2GROB

Crystal structure of human rangap1-ubc9-n85q
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
157
structure length
157
Chain Sequence
b'PADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Lysine activation and functional analysis of E2-mediated conjugation in the SUMO pathway.
pubmed doi rcsb
molecule keywords Ubiquitin-conjugating enzyme E2 I
source organism Homo sapiens
molecule tags Ligase
total genus 59
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2groB00
2GRNB 2GRRB 2IY0C 1Z5SC 3UINC 2IO2C 2GRQB 2GRPB 5D2MC 1KPSB 3UIPC 2GROB 2IO3C 3UIOC
chains in the Genus database with same CATH superfamily
3CKBA 5EX3A 2P9PG 1N9AA 1UJKA 4XKBA 2P9UG 3CK9A 4BT9A 2ETAA 4CRWA 3ASHA 4LSZE 4X8QA 4FHKA 4LERA 4YNDA 3SO8A 4EZJA 1AP7A 3FP3A 4I6JA 1FVFA 2ETCA 3I3NA 2H6GA 3ZXPA 1OCCE 2DZOA 3CLJA 1NA0A 2C0MA 4L2YA 4GMLA 1ELWA 3G2WA 2IOSA 3PRZA 5FTPA 2BF0X 1LD7A 4AXHA 2Y4UA 5FJYA 5CCMA 4M7CA 5G55A 3PNTB 3UXGA 2DYSE 1OWOA 4NQ0A 4DX1A 4N2QA 1S70B 3PE3A 4GYOA 4PDXA 5AJLA 3VTXA 3ASFA 2HYZA 1HG5A 5D2MC 3RIBA 3HDXA 5FWQA 1KT0A 3IKOB 2EIJE 1IHBA 1E7UA 4G1TA 3FFLA 4FLHA 4B8AA 3AG2E 2X6IA 4A55A 3AG1E 3PEVB 3U66A 2LSVA 4JZYA 3EU9A 1Y6IA 2RD0A 3B7SA 1Z6TA 2EIME 2X6JA 3DSTA 3NAWA 4WWPA 1HXIA 3CK8A 2AXUA 3SFYA 5D0OD 3RKVA 2Y1LE 3PVLA 3SFZA 2A5UA 3L22A 4FJZA 3TG5A 3EIQC 5KJNA 4GZDA 3UM3A 3IHYA 1KT1A 2XRYA 2R59A 1TR4A 3CQGB 3Q75A 4Q96A 4NACA 5CBNA 2GRRB 3CQCB 3ML8A 2BUGA 3D9LA 2R03A 2YINA 3VLEA 4MKTA 4O1PA 3I5PA 3RRNB 4GPKA 4GZ6A 2VTBA 3CVQA 4ATGA 4DX7D 4TXRA 4GTVA 3ASNE 2V4LA 1YA0A 2WXJA 1Y8MA 2EINE 3W9GA 2IU1A 1Z5SC 3GYZA 5KJMA 1ZB1A 1P5QA 4DLOA 2QZAA 4JEUA 1MX6A 3DXKG 3B13A 3ZEFA 3GZ1A 2FI7A 2WQ6A 4XE0A 5EX0A 3E30A 5BXUA 3FUHA 2DVWA 4I2ZA 5E76A 3ZYKA 3ASDA 2J4BA 3KAEA 4GTOA 2GRNB 4E6HA 3KS2A 2R17C 3C98A 3LY9A 5FT9A 2GRQB 3TWXA 4BY6A 4GMRA 1DNPA 1IYGA 2RG8A 2WXLA 4K5BA 3QNKA 4ILIA 5FQ6A 2WB2A 3F6QA 1TNBA 2ZXWE 3UM2A 2IF4A 3KEZA 2XS8A 4JW1A 4UWFA 3D9NA 4UI9K 5ANRA 4A1GA 1H6OA 5D66A 3PUJA 2ILRA 1WG0A 2F37A 