA 3KD7A 1X57A 3ZRHA 1EPUA 4J1XA 4I43A 3Q15A 2HSGA 2XI8A 1PRVA 3CIAA 4JL0A 4BY6A 4MCTA 4GCOA 4C0MA 3GZSA 3SCGA 3GN5B 5DBKA 3LEWA 3SBSA 1H2VC 4ILHB 1ZAYA 2LAIA 1UJKA 2XRZA 2A5UA 4UWKA 3S7BA 4DI3A 3O48A 3TJPA 3QWWA 3CV0A 1MQSA 1H6KA 3G2UA 3IBEA 4V3IA 3CKCA 5BV0A 3LXUX 3CVYA 1DWKA 3CVWA 2LSUA 4I6RA 5T3RA 3U9WA 4N3AA 1HX8A 3CECA 2WXIA 3Q49B 4U8HA 4BT8A 4B0ZA 5JJ7A 2XGMA 3AU5A 4FADA 2BTDA 3QYXA 4ILGA 3OQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEI A;  1R63 A;  3ZHI A;  3G5G A;  2IUO A;  1POU A;  2GZU A;  3OP9 A;  3PXP A;  4X4I A;  4Z5H A;  4JCY A;  2LCV A;  4X4H A;  3F51 A;  4NDW A;  4PU4 C;  2AW6 A;  2EF8 A;  1ZZ8 A;  1WIZ A;  4F8D A;  2KEK A;  2BJC A;  4J1W A;  2O49 A;  4X4G A;  1OSL A;  2PUC A;  3KXA A;  4JQD A;  1LQC A;  1LCD A;  1X2L A;  1NER A;  1JH9 A;  1BDH A;  2PE5 A;  1O4X A;  1WH6 A;  2LYK A;  1OCT C;  3L1P A;  1QP0 A;  1ZS4 A;  2R1J L;  3CLC A;  1SQ8 A;  1Y9Q A;  1LMB 3;  2LYR A;  3G7D A;  1WH8 A;  2HIN A;  1E3O C;  3RZZ A;  3UFD A;  2ICT A;  2KPJ A;  1UTX A;  4PU7 A;  3DNV B;  3F6W A;  1GT0 C;  3FYA A;  2AXZ A;  3LFP A;  1IC8 A;  2WIU B;  2O4A A;  1ADR A;  3FYM A;  2PUD A;  4YAR A;  1QP4 A;  4YG4 A;  3SCH A;  1XWR A;  1HF0 A;  2LYL A;  1JFT A;  2PPX A;  3LIS A;  3QWG A;  4YBA A;  1QQA A;  2CRO A;  4PU3 C;  1ZUG A;  2JVL A;  2PIJ A;  2OR1 L;  4PU8 A;  4YG1 A;  1ZZC A;  2PUF A;  1B0N A;  2KZ8 A;  3O9X A;  2CSF A;  4JCX A;  2IVG A;  2AUW A;  4X4F A;  3OQM A;  4YG7 B;  3D1N I;  1ZZB A;  3CRO L;  1UXC A;  1DW9 A;  1LCC A;  2B5A A;  2XJ3 A;  3BDN A;  3JXB C;  2O38 A;  1UXD A;  2GRM A;  2EBY A;  3HZI B;  2LYS A;  2IVB A;  4OB4 A;  3QQ6 A;  1QP7 A;  2KEJ A;  2H8R A;  4IWR A;  1RZR A;  1LLI A;  2A6C A;  2BNN A;  4I6U A;  1ZZ7 A;  3F52 A;  4Z59 A;  3OQO A;  1JWL A;  3TRB A;  4MCX A;  1JFS A;  2XSD C;  4Z5D A;  3R1F A;  2MEZ A;  1RIO A;  1NEQ A;  2L49 A;  4GQM A;  3KZ3 A;  1CQT A;  1EFA A;  3QF3 A;  4FBI A;  4Z5C A;  2L8N A;  4Z58 A;  2OFY A;  2PUB A;  1RZR D;  4Y42 A;  3ZKC A;  1CJG A;  3VK0 A;  1RPE L;  1ZZ6 A;  4GHJ A;  1ZPQ A;  1PRA A;  2IU7 A;  1Y7Y A;  3MLF A;  3JXC L;  2D5V A;  3FMY A;  2PUA A;  2AWI A;  2ICP A;  5K98 B;  2FJR A;  2GRL A;  3ZHM A;  2LYP A;  1QPZ A;  3EUS A;  2PUE A;  4IVZ A;  4FN3 A;  2AXU A;  4X4D A;  2JCG A;  3BD1 A;  3U3W A;  1S7E A;  2WUS R;  1PER L;  1ZVV A;  3IVP A;  1X57 A;  2EWT A;  4J1X A;  1L1M A;  2IV1 A;  2MQK A;  3S8Q A;  3BS3 A;  1BDI A;  1QQB A;  1VPW A;  1WET A;  2HSG A;  2XI8 A;  1PRV A;  4X4E A;  3B7H A;  2BNO A;  4MCT A;  5A7L A;  2PUG A;  2LYQ A;  3SCF A;  3SCG A;  3GN5 B;  1PNR A;  4I8T A;  2XCJ A;  2IVQ A;  1ZAY A;  1ZZ9 A;  3KJX A;  3OMT A;  4IA8 A;  3JXD L;  3H5T A;  4X4B A;  1AU7 A;  1DWK A;  4I6R A;  1R69 A;  3CEC A;  2R63 A;  1RZS A;  2BNM A;  2XIU A;  4O8B A;  2AXV A;  3GBF A;  4X4C A;  3QYX A;  1PRU A;  2LYJ A;  1YSE A;  3OQN A;  3GN5 A;  4I6T A; 
#chains in the Genus database with same CATH topology
 3NQP A;  3MYV A;  4J8Y A;  2VTB A;  1NA0 A;  4H7X A;  3F51 A;  4GTS A;  2QYU A;  3FUE A;  2PUC A;  3L08 A;  1X2L A;  5JUW A;  3CHP A;  1OUV A;  3SD5 A;  2M4H A;  2R1J L;  1UN8 A;  1QNF A;  1EYH A;  4ANU A;  4EZJ A;  2XRY A;  3M9L A;  4J8D A;  2XXA A;  3DNV B;  2GRO B;  3LFP A;  2O4A A;  2BED A;  3IKO B;  2PNN A;  3KSQ A;  4JHK A;  2L9B A;  2IQC A;  4PU8 A;  5LOZ A;  2QC9 A;  4C9B B;  1XNF A;  4JCX A;  2R02 A;  2P9I G;  3PNL B;  1S63 A;  2WXO A;  1SZ9 A;  1LCC A;  3HXB A;  2GRM A;  1U2Z A;  1K8K G;  4DX2 A;  2I6H A;  1LLI A;  2A6C A;  1FT2 A;  1JWL A;  3Q9U C;  3TWX A;  4I6E A;  2XS8 A;  2YHC A;  2ZGG A;  3VK0 A;  2EIM E;  3B7T A;  3QFI A;  3UIO C;  4Q2J A;  3Q4A B;  4EQF A;  4AVX A;  2ILR A;  3R09 A;  1FCH A;  3ZKJ A;  1S7E A;  3FTS A;  4GTO A;  1OY3 D;  3R7Q A;  4TXP A;  3APD A;  3FUM A;  2LYQ A;  3TG5 A;  3L22 A;  1PAQ A;  