2GROB

Crystal structure of human rangap1-ubc9-n85q
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
157
structure length
157
Chain Sequence
PADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Lysine activation and functional analysis of E2-mediated conjugation in the SUMO pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 I
total genus 59
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2groB00
1Z5SC 2IO2C 2GRNB 3UIOC 2GRRB 2IY0C 2GRQB 2GRPB 2IO3C 2GROB 3UIPC 1KPSB 3UINC 5D2MC
chains in the Genus database with same CATH superfamily
4A1SA 3Q9UC 4GTSA 3FTYA 3CEQA 4B8CB 1K1BA 2CG2A 3UT4A 1P5QA 2H6GA 3EHMA 3IXEA 4CYMD 2V0PA 4ILGA 2BUGA 1BD8A 4CGWA 3HYMB 3K9IA 1OWLA 5AJDA 3ESLA 2PM7A 2WXIA 3UT7A 1ELWA 3UXGA 4XKBA 2ONDA 2XCCA 3HG0D 4JXTA 4X8QA 1KT1A 3F6QA 5CCLA 3PZ3A 3ULQA 5ITZF 1NP7A 3EDTB 4CCAA 1TR4A 1EDUA 2ILRA 3TWRA 4GMLA 3MA5A 2GRNB 2L6JA 3ABLE 4FHJA 4JC8A 4HI9A 2OVBA 3DSWA 1TNOA 1JUQA 4D10C 2BF0X 5E76A 4HLLA 2L9BA 1N94A 3SQVA 4Q94A 1QNFA 3ESKA 3V2OA 2ETAA 3UMVA 4E85A 3R9AB 3P1UA 5FQ7A 3C3OA 5T8IA 3CHOA 4KYOB 4L9PA 3KSLA 2X6KA 4J6IA 2I1JA 3KS2A 4CT0A 1N0QA 4GZDA 1H6PA 3CHRA 3JXJA 2VSOE 4FHKA 3PE4A 2OCCE 3T8KA 5AQ7A 1UN9A 2R5SA 2IF4A 2P9IG 1YYHA 3CHSA 3ZHEB 3SBSA 4XI9A 5G04C 2B0OE 3MZLB 4HLEA 4AY6A 2J07A 5JMND 1XNFA 2KZTA 5FQ8A 1FT1A 1VDYA 4M7CA 4XIFA 3VTYA 5D66A 5ENQD 1NFIE 4WNDA 3D9OA 2LXLA 3NAWA 3DSTA 3AG3E 3Q4AB 3DXKG 5JJ6A 3LKUA 5KWDA 1JWFA 3JXIA 1H2UA 1WY6A 4IYPA 3DRAA 3FUDA 4RG9A 4L2YA 3TJPA 1SZ9A 3IV0A 4GYWA 2QFCA 5BT1A 4NIKA 2WXRA 1IHBA 1SQMA 1L5JA 4C0MA 4FJYA 2I1KA 4BT8A 3GZ2A 2VQ2A 3EIQC 3CQCB 5CERB 5ENPD 3RAUA 3V30A 3UQ3A 2J9QA 4YVQC 3OXLA 3UTMA 3FEYA 4GZ6A 2CHXA 2EIKE 1HG2A 5J90A 1FT2A 3U3WA 5EX0A 2HO1A 4GTPA 4DX2A 4GTQA 2HM8A 4WWOA 4XEIG 3KAEA 4YDOA 4NQ0A 1TNYA 5LX8A 2WXMA 4ILIA 4B93B 3ZNGA 3BEEA 4FJZA 4HRNA 5BV1A 4GZ3A 3ZUVB 4UWLA 4GYOA 3DEOA 1PY1A 5ENSD 3UPVA 3QNKA 3G2TA 1TEZA 4O1OA 4G8LA 3ZIMA 2P9LG 3TWQA 1N4PA 1FCHA 2Y4UA 3ML9A 4L7TA 1SA4A 3HDXA 2XZDG 4LERA 2Y4TA 4TXQA 4ANWA 2FO7A 2HYZA 2AXUA 3ZYLA 1NZNA 2H6FA 1NA0A 3AS5A 1QZ2A 3FH7A 3EHNA 1JCRA 1IQUA 4I17A 3ZVVA 5HS0A 5KNHD 5EILA 3B7RL 3V31A 5B3SE 3NZSA 5JJTA 2ZIRA 4N3AA 3DEPA 5DBKA 4EZLA 2M63A 3CV0A 4U8HA 2XPYA 4K5BA 4MKTA 1ZB1A 2IO3C 4PS8A 4H7YA 1MJ0A 1E8WA 4BSZB 3T5VA 4HOSA 1Q2ZA 1MZCA 4IRUA 1X81A 3PNTB 4JA9A 2VSYA 1H2TC 3PUJA 1O1RA 4J8YA 3KD7A 3FTUA 3MEKA 2EIME 5G04J 4XKCA 3I3NA 2WQ6A 2LO6A 4KT6B 4I1OB 2OEVA 5D0QD 1Z5SC 2PQRA 2XHEA 1OCCE 3B95A 2J8SD 4OVVA 2WXJA 2XENA 3TWSA 2FBNA 3Q7AA 3U9WA 5KJMA 5CBNA 3ISMC 2KXPC 3QARA 4UWFA 3C72A 2I9CA 1TNZA 3RO3A 1YA0A 2LSUA 3GYZA 3D9PA 4LRZA 3CIAA 3RK6A 1GW6A 5KJKA 3EIJA 3V2XA 3SHFA 4ATZD 3Q9NC 3ZGQA 4C0EA 3E33A 4RVBA 3KEZA 2LXMA 3G2WA 3Q79A 1AWCB 3HRAA 3RRUA 1H6KA 3TGOA 2MRIA 4ANXA 2X6HA 4TXPA 3FUKA 3PZ1A 2EQXA 3CK9A 3QWVA 3LJNA 1WM5A 4TV3A 2VGXB 2JABA 2WXHA 3B7UX 3SY2A 4DRXE 