3MX3A 1TNUA 4JHJA 4OAUC 5AIJA 4FHJA 3L54A 3LS8A 5ENTD 3T9KA 3C3QA 5HKPA 4C9BB 3SHFA 3U9WA 2MHKA 2KXPC 3Q5MA 2XQ0A 1EYHA 1QNFA 2HM8A 2L0IA 3FY4A 2L0TB 4G8LA 2LO6A 3K9IA 2FO1E 3DWLG 5A6CA 2IY0C 1BI7B 4GYYA 5ENPD 2H6IA 3E32A 4HBDA 4I6EA 2MOWA 3LCAA 4WWOA 3CR3A 4DPRA 2VSOE 3FH8A 5CMWA 1OUVA 4GYWA 3B7UX 3PEUB 3MYVA 3UPVA 4U7EB 3T8KA 4EHMA 3CSTA 1SZAA 1IQUA 4BETA 2XPYA 3HG0D 4I43A 4J8YA 5ARFA 2VGXB 4L1BA 1VDYA 2KBXA 2R2LA 4DLQA 3NBNB 4CT0A 4XKCA 3E34A 3W9FA 4L23A 4CT4A 4HRLA 3RU0A 2CFUA 3SNXA 1Z3YA 1JPLA 4K03A 3EHQA 4U8YD 2PM6A 2CHZA 3CHQA 4UQYA 5LX8A 4WUYA 3GW4A 1H19A 3JQ0A 3TWRA 5JA4D 4U0SA 5FZRA 5JJTA 2AXVA 3G2VA 3HRAA 1KPSB 2VGEA 1UG3A 3LYAA 1DVPA 4I17A 1D8EA 2VJ8A 3FTYA 2QFCA 3FU3A 4GU5A 3RO3A 5A7DB 4XEIG 5KNHD 4CDRA 5CMYA 2NYJA 3V2OA 2V5QC 1HE8A 4XI9A 4A63B 3J5QB 5E75A 3SD5A 2FBNA 4I9CA 4ANVA 2XGOA 4F3VA 4HI9A 3L16A 5KNGA 3EIJA 1HO8A 4K5CA 1UN8A 1H2UA 4HFGA 4YDWA 1LF8A 4G2VA 4EBAG 5BT1A 3UIPC 3TAXA 1PY1A 5HQ8A 3CVVA 3AG4E 4HB5A 2QY7A 5ENQD 4L2LA 5LP0A 3OXFA 3ISMC 3PH0C 1FPPA 3Q73A 3NOGD 3QKYA 3S7DA 2IONA 4NURA 3TL5A 3PREA 4A3TA 2XZTG 3MV2B 1E7VA 5CERB 3NOCD 5AAOA 2I1JA 4UI9J 4JC8A 5T4YA 3TWSA 5CRUA 3ZIMA 4G8KA 5AENA 4ACKA 3D9PA 3D3MA 3QAQA 1OCRE 4EZKA 2AXZA 4BFRA 3E33A 2FF4A 2XEHA 4TUUA 3NQPA 2E2EA 3HXCA 2WVIA 4GAAA 3AS8A 2IOLA 3FUJA 4AJWA 2P2CP 4J7WA 2DWZA 2WXGA 2OCCE 3BU8A 1N94A 2ONDA 3QWVA 3CSFA 4U04A 5FIOA 1PC2A 3G2SA 4G26A 4TRQA 2WPVA 3TJPA 4FP7A 4EQFA 4BT8A 5AQAA 2VSYA 1G3NB 3Q49B 3Q7AA 4WNFA 4RG9A 4CYMD 3UQ3A 4IRUA 2H6HA 4QFVA 1JCRA 3QWPA 4OYSA 1N4SA 2LXLA 4NIKA 3CVNA 5B1BE 5FQ7A 4EZLA 3ZXSA 4OVUA 3ABLE 3PS6A 1YMPA 4ZFHA 4I1MA 3APCA 3DEPA 2IEJA 4LEUA 1D8DA 3BUAA 2I6HA 4U96D 1HU3A 4HLEA 2VQ2A 4Y6CA 4B89A 3UIOC 3ZGQA 1HG2A 4N5QA 4L7TA 5KCMA 5C2YA 1TJCA 2WMNA 3S2AA 2F8YA 3TWWA 1UOHA 3CK7A 2V0PA 5G04C 3TWUA 3AU4A 3ASGA 2L9BA 3CHRA 3FUKA 2EQXA 2Y3AA 4U8HA 2HO1A 4ANWA 1MZCA 4URKA 2KCLA 1Z3XA 2XCCA 2I2OA 1AWCB 5FQ4A 1H6PA 4GTPA 3FUNA 2Y4TA 3FTWA 2XPZA 2OEVA 3ABME 1NZNA 3NZSA 1N0QA 3ONKA 4N5CA 