4WND A;  4BSZ B;  3ZN3 A;  1BD8 A;  4ATZ D;  3CVP A;  4GTT A;  4RVB A;  1R69 A;  1N52 A;  5LCW C;  3PRZ A;  2R63 A;  3QWV A;  2KC7 A;  4BWR A;  1FVF A;  3ZHI A;  4MLP A;  2RD0 A;  3CST A;  4ZFH A;  4PU4 C;  2V0P A;  1MZC A;  3SGH A;  3ZFW A;  1TR4 A;  4NRH B;  5KJN A;  1LTX A;  5BPP A;  1NER A;  3S7J A;  4XE0 A;  3JUE A;  3D9I A;  1Y9Q A;  3PNT B;  5LX8 A;  3EHN A;  1QYM A;  3TEP A;  1PC2 A;  2XGO A;  4GPM A;  4K5A B;  4EHM A;  3GZ1 A;  2X6I A;  2KPJ A;  3E32 A;  3NF1 A;  3GZ2 A;  3FYA A;  1B89 A;  1YA0 A;  3J5P A;  1JUQ A;  4ATG A;  3LIS A;  5HRY A;  4ER0 A;  3OKZ A;  2P9L G;  5LP0 A;  3ASD A;  4HLL A;  3S7D A;  3MEJ A;  4Q94 A;  2XEH A;  3PZ3 A;  4ER3 A;  2EBY A;  2IVB A;  1ZB1 A;  5EX0 A;  2QYJ A;  4YDW A;  3SFZ A;  2A5E A;  4U7E B;  5HKP A;  1N4R A;  4JD2 G;  2L49 A;  4DLQ A;  4FU3 A;  4DI4 A;  3FUD A;  5CER B;  1MFQ C;  2CHZ A;  3G2T A;  4GZ6 A;  3UM1 A;  3DPD A;  4MRU A;  3JXI A;  1ZPQ A;  2IU7 A;  4UI9 C;  1QQE A;  4N3C A;  4IVZ A;  3Q73 A;  3F6Q A;  4G8K A;  5AQ9 A;  3HG0 D;  2MQK A;  3HXD A;  4W9R A;  3HVE B;  5A7L A;  4DX7 D;  4JA7 A;  2IVQ A;  2RFM A;  4BFR A;  2WMO A;  5CMY A;  3JYS A;  1ZBP A;  1AU7 A;  4A3V A;  3SFX A;  4O8B A;  1LD7 A;  4U8Y D;  1D8E A;  3B7R L;  4JC8 A;  2J4D A;  2GRR B;  4X4H A;  5KNH D;  4X4G A;  4JQD A;  1Z5S C;  3QWP A;  2H6F A;  4KMO A;  3L1P A;  1A17 A;  3LJ3 A;  1XGW A;  2IF4 A;  1ELR A;  1O1R A;  3C3R A;  2P58 C;  3FDH A;  1QZ2 A;  2Y1L E;  3FYM A;  5FQ8 A;  3D9N A;  4NAC A;  4YG4 A;  3OXF A;  3QAR A;  4KZC A;  2E0I A;  2OEV A;  5FZQ A;  3TWV A;  4OBM A;  5ENO D;  4GTM A;  3LYA A;  2P9U G;  4A55 A;  4CT0 A;  5D0O D;  2LLW A;  4G23 A;  4DRX E;  3UM3 A;  4AV7 A;  4U0Z A;  4HOU A;  1RIO A;  4GQM A;  3PVL A;  1SW6 A;  2PXQ A;  2OFY A;  4HRM B;  4CGV A;  3DXK G;  1SA4 A;  5KBA A;  3MX3 A;  5A23 A;  3TWU A;  1X81 A;  3DSW A;  1NP7 A;  2LNI A;  4FN3 A;  2AXU A;  3BU8 A;  5AJL A;  2MOW A;  2FO1 E;  2YNQ A;  3BD1 A;  5CRU A;  2LUH A;  3ML8 A;  3IVP A;  2B0O E;  2IV1 A;  1VPW A;  3HIZ A;  1WDY A;  2C0M A;  2PXL A;  3OMT A;  3JXD L;  5AQB A;  4GZC A;  3IEG A;  3QOW A;  1IHG A;  3CVQ A;  3B7U X;  2AXV A;  2CHW A;  4U96 D;  2LCV A;  4OYS A;  4NDW A;  3BUA A;  2BJC A;  1UOH A;  4I17 A;  5CEA A;  1NI1 A;  1ZS4 A;  1ZU2 A;  3CSF A;  3L9T A;  5B3S E;  1Y6I A;  3TWQ A;  4NUR A;  3LVQ E;  3RZZ A;  3B13 A;  3ONL A;  2WXP A;  1N54 A;  3ULY A;  3DWL G;  2OEW A;  5DTR A;  3AS8 A;  2I1J A;  1HH8 A;  2KCK A;  5ENP D;  3VWS A;  2KAT A;  1HQ1 A;  4JA9 A;  4TUM A;  2YBD A;  1MX2 A;  3FUN A;  3D1N I;  4G2V A;  3NOC D;  4K0R A;  2O38 A;  3HZI B;  2Y4T A;  4J0U A;  3ME5 A;  3AAA C;  3C72 A;  2LO6 A;  3CVV A;  3B95 A;  5CCM A;  1N95 A;  4KVO A;  4N3B A;  3CHS A;  3PZ4 A;  4PDX A;  4XEI G;  5C2Y A;  1E8Y A;  1EDU A;  2PUA A;  3KEZ A;  3A9X A;  1UW4 B;  4CCA A;  2PL2 A;  5HI7 A;  2HFZ A;  1DVP A;  1FPP A;  1JCQ A;  5AN8 A;  2WUS R;  2WPV A;  1X57 A;  2MYO A;  1FT1 A;  2HSG A;  3GZS A;  4ILH B;  1ZAY A;  2BKK B;  4UWK A;  4U8V D;  3TJP A;  1MQS A;  3IBE A;  3CVY A;  1DWK A;  3CVW A;  5T3R A;  3U9W A;  5J90 A;  4N3A A;  4U8H A;  4BT8 A;  4B0Z A;  3QYX A;  3ZGQ A;  3G5G A;  3UTM A;  4L9P A;  5LFA A;  2EQX A;  3UMV A;  5CED B;  3ZYQ A;  5M72 A;  1L5J A;  2NYJ A;  5ARF A;  3CK7 A;  4APO A;  5CBO A;  3ZEF A;  2X38 A;  2VGE A;  3FU0 A;  3ASO E;  2L0T B;  1IC8 A;  2R05 A;  4GU5 A;  4JXT A;  2JVL A;  1MHQ A;  1INZ A;  2P9P G;  3AS4 A;  3IHY A;  2JAB A;  2J07 A;  2V8S E;  4WNG A;  3TAX A;  4GML A;  4CRW A;  4GZD A;  2LYS A;  4G8L A;  3QQ6 A;  4XKB A;  3DM5 A;  2DZN A;  1S64 A;  3FTX A;  1N4Q A;  3V2X A;  3JQ0 A;  4L23 A;  3RSE G;  2HE0 A;  3CLJ A;  3ULQ A;  1NEQ A;  3KZ3 A;  3PE3 A;  1ELW A;  3ONK A;  2FEZ A;  3ZKC A;  2NXP A;  2DYR E;  2IJG X;  3AJI A;  3FEX A;  3ZXS A;  5K98 B;  