2ZU6B 5ANLA 2KATA 4A63B 3UINC 1K8KG 4UUCA 3ZW3A 1ELRA 2DYRE 5D2MC 1B89A 4JVSA 2ETBA 1KZOA 3Q5MA 5EIDA 3ZYMA 3PRZA 2FI7A 4UI9K 4QQIA 1O1TA 2QZAA 1V55E 4JHRA 5EX3A 1EPUA 1FVFA 3SBTB 2WXGA 4LNGA 2F37A 3T8MA 1WDYA 3CSTA 5C1DA 3O48A 3R7RA 2F8YA 5BXOA 2Y1LE 2WXLA 1V54E 4AY5A 4I2ZA 5EN5D 3EHRA 3MKQA 4ANUA 3FFLA 4GA2A 3SZ7A 4BESA 2IY0C 3FHEA 2LNIA 4KVOA 2I2OA 1HF8A 3GW4A 1YMPA 3FTSA 3Q7FA 3HXEA 4AIFA 3AS8A 4QFVA 5AYWD 4GMJA 2X6JA 2WXFA 2GROB 2L0IA 3SD5A 4FULA 3V79K 1UN8A 2C0LA 2H6HA 3J5QB 3ZRHA 4DJAA 4LCTA 2NSZA 4U8VD 2VYIA 3VLFA 2ZGDA 5AN8A 1O1SA 4DX7D 1S0PA 4U96D 2V5QC 2AXZA 3PZDA 4WNFA 5HRYA 5CCMA 3LY7A 3MJWA 3S7FA 2KCKA 2YINA 1NI1A 1E96B 2IFUA 4EQFA 2XCBA 4OAVB 2P9PG 2XEEA 3TG5A 3UUXA 4C48B 3RRNB 3AS4A 4WWPA 4ACLA 4DI3A 1X5BA 3EHQA 1K3ZD 2V5FA 1OCZE 2LUHA 3MCXA 3NZUA 3FEXA 1LTXA 3LVQE 3D9KA 4EZJA 2QYUA 4RG6A 3PVLA 5CRVA 3HXFA 4TXRA 3HVEA 1DCQA 4PUCA 5KJLA 1OWOA 3FH8A 3CLJA 3FUIA 2DWZA 1QQEA 4JW1A 4Y6CA 4FP7A 2DZNA 1H6OA 5CRUA 5G05J 1S63A 3IHYA 4O60A 3QWPA 3APFA 3LYAA 5BPPA 4EBAG 2YNQA 3TL5A 4XE0A 5EKQD 5LCWJ 3ENEA 4J8DA 4UQXA 1EF1C 5HI7A 4UQYA 4YDYA 3Q15A 4DI4A 3FU0A 4URKA 3P2BA 5AENA 1OY3D 3AU4A 1OCOE 1FPPA 3PS6A 3UIOC 1JCQA 5G05C 4EHMA 4N3BA 1IXVA 3AG4E 4F6RD 4TUUA 4G23A 5AARA 2VTBA 4O6FA 1OWNA 3IHVA 3S7JA 4WNEA 5FZSA 5JA4D 3Q47B 4JEHA 2P9SG 2R59A 3PUKA 4BFRA 4DPRA 1OT8A 1JPLA 5CHEE 2IEJA 4B8AA 3E30A 4I9EA 3DPYA 3MKRA 1MX4A 4J8EA 2KCVA 2GRLA 3EU5A 2VGEA 2KM4A 3S7BA 3IEGA 4W9RA 3L13A 2KZTB 2DVWA 4O1PA 1TN8A 3EJNA 2VSXE 1IKND 2GRRB 3T9KA 4GZ5A 3UIPC 1OWMA 4WAFA 1MHQA 2BEDA 3DXMG 2ETCA 3HXCA 4I2WA 3D9IA 3TAXA 3ASGA 4H7XA 3BU8A 3D9HA 3U64A 2IU1A 4HORA 5CBOA 3C3RA 4DX1A 5BW8C 1HFAA 4B94A 4FA6A 3C5RA 1BI7B 1E8XA 1DVPA 2R03A 3CVUA 4GU5A 3L9TA 1N4QA 5B1AE 4HOUA 2VJ8A 3EU9A 1RW2A 4JD2G 2XS8A 4AOFA 2XRZA 3NOCD 3LY9A 2DBAA 2QY7A 2R2LA 5ENOD 3ZN3A 4DK5A 3ZXPA 4K5CA 3SGHA 1WG0A 1TN6A 4CDMA 1PAQA 1DC2A 4BWRA 2WXQA 2RG8A 2OV8A 4XI0A 5EIBE 1UJJA 5BUZA 2WMNA 3C3QA 1D8DA 4HRLA 4JHKA 2B6CA 3D9MA 1Y6IA 4GCOA 4AM9A 4DX5D 3R9MA 2F0YA 3APDA 2WXPA 3ML8A 3QB2A 3SF4A 3LCAA 5CMWA 1UG3A 1UOHA 5BXUA 2WXOA 1S70B 4UWKA 4I9CA 4AEZC 4YDWA 2DIWA 3FP3A 3J5PA 3Q75A 2Y3AA 5BNWA 4HRMB 1JCSA 2IONA 2OVFA 4B0ZA 3L6AA 4OYSA 3PZ2A 2FF4A 2XGSA 4PS7A 3R7QA 4AP2A 2KBXA 2FO1E 4BEPA 4GAAA 4N5QA 2DYSE 4ZHBA 3AG1E 2WXNA 3ONKA 3FULA 5CEDB 1HG5A 4L2LA 1TYQG 4GA1A 1U3DA 3SFZA 1ELKA 5FZRA 5T4YA 4XX5A 1N54A 1DNPA 2AJAA 1UW4B 4AVXA 2IOSA 1WAO1 4LNUD 4DUIA 4CEMA 2VGYA 2NYJA 2AWIA 2P9UG 3CVNA 5FTPA 1KPSB 3VLEA 3MGBA 1E7VA 3RO2A 3T5XA 3E32A 5M72A 2P9NG 5KBAA 3FUNA 1BPOA 4LG6A 4F7AA 5ARFA 3UX4A 2CHWA 4GPKA 3FTWA 3L54A 1IYGA 4RSYA 4GPMA 2Y69E 3DSSA 4I1AA 4P29A 3HHMA 4OAUC 4HQDA 3ZU7B 3ONLA 4WWNA 1AP7A 4N39A 3CHMA 2V4LA 3AAAC 4MBGA 2WM9A 4UWHA 4UI9C 4BTBA 2P58C 2F8XK 4GTTA 3NF1A 3TWWA 4LUNU 1BU9A 3QK0A 5FIOA 3QKYA 2E0IA 5EYPF 4NURA 3AG2E 5T3RA 5A6CA 2LSVA 1E8YA 