2JEK A;  4N5C A;  1GW6 A;  2PUE A;  1KZP A;  1QZX A;  3URZ A;  3FTU A;  5E75 A;  2DYS E;  1IQR A;  3HHM A;  3S8Q A;  4HI8 A;  2X6F A;  1VDY A;  1OCR E;  4E85 A;  3U64 A;  3ZU7 B;  3NBN B;  3TFL A;  3OXG A;  3S7F A;  5KJL A;  3ISM C;  2KBX A;  3CHQ A;  4YDE A;  4OAV B;  5T4Y A;  1YSE A;  2I1K A;  1BPO A;  2UWJ G;  5EYP F;  4JCY A;  4Q69 A;  3OXL A;  2AW6 A;  1ZZ8 A;  4EKG A;  2KEK A;  1O1T A;  3CK8 A;  4O1O A;  2VSY A;  4JEU A;  3TWT A;  3CLC A;  3MKQ A;  4N5Q A;  4TXR A;  2LSV A;  2HIN A;  1N0R A;  2ICT A;  4DX5 D;  3FUI A;  2PXF A;  3P2B A;  4LCT A;  4A1S A;  2F8X K;  4RSY A;  2EIJ E;  3PEU B;  2IO3 C;  4GPK A;  3QAQ A;  2AJA A;  2ETC A;  3T8M A;  4MKT A;  4LNB A;  1TN6 A;  1OCZ E;  4GB9 A;  2IVG A;  2MRI A;  4KT6 B;  4J8F A;  2Q7F A;  2J8S D;  3ZNG A;  1YCS B;  2HM8 A;  3GZC A;  2VSX E;  1H6O A;  2KEJ A;  3ABK E;  3ZPX A;  3NB2 A;  1DC2 A;  2VJ8 A;  3FUJ A;  3NZL A;  1EFA A;  4FBI A;  4A1G A;  3KAE A;  1RPE L;  3QB2 A;  1NA3 A;  3HRA A;  3JXC L;  3FMY A;  3QK0 A;  2HR2 A;  3TWS A;  3LPZ A;  4C0E A;  2XCB A;  2FBN A;  4ME2 A;  4G24 A;  2JCG A;  3U3W A;  3EU9 A;  4K5C A;  5BW8 C;  3EDT B;  4XKC A;  2AVP A;  3ABL E;  3BS3 A;  4GTP A;  3Q47 B;  4EKI A;  3SCF A;  2WXN A;  3QDN A;  5B1B E;  5KJM A;  3T5V A;  3G2S A;  2LXL A;  4PS7 A;  5FT9 A;  2LYJ A;  1RZR D;  2FUL A;  3B7B A;  2PQR A;  2WXH A;  2NSZ A;  4GA1 A;  3TL5 A;  4X4I A;  3JQ1 A;  3LDZ A;  4APF A;  2DIW A;  2X6H A;  4URK A;  4HB5 A;  4O60 A;  2XEN A;  4RG6 A;  4YDY A;  4BTA A;  1LCD A;  3UX4 A;  4HOT A;  1OXJ A;  5AAR A;  5FTP A;  1LMB 3;  3BG0 B;  3G7D A;  4WWN A;  3DXM G;  4ILI A;  3TGO A;  2R2L A;  3G0T A;  3CVX A;  4WNF A;  1OWL A;  5AQA A;  3VLF A;  4BX9 A;  4A3T A;  3L16 A;  3PZD A;  5EIB E;  4G11 A;  5G2N A;  1D9S A;  2ZXW E;  1ZUG A;  2LLV A;  2R59 A;  4YG1 A;  2PUF A;  5BUZ A;  1TEZ A;  1W3B A;  2WXF A;  3C5R A;  3W9F A;  3OQM A;  4HQD A;  3CRO L;  5FZS A;  3ZYM A;  1TJF A;  2LAH A;  3BDN A;  3S2A A;  4OB4 A;  2DWZ A;  4FJY A;  5JJ6 A;  2YIN A;  3PUK A;  3U4T A;  5IY5 E;  1BU9 A;  1O5M A;  3FH7 A;  2L6J A;  5ENT D;  3PUJ A;  3FWV A;  3R9A B;  4M3O A;  1U2V G;  2PXT A;  3ZW3 A;  1CJG A;  5CRV A;  5DSX A;  4JW1 A;  2KCL A;  3DSX A;  2GW1 A;  3K9I A;  5ITZ F;  4EZL A;  3FY4 A;  1QQB A;  4KBQ A;  3FTW A;  2RG8 A;  3J5Q B;  3DSV A;  2V4H C;  4HOQ A;  3UIP C;  4EZK A;  2J08 A;  1DUL A;  5EDS A;  4X4B A;  4CDN A;  1RZS A;  5D0Q D;  4AOF A;  3FUL A;  3R7R A;  3TG4 A;  4I6T A;  4L1B A;  2GZU A;  4U0U A;  1E90 A;  2V5F A;  1OSL A;  1BDH A;  3ZXP A;  4WWP A;  4GA2 A;  3AG3 E;  3DSU A;  2MXD A;  3C98 A;  1SA5 A;  4EBA A;  2FF4 A;  2IEJ A;  2QZA A;  3NDB B;  4GMJ A;  3NAW A;  1X5B A;  1K1B A;  2IOS A;  2PUD A;  4J7W A;  4HRA A;  4GCN A;  1JFT A;  5FJY A;  2VSO E;  4DX1 A;  2PQN A;  2ZGD A;  4UWH A;  3VLE A;  2OV8 A;  2V4L A;  1KZO A;  3ABM E;  3MCX A;  3LY9 A;  5BNW A;  2BF0 X;  3GW4 A;  3RO3 A;  3QOX A;  4MCX A;  4IN3 B;  2OVF A;  2XZD G;  4Z5D A;  3KL4 A;  2IFU A;  3FTZ A;  2HCN A;  2XPY A;  1N4S A;  4NIK A;  3HXC A;  3HXF A;  3ESK A;  4FJZ A;  3EIQ C;  5J08 A;  3ZPJ A;  4PS8 A;  2WQ6 A;  4X4D A;  2IU1 A;  5DTM A;  2XI8 A;  1PRV A;  3CIA A;  4JL0 A;  4MCT A;  4GCO A;  2ZIR A;  3Q75 A;  1UJK A;  2XRZ A;  3O48 A;  2XXQ A;  1H6K A;  3BQO A;  4I6R A;  1HX8 A;  3CEC A;  2WXI A;  2XGM A;  3DST A;  4ILG A;  3D9M A;  3EU5 A;  1H19 A;  4F7A A;  2PXP A;  2PXE A;  1TNB A;  4I6G A;  4I1A A;  3NXH A;  2HCS A;  1KT1 A;  3SFY A;  4QFV A;  1SQM A;  4DK5 A;  4G1T A;  3V30 A;  1LQC A;  2XEV A;  3OAW A;  2PE5 A;  1WH6 A;  4J8E A;  3KEA A;  1V55 E;  3G2W A;  3FEY A;  3EHR A;  3WXX A;  1HG5 A;  4G26 A;  2JLB A;  3UM2 A;  3F6W A;  5AYW D;  4A63 B;  5EIL A;  3UT7 A;  3D3M A;  1NL4 A;  1DCQ A;  3E30 A;  2XQ0 A;  3QWG A;  4RLY A;  4H7Y A;  2PXK A;  4BET A;  1ZZC A;  2KZ8 A;  3NOG D;  4JZY A;  4EK9 A;  1MX6 A;  2P2C P;  4YVO A;  4WVL A;  4X4F A;  2GRQ B;  5FQ6 A;  4BSX A;  5CCL A;  4GMR A;  3SR4 A;  2XJ3 A;  1QBQ A;  4RQI A;  2KCV A;  5G04 J;  3UUX A;  3FTY A;  2WB2 A;  1RZR A;  1UG3 A;  2BNN A;  3LVR E;  3RK6 A;  4PUC A;  4DPR A;  3TXN A;  3RU0 A;  3CR3 A;  2WMN A;  3HVE A;  1SZA A;  3CQG B;  4Y6W A;  4I6J A;  1Q2Z A;  5FIO A;  4O1P A;  2UY1 B;  5HS0 A;  2CG2 A;  2XEE A;  3CGH A;  4TUU A;  2PM7 A;  5JHA A;  1L1M A;  2EWT A;  4CZ2 D;  1KPS B;  4D10 C;  3B7H A;  2CHX A;  4LG6 A;  4X8Q A;  2CFU A;  4GTQ A;  4GYW A;  1MJ0 A;  5E76 A;  5C1D A;  3AU4 A;  3DRA A;  4N39 A;  3LS8 A;  4I9E A;  1WM5 A;  4YDO A;  2J4B A;  2XGS A;  2RKK A;  3AG1 E;  3GUU A;  1NFI E;  2XHE A;  5EID A;  2E2E A;  3ZYK A;  4DE9 A;  3FHE A;  4UQX A;  3RIB A;  1JH9 A;  5DTQ A;  2FI7 A;  4FHK A;  1E3O C;  1TN8 A;  3TWR A;  2Y4U A;  1UN9 A;  2L1P A;  5EYL A;  4YAR A;  4MBG A;  3FH5 A;  3VTY A;  4JHJ A;  1N11 A;  3GZD C;  4AIF A;  2IY0 C;  2PIJ A;  2UY1 A;  3HYM B;  2H6G A;  4B89 A;  1B0N A;  5BXO A;  1E8Z A;  4FP7 A;  4YG7 B;  1DW9 A;  3JXB C;  3EHQ A;  4G25 A;  5EX3 A;  3UT4 A;  1WY6 A;  4EPZ A;  4UQY A;  5G55 A;  4F53 A;  1P5Q A;  1FVH A;  3A9Z A;  3OQO A;  4AJW A;  3CHO A;  2MEZ A;  4XI0 A;  2VYI A;  3MGB A;  4AEZ C;  4LNG A;  3UXG A;  1ZZ6 A;  2F37 A;  4GHJ A;  3PEV B;  3JUI A;  4AM9 A;  3IXE A;  5CEC B;  4HOS A;  3AS5 A;  2QFC A;  1A5E A;  2FJR A;  3EJN A;  3VLD A;  5ANL A;  1Z3Y A;  3EUS A;  4F1P A;  3QJZ A;  4XI9 A;  1HZ4 A;  2JQE A;  2XPZ A;  2ETA A;  1AP7 A;  2VEO A;  4X4E A;  5ENR D;  2KZT A;  2PUG A;  5D2M C;  2XCJ A;  3HDX A;  2WQ7 A;  3LY7 A;  3NZU A;  5GAH i;  5B1A E;  3D9P A;  2BNM A;  2XIU A;  5G05 J;  3ZVV A;  3GBF A;  4X4C A;  3L6A A;  2V3C C;  3GYZ A;  3FU3 A;  4N2S A;  2J7W A;  3UKR G;  2O49 A;  1N0Q A;  3BG1 B;  4IUL A;  1OCT C;  3RRU A;  1Z6T A;  2WQH A;  3DEP A;  2PZI A;  1SQ8 A;  3CVU A;  2EIL E;  3CKB A;  5A7D B;  1U3C A;  2XCC A;  1GT0 C;  2AXZ A;  4TXQ A;  2VSN A;  3SCH A;  2Y3A A;  1PY1 A;  1Y8M A;  2CRO A;  3ZUV B;  4RG9 A;  5D66 A;  3O9X A;  2CSF A;  1TYQ G;  4GYO A;  5CHE E;  2AUW A;  3L13 A;  1SVX A;  3A9Y A;  3W9G A;  4ER7 A;  2HO1 A;  4CT4 A;  5ANR A;  2WXL A;  4GZ3 A;  4P29 A;  3OWQ A;  1QP7 A;  1EF1 C;  2DBA A;  1QB2 A;  2H8R A;  4IWR A;  3HXE A;  3RO2 A;  2XSD C;  3ZYL A;  1K1A A;  5FWQ A;  4BER A;  4QQI A;  3QC1 A;  3V2O A;  2GGF A;  3LY8 A;  1V54 E;  2AWI A;  3B7S A;  2LNM A;  2GRL A;  4WAF A;  1HS6 A;  1E7U A;  2PXD A;  2KM4 A;  2ZIS A;  4ACK A;  4JHR A;  1ZVV A;  1RW2 A;  5ARG A;  5FQ7 A;  5AAO A;  2P9S G;  3C3O A;  5BV1 A;  2I2O A;  4I8T A;  2C0L A;  1NZN A;  4DE8 A;  3ZIM A;  2WXR A;  4IA8 A;  3H5T A;  1HO8 A;  3SQV A;  3CEQ A;  4HS2 A;  5JJT A;  4L2Y A;  2KEI A;  1R63 A;  1TN7 A;  1Z3X A;  4B94 A;  3QKY A;  1MYO A;  4U07 A;  4AY5 A;  4DJA A;  2Y0B G;  2MHK A;  3DSS A;  4BEP A;  3G2V A;  3WG7 E;  1H0A A;  3ASN E;  2GRP B;  3DBS A;  3E4B A;  4IRU A;  4J6I A;  2R17 C;  4Y6C A;  4TV3 A;  1H6P A;  2Y69 E;  3UWP A;  5G04 C;  4B93 B;  4LSZ E;  2WIU B;  2F8Y A;  4CDR A;  2YHE A;  2PPX A;  3ENE A;  4PU3 C;  4AY6 A;  3I5P A;  4EBA G;  3C3Q A;  3APC A;  3L82 A;  4ANX A;  2VGX A;  4B8C B;  1H2T C;  4K03 A;  3DEO A;  3PE5 A;  4I6U A;  3V79 K;  1S70 B;  3LKU A;  3PDN A;  1JFS A;  4AXH A;  3EUV A;  4UQZ A;  2DZO A;  3UQ3 A;  4LRZ A;  1HG2 A;  2L8N A;  4Z58 A;  3MZL B;  4GYY A;  1OCO E;  1HFA A;  1S0P A;  1YYH A;  2ICP A;  4I2Z A;  1OWP A;  5AEN A;  2LYP A;  2J7U A;  3LQX A;  5FIN A;  1DCE A;  3ML9 A;  4PH4 B;  3KS2 A;  4I1O B;  1PER L;  1EPU A;  1D8D A;  3Q7A A;  4I43 A;  3Q15 A;  5KNG A;  4C0M A;  3GN5 B;  3LEW A;  1H2V C;  2LAI A;  4DI3 A;  3G2U A;  4K5B A;  3CKC A;  4HNA D;  4FAD A;  5KWD A;  2BTD A;  2PXU A;  5ENQ D;  4I1M A;  2EIK