1N9AA 4DX6D 4JHJA 2DCPA 2RD0A 3LDZA 5KJNA 4J0UA 2DZOA 1TNUA 3UM1A 1D8EA 3D9JA 3PDNA 3S7DA 3FUHA 3FTVA 4L23A 3CK7A 4HOQA 4RQIA 3QAQA 2VGXA 5ENNA 4HOTA 2X6FA 4A3VA 3RRMB 3JUEA 3CQGB 2RFMA 2EIJE 2PNNA 2UWJG 4IN3B 4I6GA 2NC9A 3FWVA 3GZSA 4XZ4A 3HIZA 3HXBA 4DLOA 3FU5A 4KMOA 4ABNA 5BV0A 3N71A 3MYVA 5J08A 3NBNB 1KLXA 3RKVA 3TWUA 3BG1B 4KXKB 1D9SA 1TJFA 1N52A 4I6JA 4G2VA 2L0TB 3CK8A 3OXFA 4BETA 3QOUA 3MKQB 3PEVB 4LNBA 2HE0A 4J7WA 3SFXA 3KEAA 3PH0C 3FUJA 4JPSA 3FUFA 5A7DB 3Q73A 4GCNA 3U66A 3VLDA 3ZYQA 1DCEA 4AJWA 3D9NA 4ILHB 5EYLA 3CVYA 1E90A 5EDSA 2XRYA 3ASDA 4K0RA 3RJVA 4GB9A 4CT4A 3RIBA 1H19A 1KT0A 2QYJA 3PE3A 3QDNA 3LY8A 2XGMA 3CVPA 2X6IA 2ZISA 3B7TA 4WNGA 2RFAA 3Q49B 3TWVA 1UJKA 4JB8P 3UM3A 2AVPA 1HH8A 2PM6A 3CSFA 1OCRE 1EYHA 4NACA 2LAHA 4U0SA 2YQ8A 4U63A 3TG4A 1SW6A 1RZ4A 4IULA 3ZEFA 3LEWA 5FJYA 4F53A 4APFA 2J4DA 4FLHA 4GTVA 4GZCA 2V4HC 4F1SA 3HVEB 5AQAA 4BSXA 2PL2A 3UT8A 1E7UA 1TNBA 4Q69A 1N95A 3E37A 5CMYA 3SFYA 2WMOA 4G11A 5H7PA 2IO2C 3JYSA 1SZAA 1S64A 3RU0A 1K1AA 4NRHB 5C2YA 4APOA 3CHQA 3CVQA 4G8KA 4Y6WA 1A17A 4Z68A 4G1TA 4PDXA 4CDNA 3LVRE 2FEZA 2VSNA 3FTZA 4GTMA 2GRQB 1JWGA 3IBEA 1TN7A 1QYMA 2IJGX 3L22A 5DIZA 2IOLA 2MOWA 3ULEG 4B89A 3UKUG 4GMRA 4GA0A 3OXGA 4HNAD 5HKPA 5ARGA 5G2NA 1O5MA 5ANRA 1BLXB 4KZ0A 2V8SE 2BTDA 3LXUX 1HE8A 3RSEG 4FADA 2EINE 4TUMA 2OEWA 3ZXSA 3G2SA 3KSQA 2KCLA 3FTXA 4WUYA 5B1BE 2E2EA 4J8FA 4YDEA 4CDRA 2XQ0A 4HB5A 1HXIA 1ZBPA 4HS2A 2ZXWE 3Q78A 3TWTA 2RKKA 3B7SA 3ASHA 1E8ZA 4ATGA 5AAOA 1FVHA 4I43A 3TXNA 3UM2A 1Z3YA 2J49A 3ASOE 2WB2A 2BKKB 4U0ZA 3LS8A 2NXPA 2QC9A 1N11A 5AQBA 3TXMA 3ZYKA 4J8SA 4AXHA 4UQZA 3ULYA 3SNXA 2A5EA 1U2VG 5JJ7A 4U04A 4YVOA 3DSVA 1HS6A 1N4SA 5CEAA 1LD8A 2BKGA 3G2VA 1MX2A 1OUVA 3OAWA 3PREA 5IY5E 3PZ4A 4U8YD 3FUEA 2PQNA 2I6HA 2L6BA 5CECB 2CFUA 3UM0A 3CKCA 4TRQA 3WG7E 3U4TA 4G24A 5A23A 3E4BA 2XZTG 3CKBA 3ZKJA 4U7EB 3C98A 3NB2A 2GW1A 3DWLG 4CZ2D 4ME2A 4MRUA 3UKRG 3B13A 2X38A 2A5UA 4ANVA 5AIJA 2CHZA 5FQ4A 4JEUA 2CG3A 1PC2A 2C2LA 2EILE 4ZFHA 3D3MA 3CVLA 4HBDA 5G55A 4GYYA 5FZQA 1N4RA 3BG0B 3BQOA 4Q96A 2GRPB 3HXDA 1BI8B 2XGOA 3QWWA 1W3BA 4A1GA 5LP0A 4F3VA 3FH5A 4E6HA 1XGWA 2WQHA 3FU3A 4KBQA 3DSUA 4PS3A 3QJZA 5ENTD 3BUAA 3JQ1A 3PEUB 4JA7A 4CRWA 2XPZA 1HO8A 2X3MA 2R17C 4EECA 3WXXA 2J4BA 2WVIA 5LCWC 3FY4A 4U07A 3ZFWA 4K03A 2A4ZA 4GTRA 3ZPJA 4HVBA 4RLYA 2WPVA 3LPZA 2Y0BG 4GTOA 4LEUA 3X2QE 2YHEA 1SA5A 5ENRD 3CVXA 1Y8MA 3ASFA 4AV7A 1N0RA 3FUMA 1HZ4A 3NQPA 2MHKA 3FDHA 2YHCA 4BT9A 1IHGA 1MX6A 2P9KG 3ABKE 2WQ7A 3QC1A 3IKOB 1Z3XA 3I4RB 3L16A 4BY6A 3UI2A 3GZ1A 4EBAA 3TWXA 2ZGGA 3SI5A 3JCKC 1HU3A 1H0AA 1NL4A 2GGFA 2MYOA 4LSZE 4N3CA 1HX8A 4JZYA 1NA3A 2J09A 2OOEA 3L82A 5KCMA 2IQCA 2VTBB 3ABME 2UY1A 3I5PA 4MS6A 1TJCA 5D0OD 4M3OA 4G26A 2WXKA 3W9GA 2XPIA 4F1PA 1KZPA 3E34A 3DBSA 3D9LA 1YCSB 3APCA 5E75A 3NOGD 4V3IA 1IQRA 3L08A 3PNLB 2P2CP 4FLBA 4KVMA 4UI9J 2AW6A 2LAIA 4EPZA 4HI8A 5FQ6A 2AXVA 