E;  2IUO A;  3PXP A;  1N94 A;  3Q79 A;  3OTN A;  4PS3 A;  5EN5 D;  3UPV A;  3BEE A;  3SY2 A;  2V5Q C;  2L6B A;  1UJJ A;  2WM9 A;  4LER A;  3Q5M A;  4FLH A;  4KXK B;  4FHJ A;  3E37 A;  3QNK A;  1ADR A;  1XWR A;  2IO2 C;  3Q9N C;  3E34 A;  3JXJ A;  5JHB A;  4FA6 A;  4LEU A;  4R7L A;  3ZHE B;  3PS6 A;  3DPY A;  3D9K A;  4ACL A;  4WUY A;  1DNP A;  3ULE G;  1N4P A;  4FLB A;  1YMP A;  3IHV A;  4ZHB A;  3MKQ B;  3FU5 A;  3AG2 E;  4J8S A;  2KZT B;  4OVV A;  4Z5C A;  3QOU A;  1IYG A;  3LJN A;  3PZ1 A;  3CVL A;  3UIN C;  3D9O A;  2IOL A;  1PRA A;  4AP2 A;  3MLF A;  2XS1 A;  4UUC A;  2BKG A;  4U63 A;  4F6R D;  4YVQ C;  5G05 C;  2LXM A;  4NQ0 A;  4HLE A;  3I3N A;  3CVN A;  3PH0 C;  2WVI A;  4U04 A;  4JVS A;  2FFH A;  1BLX B;  2XXP A;  3U66 A;  3TWW A;  1WET A;  1N9A A;  4HFG A;  4UWF A;  1PNR A;  5BXU A;  3D9L A;  4CYM D;  3KJX A;  3UI2 A;  4F1S A;  3FFL A;  3NZS A;  3ZHE A;  4L2L A;  3SI5 A;  1BI8 B;  1JWG A;  2X6J A;  3TEL A;  3OP9 A;  4ER6 A;  3MKR A;  3ESL A;  5CMW A;  1O4X A;  2LYK A;  1E8X A;  4TRQ A;  3UT8 A;  2VGY A;  4FUL A;  2PM6 A;  2LYR A;  1JPL A;  4C48 B;  3O4Z A;  3MV2 B;  1UTX A;  4PU7 A;  1OWM A;  1MX4 A;  1QP4 A;  2R5S A;  2VTB B;  2ZU6 B;  1HXI A;  1HF0 A;  4YBA A;  5BT1 A;  2OR1 L;  3R9M A;  2BUG A;  3L54 A;  2FO7 A;  5HQ8 A;  3D9J A;  5FQ4 A;  4XX5 A;  4MS6 A;  5KJK A;  1HE8 A;  2X3M A;  1UXC A;  4GA0 A;  5DRY A;  2B5A A;  3PE4 A;  4JB8 P;  2RFA A;  3RRM B;  5CBN A;  2WXG A;  1ZZ7 A;  3F52 A;  3T8K A;  3TRB A;  1JWF A;  1JCS A;  2CFZ A;  3MA5 A;  4JEH A;  4KZ0 A;  1TNY A;  4Y42 A;  4L7T A;  4HVB A;  3FUF A;  1Y7Y A;  3P1U A;  2M63 A;  1TNZ A;  3SNX A;  4ANV A;  2PXB A;  1OWO A;  2ION A;  4BX8 A;  4EQZ A;  2X6K A;  4HRN A;  1BDI A;  4U0S A;  3RAU A;  2NC9 A;  3SX0 A;  4FC8 A;  1IKN D;  4UWL A;  1ZZ9 A;  1OT8 A;  3EIJ A;  4BES A;  3MJW A;  1TJC A;  4ER5 A;  3VTX A;  2CG3 A;  4GAA A;  1PRU A;  2QY7 A;  3GN5 A;  2XZT G;  3KSL A;  3CHM A;  1IHB A;  5FZR A;  3MV3 B;  2EF8 A;  3APF A;  5A6C A;  2J49 A;  2P9N G;  5KCM A;  3PZ2 A;  4J1W A;  2VQ2 A;  4LUN U;  4EEC A;  5AQ7 A;  2VGX B;  1WG0 A;  2OOE A;  3SZ7 A;  1QP0 A;  5JMN D;  2DVW A;  1WH8 A;  3UFD A;  3CK9 A;  4ANW A;  3SBT B;  4WNE A;  5ENN A;  3V31 A;  1ELK A;  2LYL A;  2P9K G;  4GTV A;  2KXP C;  4GZ5 A;  3Q7F A;  1RZ4 A;  1E96 B;  4KVM A;  2WXM A;  4OAU C;  4CDM A;  4GTR A;  2WXQ A;  1ZZB A;  2ODR D;  3IV0 A;  3AG4 E;  3SHF A;  3EHM A;  4Z59 A;  2GRN B;  4DUI A;  1HU3 A;  3FP3 A;  1KLX A;  1OCC E;  5DRT A;  3UM0 A;  1TNU A;  3RRN B;  2OVB A;  4CEM A;  4HBD A;  4DX6 D;  4XIF A;  4HOR A;  3RKV A;  4OVU A;  4HI9 A;  2DCP A;  4DLO A;  3FUH A;  4JPS A;  4XZ4 A;  3ASG A;  2BNO A;  3PRE A;  3SO8 A;  2H6H A;  1K3Z D;  2C2L A;  1WAO 1;  4O6F A;  3MEK A;  3FH8 A;  4UI9 J;  4Z68 A;  2WXK A;  3FUK A;  3T9K A;  1LF8 A;  2XPI A;  4N2Q A;  5GAG i;  2YQ8 A;  5AJD A;  1POU A;  4LNU D;  2EIN E;  4Z5H A;  3ASF A;  1G3N B;  1E7V A;  1WIZ A;  4F8D A;  2PXV A;  3X2Q E;  3KXA A;  5H7P A;  4E6H A;  3CHR A;  2B6C A;  3UKU G;  4I9C A;  3L17 A;  2I9C A;  3CQC B;  1LD8 A;  3SF4 A;  3RJV A;  1O1S A;  3Q78 A;  3LCA A;  4WWO A;  5DIZ A;  4UI9 K;  5AIJ A;  5DT2 A;  1BI7 B;  4BT9 A;  3ASH A;  1U3D A;  3FTV A;  2R03 A;  4Q96 A;  1QQA A;  4ABN A;  3FU6 A;  2WXJ A;  5ENS D;  3JCK C;  1OWN A;  4IYP A;  4CGW A;  1H2U A;  1UXD A;  1HF8 A;  3D9H A;  1IQU A;  4I2W A;  4YND A;  4KYO B;  4HXI A;  3R1F A;  4B8A A;  3I4R B;  1CQT A;  2OND A;  4UWG A;  2OCC E;  3QF3 A;  2PUB A;  5EKQ D;  3GZD A;  4EZI A;  4BTB A;  1JCR A;  2J9Q A;  5T8I A;  4F3V A;  1AWC B;  2D5V A;  2A4Z A;  4M7C A;  3TXM A;  5LCW J;  3NRO A;  3ZHM A;  3T5X A;  2H6I A;  1QPZ A;  2L0I A;  1E8W A;  4HRL A;  2HYZ A;  2J09 A;  1KT0 A;  2F0Y A;  3N71 A;  3I4G A;  3KD7 A;  3ZRH A;  4J1X A;  1NW3 A;  1TNO A;  2ETB A;  4BY6 A;  3SCG A;  5DBK A;  3SBS A;  4U95 D;  2A5U A;  3S7B A;  3E33 A;  3QWW A;  5JA4 D;  3CV0 A;  4V3I A;  5BV0 A;  1IXV A;  3LXU X;  2LSU A;  3Q49 B;  5JJ7 A;  3AU5 A;  3OQN A; 
#chains in the Genus database with same CATH homology
 4I1M A;  3D9M A;  3NQP A;  3ZGQ A;  1H19 A;  3MYV A;  3G5G A;  2IUO A;  4F7A A;  2VTB A;  3PXP A;  4I6G A;  4I1A A;  1NA0 A;  4H7X A;  3F51 A;  1KT1 A;  3OTN A;  4QFV A;  4PS3 A;  3UPV A;  5LFA A;  3BEE A;  3FUE A;  1SQM A;  2EQX A;  4G1T A;  4DK5 A;  3UMV A;  2PUC A;  5JJT A;  1LQC A;  3L08 A;  1X2L A;  2XEV A;  3CHP A;  3OAW A;  2PE5 A;  3ZYQ A;  1WH6 A;  1UJJ A;  1OUV A;  3SD5 A;  5M72 A;  2R1J L;  4J8E A;  1L5J A;  1QNF A;  1UN8 A;  1EYH A;  2WM9 A;  3Q5M A;  4FLH A;  4LER A;  3FEY A;  3G2W A;  5ARF A;  3CK7 A;  3WXX A;  4APO A;  4KXK B;  4ANU A;  1HG5 A;  3ZEF A;  2X38 A;  4FHJ A;  4EZJ A;  4G26 A;  2JLB A;  2XRY A;  4J8D A;  3FU0 A;  2L0T B;  3QNK A;  3DNV B;  3F6W A;  1IC8 A;  3LFP A;  1ADR A;  2O4A A;  3IKO B;  5AYW D;  4GU5 A;  3UT7 A;  3D3M A;  4JHK A;  1XWR A;  4JXT A;  2L9B A;  2XQ0 A;  3QWG A;  2IQC A;  5JHB A;  4H7Y A;  2JVL A;  1MHQ A;  4FA6 A;  1INZ A;  4LEU A;  4PU8 A;  4R7L A;  3ZHE B;  1ZZC A;  5LOZ A;  2KZ8 A;  4C9B B;  1XNF A;  3AS4 A;  3PS6 A;  3IHY A;  4JZY A;  4JCX A;  4YVO A;  4X4F A;  2J07 A;  2V8S E;  5FQ6 A;  3D9K A;  3PNL B;  4WNG A;  3TAX A;  4BSX A;  2WXO A;  1SZ9 A;  1LCC A;  4ACL A;  5CCL A;  4WUY A;  1DNP A;  4GML A;  4CRW A;  2XJ3 A;  2KCV A;  4FLB A;  2GRM A;  5G04 J;  3UUX A;  3FTY A;  4GZD A;  2LYS A;  2WB2 A;  3QQ6 A;  3IHV A;  2I6H A;  1RZR A;  1LLI A;  2A6C A;  2BNN A;  1UG3 A;  3FTX A;  3LVR E;  3MKQ B;  4PUC A;  3FU5 A;  3RK6 A;  4DPR A;  1JWL A;  3JQ0 A;  4J8S A;  4L23 A;  3TXN A;  3RU0 A;  3CLJ A;  3CR3 A;  3ULQ A;  2KZT B;  1NEQ A;  4OVV A;  3KZ3 A;  2WMN A;  3PE3 A;  3HVE A;  4I6E A;  1ELW A;  4Z5C A;  3ONK A;  2FEZ A;  2YHC A;  3QOU A;  1SZA A;  1IYG A;  3CQG B;  4Y6W A;  3ZKC A;  3VK0 A;  2NXP A;  3CVL A;  3D9O A;  3B7T A;  2IOL A;  2IJG X;  1PRA A;  4I6J A;  4AP2 A;  3MLF A;  3FEX A;  3ZXS A;  5K98 B;  2JEK A;  4U63 A;  3Q4A B;  4EQF A;  2UY1 B;  4N5C A;  4YVQ C;  5G05 C;  4AVX A;  1GW6 A;  2CG2 A;  2ILR A;  4NQ0 A;  3CGH A;  2PUE A;  4TUU A;  1FCH A;  3URZ A;  2PM7 A;  3FTU A;  3I3N A;  3CVN A;  4HLE A;  3PH0 C;  5E75 A;  5JHA A;  1IQR A;  2WVI A;  1S7E A;  4U04 A;  4JVS A;  3HHM A;  2EWT A;  1L1M A;  3U66 A;  3S8Q A;  5J90 A;  4D10 C;  1WET A;  3FTS A;  3R7Q A;  3B7H A;  4HFG A;  2CHX A;  3APD A;  4UWF A;  3FUM A;  2LYQ A;  2X6F A;  1PNR A;  1VDY A;  3TG5 A;  3L22 A;  4E85 A;  3D9L A;  3U64 A;  1PAQ A;  4WND A;  3KJX A;  2CFU A;  5LX8 A;  4GYW A;  5E76 A;  3ZN3 A;  3AU4 A;  5C1D A;  4F1S A;  3OXG A;  3S7F A;  3FFL A;  3NZS A;  3CVP A;  4N39 A;  5KJL A;  3ZHE A;  4RVB A;  5LCW C;  1R69 A;  1N52 A;  3LS8 A;  3CHQ A;  3PRZ A;  2R63 A;  3QWV A;  2KC7 A;  4I9E A;  1WM5 A;  4BWR A;  4L2L A;  2J4B A;  1FVF A;  2XGS A;  5T4Y A;  1YSE A;  3SI5 A;  1JWG A;  2I1K A;  2X6J A;  3ZHI A;  3OP9 A;  4MLP A;  2RD0 A;  3MKR A;  3CST A;  1BPO A;  2UWJ G;  4Q69 A;  4JCY A;  3ESL A;  3OXL A;  2XHE A;  4PU4 C;  2V0P A;  2AW6 A;  2E2E A;  3ZYK A;  1ZZ8 A;  3SGH A;  3ZFW A;  3ZYL A;  2KEK A;  4NRH B;  3FHE A;  4UQX A;  5CMW A;  5KJN A;  3CK8 A;  5BPP A;  3RIB A;  1NER A;  1JH9 A;  2VSY A;  4JEU A;  1O4X A;  2LYK A;  2FI7 A;  4XE0 A;  1E8X A;  3D9I A;  4TRQ A;  3UT8 A;  4FHK A;  3CLC A;  2VGY A;  3MKQ A;  1Y9Q A;  4FUL A;  2PM6 A;  2LYR A;  3EHN A;  1JPL A;  3PNT B;  2LSV A;  2HIN A;  1E3O C;  1PC2 A;  3O4Z A;  2XGO A;  2ICT A;  3MV2 B;  3GZ1 A;  2X6I A;  2KPJ A;  1UTX A;  3FUI A;  3P2B A;  2Y4U A;  4PU7 A;  3NF1 A;  4LCT A;  3GZ2 A;  1OWM A;  1UN9 A;  3FYA A;  4A1S A;  4RSY A;  1B89 A;  1YA0 A;  3PEU B;  4YAR A;  