4YNDA 4I1MA 2GRMA 2XS1A 2J08A 5LFAA 4G25A 4U0UA 4DLQA 1INZA 4L1BA 5FINA 1MQSA 3DSXA 3CVVA 1Z6TA 4BERA 1LF8A 2R05A 1MYOA 2JEKA 4N2QA 4OVUA 3CHPA 1SVXA 3AJIA 4BTAA 3ZHEA 3B7BA 5JHBA 5LOZA 1ZU2A 3EUVA 4JL0A 1A5EA 2CFZA 4I6EA 3I4GA 4ACKA 4N2SA 3CVWA 4K5AB 4N5CA 3W9FA 4UWGA 4A3TA 4HXIA 3LJ3A 3URZA 1U3CA 2Q7FA 2JLBA 5FT9A 2HR2A 2UY1B 3MX3A 3G2UA 4BX9A 4FU3A 4U95D 3JQ0A 3S2AA 1OWPA 4HFGA 3SO8A 3JUIA 4FC8A 1OXJA 2C0MA 3MV3B 4KZCA 3OTNA 3FU6A 5FWQA 5HQ8A 5KNGA 3CR3A 5AJLA 4CGVA 2XEVA 3VTXA 3AU5A 2H6IA 3O4ZA 2KC7A 4A55A 1LD7A 4EZKA 3DPDA 2XEHA 4BX8A 2R02A 3L17A 3CGHA 4PH4B 3ASNE 4C9BB 5AQ9A 2PZIA 1G3NB 1H2VC 3MV2B 1QBQA 4MLPA 2FULA 5JHAA 4R7LA
chains in the Genus database with same CATH topology
1Z5SC 2IO2C 2GRNB 3UIOC 2GRRB 2IY0C 2GRQB 2GRPB 2IO3C 2GROB 3UIPC 1KPSB 3UINC 5D2MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5S C;  2IO2 C;  2GRN B;  3UIO C;  2GRR B;  2IY0 C;  2GRQ B;  2GRP B;  2IO3 C;  2GRO B;  3UIP C;  1KPS B;  3UIN C;  5D2M C; 
#chains in the Genus database with same CATH topology
 4A1S A;  3Q9U C;  4GTS A;  3FTY A;  3CEQ A;  4B8C B;  1K1B A;  2CG2 A;  3UT4 A;  1P5Q A;  2H6G A;  3EHM A;  3IXE A;  4CYM D;  2V0P A;  4ILG A;  2BUG A;  1BD8 A;  4CGW A;  3HYM B;  3K9I A;  1OWL A;  5AJD A;  3ESL A;  2PM7 A;  2WXI A;  3UT7 A;  1ELW A;  3UXG A;  4XKB A;  2OND A;  2XCC A;  3HG0 D;  4JXT A;  4X8Q A;  1KT1 A;  3F6Q A;  5CCL A;  3PZ3 A;  3ULQ A;  5ITZ F;  1NP7 A;  3EDT B;  4CCA A;  1TR4 A;  1EDU A;  2ILR A;  3TWR A;  4GML A;  3MA5 A;  2GRN B;  2L6J A;  3ABL E;  4FHJ A;  4JC8 A;  4HI9 A;  2OVB A;  3DSW A;  1TNO A;  1JUQ A;  4D10 C;  2BF0 X;  5E76 A;  4HLL A;  2L9B A;  1N94 A;  3SQV A;  4Q94 A;  1QNF A;  3ESK A;  3V2O A;  2ETA A;  3UMV A;  4E85 A;  3R9A B;  3P1U A;  5FQ7 A;  3C3O A;  5T8I A;  3CHO A;  4KYO B;  4L9P A;  3KSL A;  2X6K A;  4J6I A;  2I1J A;  3KS2 A;  4CT0 A;  1N0Q A;  4GZD A;  1H6P A;  3CHR A;  3JXJ A;  2VSO E;  4FHK A;  3PE4 A;  2OCC E;  3T8K A;  5AQ7 A;  1UN9 A;  2R5S A;  2IF4 A;  2P9I G;  1YYH A;  3CHS A;  3ZHE B;  3SBS A;  4XI9 A;  5G04 C;  2B0O E;  3MZL B;  4HLE A;  4AY6 A;  2J07 A;  5JMN D;  1XNF A;  2KZT A;  5FQ8 A;  1FT1 A;  1VDY A;  4M7C A;  4XIF A;  3VTY A;  5D66 A;  5ENQ D;  1NFI E;  4WND A;  3D9O A;  2LXL A;  3NAW A;  3DST A;  3AG3 E;  3Q4A B;  3DXK G;  5JJ6 A;  3LKU A;  5KWD A;  1JWF A;  3JXI A;  1H2U A;  1WY6 A;  4IYP A;  3DRA A;  3FUD A;  4RG9 A;  4L2Y A;  3TJP A;  1SZ9 A;  3IV0 A;  4GYW A;  2QFC A;  5BT1 A;  4NIK A;  2WXR A;  1IHB A;  1SQM A;  1L5J A;  4C0M A;  4FJY A;  2I1K A;  4BT8 A;  3GZ2 A;  2VQ2 A;  3EIQ C;  3CQC B;  5CER B;  5ENP D;  3RAU A;  3V30 A;  3UQ3 A;  2J9Q A;  4YVQ C;  3OXL A;  3UTM A;  3FEY A;  4GZ6 A;  2CHX A;  2EIK E;  1HG2 A;  5J90 A;  1FT2 A;  3U3W A;  5EX0 A;  2HO1 A;  4GTP A;  4DX2 A;  4GTQ A;  2HM8 A;  4WWO A;  4XEI G;  3KAE A;  4YDO A;  4NQ0 A;  