1QP4 A;  1JUQ A;  2R5S A;  3FH5 A;  2ZU6 B;  3VTY A;  2VTB B;  1HXI A;  4ATG A;  4GPK A;  1HF0 A;  3QAQ A;  4JHJ A;  3LIS A;  4AIF A;  4YBA A;  5BT1 A;  2PIJ A;  2OR1 L;  2UY1 A;  2BUG A;  3HYM B;  5LP0 A;  3T8M A;  4B89 A;  1B0N A;  3L54 A;  4MKT A;  1E8Z A;  2FO7 A;  2IVG A;  4GB9 A;  4FP7 A;  5HQ8 A;  2MRI A;  3ASD A;  3D9J A;  4KT6 B;  5FQ4 A;  4YG7 B;  4J8F A;  4XX5 A;  4MS6 A;  3S7D A;  5KJK A;  1HE8 A;  2Q7F A;  1UXC A;  1DW9 A;  2X3M A;  4GA0 A;  4Q94 A;  2B5A A;  2HM8 A;  3PE4 A;  3JXB C;  4G25 A;  2VSX E;  5EX3 A;  2EBY A;  2IVB A;  3UT4 A;  1WY6 A;  2KEJ A;  4EPZ A;  4UQY A;  3RRM B;  5EX0 A;  2WXG A;  5G55 A;  4F53 A;  1ZZ7 A;  3F52 A;  1P5Q A;  1FVH A;  2VJ8 A;  3OQO A;  3SFZ A;  3FUJ A;  3TRB A;  4AM9 A;  4AJW A;  1JWF A;  3CHO A;  2CFZ A;  2MEZ A;  4XI0 A;  3MA5 A;  2L49 A;  4DLQ A;  2VYI A;  4FU3 A;  1EFA A;  4JEH A;  4DI4 A;  3FUD A;  3MGB A;  4KZ0 A;  4AEZ C;  4FBI A;  2CHZ A;  4A1G A;  3G2T A;  3KAE A;  4Y42 A;  3DPD A;  4GZ6 A;  1RPE L;  4L7T A;  4MRU A;  1ZZ6 A;  3QB2 A;  4HVB A;  1NA3 A;  4GHJ A;  1ZPQ A;  2IU7 A;  1Y7Y A;  3JXC L;  3FUF A;  3JUI A;  3P1U A;  3FMY A;  3QK0 A;  4UI9 C;  2M63 A;  4HOS A;  3AS5 A;  1QQE A;  2HR2 A;  2QFC A;  2FJR A;  3EJN A;  3SNX A;  3VLD A;  4ANV A;  5ANL A;  1Z3Y A;  4N3C A;  3LPZ A;  4C0E A;  3EUS A;  1OWO A;  4IVZ A;  2FBN A;  2ION A;  2XCB A;  1HZ4 A;  3QJZ A;  4ME2 A;  4XI9 A;  4BX8 A;  4G24 A;  2JCG A;  2X6K A;  3U3W A;  2XPZ A;  5BW8 C;  3EDT B;  1BDI A;  4U0S A;  2MQK A;  2AVP A;  4XKC A;  3BS3 A;  4W9R A;  4X4E A;  2KZT A;  3HVE B;  5A7L A;  2NC9 A;  3Q47 B;  2PUG A;  3SCF A;  2WXN A;  3QDN A;  4FC8 A;  4JA7 A;  5KJM A;  2XCJ A;  4UWL A;  2IVQ A;  4BFR A;  3T5V A;  1ZZ9 A;  3HDX A;  2WMO A;  3EIJ A;  3G2S A;  5CMY A;  2WQ7 A;  3MJW A;  3LY7 A;  1TJC A;  3JYS A;  1ZBP A;  3VTX A;  3NZU A;  1AU7 A;  4A3V A;  2CG3 A;  4PS7 A;  3D9P A;  4GAA A;  2BNM A;  2XIU A;  4O8B A;  5G05 J;  3ZVV A;  3GBF A;  4X4C A;  5FT9 A;  3L6A A;  1PRU A;  2LYJ A;  1RZR D;  2FUL A;  2QY7 A;  3GN5 A;  2PQR A;  2WXH A;  3B7R L;  3CHM A;  2NSZ A;  4GA1 A;  3TL5 A;  4X4I A;  2J4D A;  3GYZ A;  3JQ1 A;  3FU3 A;  4X4H A;  3LDZ A;  4JC8 A;  5FZR A;  3MV3 B;  2EF8 A;  3APF A;  4APF A;  2DIW A;  5A6C A;  4N2S A;  2J49 A;  2X6H A;  5KCM A;  4URK A;  4J1W A;  2VQ2 A;  4LUN U;  2O49 A;  4X4G A;  4RG6 A;  3BG1 B;  4JQD A;  3QWP A;  4EEC A;  4BTA A;  4IUL A;  1LCD A;  2VGX B;  1OCT C;  4KMO A;  3UX4 A;  2OOE A;  3SZ7 A;  3RRU A;  1Z6T A;  3L1P A;  1QP0 A;  2WQH A;  4HOT A;  1A17 A;  3LJ3 A;  5FTP A;  2PZI A;  3S7J A;  1SQ8 A;  1LMB 3;  1XGW A;  2IF4 A;  3BG0 B;  3G7D A;  4WWN A;  1WH8 A;  3CVU A;  4ILI A;  3UFD A;  1ELR A;  3TGO A;  3CKB A;  3CVX A;  4WNF A;  5A7D B;  1OWL A;  1U3C A;  3CK9 A;  2XCC A;  3VLF A;  4ANW A;  4BX9 A;  1GT0 C;  3SBT B;  2P58 C;  2AXZ A;  3FDH A;  4WNE A;  4A3T A;  1QZ2 A;  2VSN A;  3L16 A;  3FYM A;  3PZD A;  4G11 A;  5ENN A;  5FQ8 A;  5G2N A;  3D9N A;  4NAC A;  4YG4 A;  3OXF A;  3SCH A;  3QAR A;  1ELK A;  2Y3A A;  2LYL A;  4KZC A;  2E0I A;  1PY1 A;  1Y8M A;  5FZQ A;  2CRO A;  1ZUG A;  4GZ5 A;  4RG9 A;  2R59 A;  4YG1 A;  3LYA A;  2PUF A;  3O9X A;  5BUZ A;  2CSF A;  1E96 B;  4GYO A;  4A55 A;  1W3B A;  4KVM A;  2WXF A;  2WXM A;  1TEZ A;  5CHE E;  2AUW A;  3OQM A;  3L13 A;  4CDM A;  4CT0 A;  5D0O D;  2WXQ A;  1ZZB A;  3CRO L;  5FZS A;  3ZYM A;  1TJF A;  2HO1 A;  2LAH A;  4G23 A;  3BDN A;  4CT4 A;  5ANR A;  2WXL A;  3IV0 A;  4GZ3 A;  4P29 A;  3S2A A;  4OB4 A;  1QP7 A;  1EF1 C;  2DBA A;  3SHF A;  2H8R A;  4IWR A;  3EHM A;  4FJY A;  4AV7 A;  5JJ6 A;  2YIN A;  4Z59 A;  3PEV B;  3PUK A;  3U4T A;  4U0Z A;  4HOU A;  3RO2 A;  2XSD C;  1HU3 A;  2L6J A;  3FH7 A;  3PUJ A;  3FP3 A;  3FWV A;  1RIO A;  1KLX A;  4M3O A;  5FWQ A;  3R9A B;  4GQM A;  3PVL A;  3QC1 A;  2GGF A;  2OFY A;  4CGV A;  3LY8 A;  3RRN B;  1CJG A;  3ZW3 A;  2OVB A;  3MX3 A;  5A23 A;  4CEM A;  4XKB A;  2AWI A;  3B7S A;  4JW1 A;  1NP7 A;  2KCL A;  2GRL A;  4XIF A;  4WAF A;  1HS6 A;  4HOR A;  3RKV A;  2LNI A;  4OVU A;  4FN3 A;  2AXU A;  5AJL A;  1E7U A;  2MOW A;  2DCP A;  4DLO A;  2YNQ A;  3BD1 A;  2GW1 A;  2KM4 A;  3K9I A;  4EZL A;  4ACK A;  3ML8 A;  4JHR A;  1ZVV A;  3IVP A;  3FY4 A;  3FUH A;  4JPS A;  4XZ4 A;  1QQB A;  2IV1 A;  4KBQ A;  1VPW A;  5ARG A;  3FTW A;  5FQ7 A;  3ASG A;  5BV1 A;  2I2O A;  2BNO A;  3HIZ A;  3PRE A;  4I8T A;  2C0L A;  2C0M A;  1NZN A;  2RG8 A;  3ZIM A;  2WXR A;  3OMT A;  4HOQ A;  4IA8 A;  3JXD L;  2J08 A;  3H5T A;  2C2L A;  1WAO 1;  4O6F A;  1HO8 A;  4EZK A;  5EDS A;  4X4B A;  3MEK A;  3FH8 A;  4GZC A;  4UI9 J;  3IEG A;  4CDN A;  2WXK A;  3CEQ A;  1IHG A;  3CVQ A;  1RZS A;  3FUK A;  4HS2 A;  5D0Q D;  3FUL A;  3B7U X;  2AXV A;  4L2Y A;  3R7R A;  2CHW A;  3TG4 A;  4AOF A;  1LF8 A;  2XPI A;  4N2Q A;  4I6T A;  2KEI A;  2YQ8 A;  1R63 A;  5AJD A;  4L1B A;  4B94 A;  1POU A;  2GZU A;  1Z3X A;  3QKY A;  4Z5H A;  2LCV A;  4U07 A;  4U0U A;  4AY5 A;  4OYS A;  4DJA A;  2MHK A;  4NDW A;  3ASF A;  1E7V A;  3G2V A;  1H0A A;  1E90 A;  1WIZ A;  4F8D A;  2BJC A;  3DBS A;  3E4B A;  4I17 A;  2V5F A;  1OSL A;  3KXA A;  4IRU A;  4J6I A;  1BDH A;  4E6H A;  3CHR A;  4I9C A;  1ZS4 A;  3L17 A;  2I9C A;  2R17 C;  1ZU2 A;  3CSF A;  4Y6C A;  3CQC B;  4WWP A;  4GA2 A;  4TV3 A;  1Y6I A;  3LVQ E;  4NUR A;  3RZZ A;  3C98 A;  3B13 A;  3SF4 A;  3ONL A;  3RJV A;  4EBA A;  2FF4 A;  3LCA A;  2WXP A;  1N54 A;  4WWO A;  5DIZ A;  5G04 C;  4UI9 K;  5AIJ A;  4GMJ A;  4BT9 A;  3AS8 A;  1X5B A;  2WIU B;  2IOS A;  3ASH A;  2PUD A;  1U3D A;  2I1J A;  1HH8 A;  2KCK A;  4CDR A;  3FTV A;  2YHE A;  4GCN A;  2KAT A;  4Q96 A;  1JFT A;  2PPX A;  5FJY A;  2VSO E;  3ENE A;  1QQA A;  4PU3 C;  2PQN A;  4AY6 A;  3I5P A;  4EBA G;  4UWH A;  4ABN A;  4JA9 A;  3VLE A;  2OV8 A;  3APC A;  2WXJ A;  2V4L A;  3FU6 A;  4ANX A;  3JCK C;  2VGX A;  1OWN A;  4B8C B;  4IYP A;  1H2T C;  4CGW A;  3FUN A;  3D1N I;  4G2V A;  4K0R A;  3MCX A;  3LY9 A;  2O38 A;  1H2U A;  1UXD A;  1HF8 A;  4K03 A;  5BNW A;  3HZI B;  1IQU A;  2Y4T A;  2BF0 X;  4I2W A;  3GW4 A;  3RO3 A;  4J0U A;  4I6U A;  4KYO B;  4YND A;  4HXI A;  3LKU A;  2LO6 A;  3PDN A;  4MCX A;  1JFS A;  2OVF A;  4IN3 B;  4AXH A;  3CVV A;  4Z5D A;  3R1F A;  4B8A A;  4UQZ A;  3I4R B;  5CCM A;  4KVO A;  4N3B A;  3UQ3 A;  1CQT A;  2OND A;  3CHS A;  4UWG A;  4LRZ A;  2IFU A;  3QF3 A;  1HG2 A;  2L8N A;  4Z58 A;  2PUB A;  5EKQ D;  4BTB A;  3FTZ A;  3MZL B;  4PDX A;  4GYY A;  1HFA A;  5C2Y A;  2XPY A;  2J9Q A;  5T8I A;  1E8Y A;  4F3V A;  1EDU A;  2D5V A;  2A4Z A;  2PUA A;  1S0P A;  2ICP A;  3KEZ A;  3ESK A;  1UW4 B;  4FJZ A;  3TXM A;  3EIQ C;  4I2Z A;  4CCA A;  5LCW J;  3ZHM A;  1OWP A;  2PL2 A;  2LYP A;  3T5X A;  5HI7 A;  5AEN A;  1QPZ A;  5J08 A;  3ZPJ A;  2L0I A;  1E8W A;  2HYZ A;  4PS8 A;  1DVP A;  2WQ6 A;  2J09 A;  1KT0 A;  4X4D A;  2IU1 A;  3ML9 A;  3N71 A;  4PH4 B;  3KS2 A;  4I1O B;  2WUS R;  1PER L;  2WPV A;  3I4G A;  3KD7 A;  1X57 A;  3ZRH A;  1EPU A;  4J1X A;  4I43 A;  3Q15 A;  2HSG A;  2XI8 A;  1PRV A;  3CIA A;  4JL0 A;  4BY6 A;  4MCT A;  4GCO A;  4C0M A;  3GZS A;  3SCG A;  3GN5 B;  5DBK A;  3LEW A;  3SBS A;  1H2V C;  4ILH B;  1ZAY A;  2LAI A;  1UJK A;  2XRZ A;  2A5U A;  4UWK A;  3S7B A;  4DI3 A;  3O48 A;  3TJP A;  3QWW A;  3CV0 A;  1MQS A;  1H6K A;  3G2U A;  3IBE A;  4V3I A;  3CKC A;  5BV0 A;  3LXU X;  3CVY A;  1DWK A;  3CVW A;  2LSU A;  4I6R A;  5T3R A;  3U9W A;  4N3A A;  1HX8 A;  3CEC A;  2WXI A;  3Q49 B;  4U8H A;  4BT8 A;  4B0Z A;  5JJ7 A;  2XGM A;  3AU5 A;  4FAD A;  2BTD A;  3QYX A;  4ILG A;  3OQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...