1TNY A;  5LX8 A;  2WXM A;  4ILI A;  4B93 B;  3ZNG A;  3BEE A;  4FJZ A;  4HRN A;  5BV1 A;  4GZ3 A;  3ZUV B;  4UWL A;  4GYO A;  3DEO A;  1PY1 A;  5ENS D;  3UPV A;  3QNK A;  3G2T A;  1TEZ A;  4O1O A;  4G8L A;  3ZIM A;  2P9L G;  3TWQ A;  1N4P A;  1FCH A;  2Y4U A;  3ML9 A;  4L7T A;  1SA4 A;  3HDX A;  2XZD G;  4LER A;  2Y4T A;  4TXQ A;  4ANW A;  2FO7 A;  2HYZ A;  2AXU A;  3ZYL A;  1NZN A;  2H6F A;  1NA0 A;  3AS5 A;  1QZ2 A;  3FH7 A;  3EHN A;  1JCR A;  1IQU A;  4I17 A;  3ZVV A;  5HS0 A;  5KNH D;  5EIL A;  3B7R L;  3V31 A;  5B3S E;  3NZS A;  5JJT A;  2ZIR A;  4N3A A;  3DEP A;  5DBK A;  4EZL A;  2M63 A;  3CV0 A;  4U8H A;  2XPY A;  4K5B A;  4MKT A;  1ZB1 A;  2IO3 C;  4PS8 A;  4H7Y A;  1MJ0 A;  1E8W A;  4BSZ B;  3T5V A;  4HOS A;  1Q2Z A;  1MZC A;  4IRU A;  1X81 A;  3PNT B;  4JA9 A;  2VSY A;  1H2T C;  3PUJ A;  1O1R A;  4J8Y A;  3KD7 A;  3FTU A;  3MEK A;  2EIM E;  5G04 J;  4XKC A;  3I3N A;  2WQ6 A;  2LO6 A;  4KT6 B;  4I1O B;  2OEV A;  5D0Q D;  1Z5S C;  2PQR A;  2XHE A;  1OCC E;  3B95 A;  2J8S D;  4OVV A;  2WXJ A;  2XEN A;  3TWS A;  2FBN A;  3Q7A A;  3U9W A;  5KJM A;  5CBN A;  3ISM C;  2KXP C;  3QAR A;  4UWF A;  3C72 A;  2I9C A;  1TNZ A;  3RO3 A;  1YA0 A;  2LSU A;  3GYZ A;  3D9P A;  4LRZ A;  3CIA A;  3RK6 A;  1GW6 A;  5KJK A;  3EIJ A;  3V2X A;  3SHF A;  4ATZ D;  3Q9N C;  3ZGQ A;  4C0E A;  3E33 A;  4RVB A;  3KEZ A;  2LXM A;  3G2W A;  3Q79 A;  1AWC B;  3HRA A;  3RRU A;  1H6K A;  3TGO A;  2MRI A;  4ANX A;  2X6H A;  4TXP A;  3FUK A;  3PZ1 A;  2EQX A;  3CK9 A;  3QWV A;  3LJN A;  1WM5 A;  4TV3 A;  2VGX B;  2JAB A;  2WXH A;  3B7U X;  3SY2 A;  4DRX E;  2ZU6 B;  5ANL A;  2KAT A;  4A63 B;  3UIN C;  1K8K G;  4UUC A;  3ZW3 A;  1ELR A;  2DYR E;  5D2M C;  1B89 A;  4JVS A;  2ETB A;  1KZO A;  3Q5M A;  5EID A;  3ZYM A;  3PRZ A;  2FI7 A;  4UI9 K;  4QQI A;  1O1T A;  2QZA A;  1V55 E;  4JHR A;  5EX3 A;  1EPU A;  1FVF A;  3SBT B;  2WXG A;  4LNG A;  2F37 A;  3T8M A;  1WDY A;  3CST A;  5C1D A;  3O48 A;  3R7R A;  2F8Y A;  5BXO A;  2Y1L E;  2WXL A;  1V54 E;  4AY5 A;  4I2Z A;  5EN5 D;  3EHR A;  3MKQ A;  4ANU A;  3FFL A;  4GA2 A;  3SZ7 A;  4BES A;  2IY0 C;  3FHE A;  2LNI A;  4KVO A;  2I2O A;  1HF8 A;  3GW4 A;  1YMP A;  3FTS A;  3Q7F A;  3HXE A;  4AIF A;  3AS8 A;  4QFV A;  5AYW D;  4GMJ A;  2X6J A;  2WXF A;  2GRO B;  2L0I A;  3SD5 A;  4FUL A;  3V79 K;  1UN8 A;  2C0L A;  2H6H A;  3J5Q B;  3ZRH A;  4DJA A;  4LCT A;  2NSZ A;  4U8V D;  2VYI A;  3VLF A;  2ZGD A;  5AN8 A;  1O1S A;  4DX7 D;  1S0P A;  4U96 D;  2V5Q C;  2AXZ A;  3PZD A;  4WNF A;  5HRY A;  5CCM A;  3LY7 A;  3MJW A;  3S7F A;  2KCK A;  2YIN A;  1NI1 A;  1E96 B;  2IFU A;  4EQF A;  2XCB A;  4OAV B;  2P9P G;  2XEE A;  3TG5 A;  3UUX A;  4C48 B;  3RRN B;  3AS4 A;  4WWP A;  4ACL A;  4DI3 A;  1X5B A;  3EHQ A;  1K3Z D;  2V5F A;  1OCZ E;  2LUH A;  3MCX A;  3NZU A;  3FEX A;  1LTX A;  3LVQ E;  3D9K A;  4EZJ A;  2QYU A;  4RG6 A;  3PVL A;  5CRV A;  3HXF A;  4TXR A;  3HVE A;  1DCQ A;  4PUC A;  5KJL A;  1OWO A;  3FH8 A;  3CLJ A;  3FUI A;  2DWZ A;  1QQE A;  4JW1 A;  4Y6C A;  4FP7 A;  2DZN A;  1H6O A;  5CRU A;  5G05 J;  1S63 A;  3IHY A;  4O60 A;  3QWP A;  3APF A;  3LYA A;  5BPP A;  4EBA G;  2YNQ A;  3TL5 A;  4XE0 A;  5EKQ D;  5LCW J;  3ENE A;  4J8D A;  4UQX A;  1EF1 C;  5HI7 A;  4UQY A;  4YDY A;  3Q15 A;  4DI4 A;  3FU0 A;  4URK A;  3P2B A;  5AEN A;  1OY3 D;  3AU4 A;  1OCO E;  1FPP A;  3PS6 A;  3UIO C;  1JCQ A;  5G05 C;  4EHM A;  4N3B A;  1IXV A;  3AG4 E;  4F6R D;  4TUU A;  4G23 A;  5AAR A;  2VTB A;  4O6F A;  1OWN A;  3IHV A;  3S7J A;  4WNE A;  5FZS A;  5JA4 D;  3Q47 B;  4JEH A;  2P9S G;  2R59 A;  3PUK A;  4BFR A;  4DPR A;  1OT8 A;  1JPL A;  5CHE E;  2IEJ A;  4B8A A;  3E30 A;  4I9E A;  3DPY A;  3MKR A;  1MX4 A;  4J8E A;  2KCV A;  2GRL A;  3EU5 A;  2VGE A;  2KM4 A;  3S7B A;  3IEG A;  4W9R A;  3L13 A;  2KZT B;  2DVW A;  4O1P A;  1TN8 A;  3EJN A;  2VSX E;  1IKN D;  2GRR B;  3T9K A;  4GZ5 A;  3UIP C;  1OWM A;  4WAF A;  1MHQ A;  2BED A;  3DXM G;  2ETC A;  3HXC A;  4I2W A;  3D9I A;  3TAX A;  3ASG A;  4H7X A;  3BU8 A;  3D9H A;  3U64 A;  2IU1 A;  4HOR A;  5CBO A;  3C3R A;  4DX1 A;  5BW8 C;  1HFA A;  4B94 A;  4FA6 A;  3C5R A;  1BI7 B;  1E8X A;  1DVP A;  2R03 A;  3CVU A;  4GU5 A;  3L9T A;  1N4Q A;  5B1A E;  4HOU A;  2VJ8 A;  3EU9 A;  1RW2 A;  4JD2 G;  2XS8 A;  4AOF A;  2XRZ A;  3NOC D;  3LY9 A;  2DBA A;  2QY7 A;  2R2L A;  5ENO D;  3ZN3 A;  4DK5 A;  3ZXP A;  4K5C A;  3SGH A;  1WG0 A;  1TN6 A;  4CDM A;  1PAQ A;  1DC2 A;  4BWR A;  2WXQ A;  2RG8 A;  2OV8 A;  4XI0 A;  5EIB E;  1UJJ A;  5BUZ A;  2WMN A;  3C3Q A;  1D8D A;  4HRL A;  4JHK A;  2B6C A;  3D9M A;  1Y6I A;  4GCO A;  4AM9 A;  4DX5 D;  3R9M A;  2F0Y A;  3APD A;  2WXP A;  3ML8 A;  3QB2 A;  3SF4 A;  3LCA A;  5CMW A;  1UG3 A;  1UOH A;  5BXU A;  2WXO A;  1S70 B;  4UWK A;  4I9C A;  4AEZ C;  4YDW A;  2DIW A;  3FP3 A;  3J5P A;  3Q75 A;  2Y3A A;  5BNW A;  4HRM B;  1JCS A;  2ION A;  2OVF A;  4B0Z A;  3L6A A;  4OYS A;  3PZ2 A;  2FF4 A;  2XGS A;  4PS7 A;  3R7Q A;  4AP2 A;  2KBX A;  2FO1 E;  4BEP A;  4GAA A;  4N5Q A;  2DYS E;  4ZHB A;  3AG1 E;  2WXN A;  3ONK A;  3FUL A;  5CED B;  1HG5 A;  4L2L A;  1TYQ G;  4GA1 A;  1U3D A;  3SFZ A;  1ELK A;  5FZR A;  5T4Y A;  4XX5 A;  1N54 A;  1DNP A;  2AJA A;  1UW4 B;  4AVX A;  2IOS A;  1WAO 1;  4LNU D;  4DUI A;  4CEM A;  2VGY A;  2NYJ A;  2AWI A;  2P9U G;  3CVN A;  5FTP A;  1KPS B;  3VLE A;  3MGB A;  1E7V A;  3RO2 A;  3T5X A;  3E32 A;  5M72 A;  2P9N G;  5KBA A;  3FUN A;  1BPO A;  4LG6 A;  4F7A A;  5ARF A;  3UX4 A;  2CHW A;  4GPK A;  3FTW A;  3L54 A;  1IYG A;  4RSY A;  4GPM A;  2Y69 E;  3DSS A;  4I1A A;  4P29 A;  3HHM A;  4OAU C;  4HQD A;  3ZU7 B;  3ONL A;  4WWN A;  1AP7 A;  4N39 A;  3CHM A;  2V4L A;  3AAA C;  4MBG A;  2WM9 A;  4UWH A;  4UI9 C;  4BTB A;  2P58 C;  2F8X K;  4GTT A;  3NF1 A;  3TWW A;  4LUN U;  1BU9 A;  3QK0 A;  5FIO A;  3QKY A;  2E0I A;  5EYP F;  4NUR A;  3AG2 E;  5T3R A;  5A6C A;  2LSV A;  1E8Y A;  1N9A A;  4DX6 D;  4JHJ A;  2DCP A;  2RD0 A;  3LDZ A;  5KJN A;  4J0U A;  2DZO A;  1TNU A;  3UM1 A;  1D8E A;  3D9J A;  3PDN A;  3S7D A;  3FUH A;  3FTV A;  4L23 A;  3CK7 A;  4HOQ A;  4RQI A;  3QAQ A;  2VGX A;  5ENN A;  4HOT A;  2X6F A;  4A3V A;  3RRM B;  3JUE A;  3CQG B;  2RFM A;  2EIJ E;  2PNN A;  2UWJ G;  4IN3 B;  4I6G A;  2NC9 A;  3FWV A;  3GZS A;  4XZ4 A;  3HIZ A;  3HXB A;  4DLO A;  3FU5 A;  4KMO A;  4ABN A;  5BV0 A;  3N71 A;  3MYV A;  5J08 A;  3NBN B;  1KLX A;  3RKV A;  3TWU A;  3BG1 B;  4KXK B;  1D9S A;  1TJF A;  1N52 A;  4I6J A;  4G2V A;  2L0T B;  3CK8 A;  3OXF A;  4BET A;  3QOU A;  3MKQ B;  3PEV B;  4LNB A;  2HE0 A;  4J7W A;  3SFX A;  3KEA A;  3PH0 C;  3FUJ A;  4JPS A;  3FUF A;  5A7D B;  3Q73 A;  4GCN A;  3U66 A;  3VLD A;  3ZYQ A;  1DCE A;  4AJW A;  3D9N A;  4ILH B;  5EYL A;  3CVY A;  1E90 A;  5EDS A;  2XRY A;  3ASD A;  4K0R A;  3RJV A;  4GB9 A;  4CT4 A;  3RIB A;  1H19 A;  1KT0 A;  2QYJ A;  3PE3 A;  3QDN A;  3LY8 A;  2XGM A;  3CVP A;  2X6I A;  2ZIS A;  3B7T A;  4WNG A;  2RFA A;  3Q49 B;  3TWV A;  1UJK A;  4JB8 P;  3UM3 A;  2AVP A;  1HH8 A;  2PM6 A;  3CSF A;  1OCR E;  1EYH A;  4NAC A;  2LAH A;  4U0S A;  2YQ8 A;  4U63 A;  3TG4 A;  1SW6 A;  1RZ4 A;  4IUL A;  3ZEF A;  3LEW A;  5FJY A;  4F53 A;  4APF A;  2J4D A;  4FLH A;  4GTV A;  4GZC A;  2V4H C;  4F1S A;  3HVE B;  5AQA A;  4BSX A;  2PL2 A;  3UT8 A;  1E7U A;  1TNB A;  4Q69 A;  1N95 A;  3E37 A;  5CMY A;  3SFY A;  2WMO A;  4G11 A;  5H7P A;  2IO2 C;  3JYS A;  1SZA A;  1S64 A;  3RU0 A;  1K1A A;  4NRH B;  5C2Y A;  4APO A;  3CHQ A;  3CVQ A;  4G8K A;  4Y6W A;  1A17 A;  4Z68 A;  4G1T A;  4PDX A;  4CDN A;  3LVR E;  2FEZ A;  2VSN A;  3FTZ A;  4GTM A;  2GRQ B;  1JWG A;  3IBE A;  1TN7 A;  1QYM A;  2IJG X;  3L22 A;  5DIZ A;  2IOL A;  2MOW A;  3ULE G;  4B89 A;  3UKU G;  4GMR A;  4GA0 A;  3OXG A;  4HNA D;  5HKP A;  5ARG A;  5G2N A;  1O5M A;  5ANR A;  1BLX B;  4KZ0 A;  2V8S E;  2BTD A;  3LXU X;  1HE8 A;  3RSE G;  4FAD A;  2EIN E;  4TUM A;  2OEW A;  3ZXS A;  3G2S A;  3KSQ A;  2KCL A;  3FTX A;  4WUY A;  5B1B E;  2E2E A;  4J8F A;  4YDE A;  4CDR A;  2XQ0 A;  4HB5 A;  1HXI A;  1ZBP A;  4HS2 A;  2ZXW E;  3Q78 A;  3TWT A;  2RKK A;  3B7S A;  3ASH A;  1E8Z A;  4ATG A;  5AAO A;  1FVH A;  4I43 A;  3TXN A;  3UM2 A;  1Z3Y A;  2J49 A;  3ASO E;  2WB2 A;  2BKK B;  4U0Z A;  3LS8 A;  2NXP A;  2QC9 A;  1N11 A;  5AQB A;  3TXM A;  3ZYK A;  4J8S A;  4AXH A;  4UQZ A;  3ULY A;  3SNX A;  2A5E A;  1U2V G;  5JJ7 A;  4U04 A;  4YVO A;  3DSV A;  1HS6 A;  1N4S A;  5CEA A;  1LD8 A;  2BKG A;  3G2V A;  1MX2 A;  1OUV A;  3OAW A;  3PRE A;  5IY5 E;  3PZ4 A;  4U8Y D;  3FUE A;  2PQN A;  2I6H A;  2L6B A;  5CEC B;  2CFU A;  3UM0 A;  3CKC A;  4TRQ A;  3WG7 E;  3U4T A;  4G24 A;  5A23 A;  3E4B A;  2XZT G;  3CKB A;  3ZKJ A;  4U7E B;  3C98 A;  3NB2 A;  2GW1 A;  3DWL G;  4CZ2 D;  4ME2 A;  4MRU A;  3UKR G;  3B13 A;  2X38 A;  2A5U A;  4ANV A;  5AIJ A;  2CHZ A;  5FQ4 A;  4JEU A;  2CG3 A;  1PC2 A;  2C2L A;  2EIL E;  4ZFH A;  3D3M A;  3CVL A;  4HBD A;  5G55 A;  4GYY A;  5FZQ A;  1N4R A;  3BG0 B;  3BQO A;  4Q96 A;  2GRP B;  3HXD A;  1BI8 B;  2XGO A;  3QWW A;  1W3B A;  4A1G A;  5LP0 A;  4F3V A;  3FH5 A;  4E6H A;  1XGW A;  2WQH A;  3FU3 A;  4KBQ A;  3DSU A;  4PS3 A;  3QJZ A;  5ENT D;  3BUA A;  3JQ1 A;  3PEU B;  4JA7 A;  4CRW A;  2XPZ A;  1HO8 A;  2X3M A;  2R17 C;  4EEC A;  3WXX A;  2J4B A;  2WVI A;  5LCW C;  3FY4 A;  4U07 A;  3ZFW A;  4K03 A;  2A4Z A;  4GTR A;  3ZPJ A;  4HVB A;  4RLY A;  2WPV A;  3LPZ A;  2Y0B G;  4GTO A;  4LEU A;  3X2Q E;  2YHE A;  1SA5 A;  5ENR D;  3CVX A;  1Y8M A;  3ASF A;  4AV7 A;  1N0R A;  3FUM A;  1HZ4 A;  3NQP A;  2MHK A;  3FDH A;  2YHC A;  4BT9 A;  1IHG A;  1MX6 A;  2P9K G;  3ABK E;  2WQ7 A;  3QC1 A;  3IKO B;  1Z3X A;  3I4R B;  3L16 A;  4BY6 A;  3UI2 A;  3GZ1 A;  4EBA A;  3TWX A;  2ZGG A;  3SI5 A;  3JCK C;  1HU3 A;  1H0A A;  1NL4 A;  2GGF A;  2MYO A;  4LSZ E;  4N3C A;  1HX8 A;  4JZY A;  1NA3 A;  2J09 A;  2OOE A;  3L82 A;  5KCM A;  2IQC A;  2VTB B;  3ABM E;  2UY1 A;  3I5P A;  4MS6 A;  1TJC A;  5D0O D;  4M3O A;  4G26 A;  2WXK A;  3W9G A;  2XPI A;  4F1P A;  1KZP A;  3E34 A;  3DBS A;  3D9L A;  1YCS B;  3APC A;  5E75 A;  3NOG D;  4V3I A;  1IQR A;  3L08 A;  3PNL B;  2P2C P;  4FLB A;  4KVM A;  4UI9 J;  2AW6 A;  2LAI A;  4EPZ A;  4HI8 A;  5FQ6 A;  2AXV A;  4YND A;  4I1M A;  2GRM A;  2XS1 A;  2J08 A;  5LFA A;  4G25 A;  4U0U A;  4DLQ A;  1INZ A;  4L1B A;  5FIN A;  1MQS A;  3DSX A;  3CVV A;  1Z6T A;  4BER A;  1LF8 A;  2R05 A;  1MYO A;  2JEK A;  4N2Q A;  4OVU A;  3CHP A;  1SVX A;  3AJI A;  4BTA A;  3ZHE A;  3B7B A;  5JHB A;  5LOZ A;  1ZU2 A;  3EUV A;  4JL0 A;  1A5E A;  2CFZ A;  4I6E A;  3I4G A;  4ACK A;  4N2S A;  3CVW A;  4K5A B;  4N5C A;  3W9F A;  4UWG A;  4A3T A;  4HXI A;  3LJ3 A;  3URZ A;  1U3C A;  2Q7F A;  2JLB A;  5FT9 A;  2HR2 A;  2UY1 B;  3MX3 A;  3G2U A;  4BX9 A;  4FU3 A;  4U95 D;  3JQ0 A;  3S2A A;  1OWP A;  4HFG A;  3SO8 A;  3JUI A;  4FC8 A;  1OXJ A;  2C0M A;  3MV3 B;  4KZC A;  3OTN A;  3FU6 A;  5FWQ A;  5HQ8 A;  5KNG A;  3CR3 A;  5AJL A;  4CGV A;  2XEV A;  3VTX A;  3AU5 A;  2H6I A;  3O4Z A;  2KC7 A;  4A55 A;  1LD7 A;  4EZK A;  3DPD A;  2XEH A;  4BX8 A;  2R02 A;  3L17 A;  3CGH A;  4PH4 B;  3ASN E;  4C9B B;  5AQ9 A;  2PZI A;  1G3N B;  1H2V C;  3MV2 B;  1QBQ A;  4MLP A;  2FUL A;  5JHA A;  4R7L A; 
#chains in the Genus database with same CATH homology
 1Z5S C;  2IO2 C;  2GRN B;  3UIO C;  2GRR B;  2IY0 C;  2GRQ B;  2GRP B;  2IO3 C;  2GRO B;  3UIP C;  1KPS B;  3UIN C;  5D2M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...