2C0LA 4HNAD 2E0IA 3L6AA 2CHXA 2HR2A 2XPIA 2X38A 1W3BA 4GTQA 4K5AB 3CHPA 1O1TA 4RLYA 4UWGA 5G04J 3MGBA 3HXDA 5EILA 4DX6D 3IHVA 4FADA 3U64A 3UKUG 3ZKJA 1H2VC 4WNGA 5HRYA 3URZA 3APFA 3OXLA 1KZPA 1MHQA 4HORA 4XX5A 4U63A 1MYOA 1A17A 4PS8A 3UTMA 3KEAA 4HOUA 5EYPF 3SFXA 5CECB 2VGYA 3CHMA 1X81A 1E96B 2NC9A 5KBAA 4GZ3A 4JPSA 4DI4A 3L82A 4F6RD 3MV3B 3IXEA 2WQ7A 2GRMA 3DPDA 2YQ8A 2IQCA 4U0UA 1WM5A 4B94A 3TWTA 3B7BA 4I9EA 1HF8A 4CZ2D 2XGSA 1E8XA 3ZU7B 3CVPA 5CRVA 4J6IA 2RFAA 3HXFA 3UI2A 3FUEA 2LAIA 3PZ3A 2YNQA 5T3RA 2J49A 1OWNA 2QYJA 3Q79A 3EU5A 1IHGA 1HS6A 1WAO1 4IULA 4BERA 3PZ2A 1QBQA 3ONLA 1N11A 3V30A 4YVQC 4FA6A 4FJYA 4GA1A 4C0MA 5CBOA 3C3RA 5JHBA 4BEPA 3FHEA 5BV0A 3JQ1A 2QYUA 3P2BA 3LEWA 5LFAA 3R7RA 2WM9A 4C48B 4BSZB 3D9KA 5FINA 3KD7A 2OVBA 2IFUA 1MJ0A 2JABA 4EBAA 4BX9A 2YHEA 1K8KG 3DBSA 5EN5D 3ZN3A 2J08A 4N3AA 5EIBE 1UN9A 2WXRA 4FULA 4JA7A 3CGHA 3ZYQA 5KJKA 4B93B 1WY6A 4PS3A 4H7YA 4NRHB 5CCLA 3R9MA 3R9AB 3Q78A 4JA9A 3D9MA 1NL4A 3IV0A 4LNBA 3FTZA 1FT1A 5CHEE 1OWLA 2PZIA 4BTAA 3X2QE 5LOZA 1V55E 2R05A 3C3OA 2MYOA 4GZCA 2LAHA 4G11A 4OAVB 4KVMA 5CEAA 1E90A 4PS7A 2IJGX 2FO7A 4DK5A 1N52A 2DBAA 3PNLB 4M3OA 4AP2A 3Q4AB 3BG0B 1BD8A 4CEMA 5D0QD 4A1SA 5DBKA 4GTMA 4CGWA 5EIDA 4MRUA 4FLBA 1LD8A 2FEZA 3JUIA 1BLXB 4KBQA 3UX4A 3HHMA 3C5RA 1TYQG 1NP7A 2GW1A 3ZFWA 1OT8A 3GZ2A 3ML9A 3UM1A 4J8EA 2WXQA 2WXKA 2C2LA 3GZSA 3WXXA 4JHKA 3QB2A 3CKCA 3ENEA 3CEQA 1ELRA 1N4QA 2XCBA 5AQBA 3EUVA 4HLLA 3AG3E 4CGVA 2AWIA 1A5EA 4ATZD 2WMOA 3HVEB 1E8ZA 4YDEA 5AJDA 3ZUVB 4LRZA 4IN3B 2HE0A 4W9RA 3FTUA 2X6FA 3G2UA 3NZUA 4IYPA 3PZDA 4DI3A 3FEXA 1TN7A 3MA5A 4N39A 4ME2A 3LVQE 1UJJA 3MZLB 3FWVA 3QOUA 2CFZA 4F1PA 3L08A 5JHAA 3LPZA 2F0YA 3QDNA 4UI9C 3TWQA 2OOEA 3MJWA 2AJAA 5FZQA 2OVFA 1BI8B 1TNYA 3LVRE 3D9OA 3L13A 1N95A 1YCSB 4F53A 3MCXA 5HI7A 4O6FA 4WNEA 4RG6A 4UQXA 4AOFA 4RSYA 3DRAA 5ARGA 4UWKA 2FULA 3FEYA 3FUDA 4GB9A 4XIFA 4UWHA 2DYRE 5KJLA 1HX8A 5LCWJ 4AIFA 4AY5A 4J8FA 2PL2A 2DIWA 2WXNA 4GTSA 2PM7A 3ULEG 2IO2C 1S64A 4GMJA 2Q7FA 1HFAA 3EDTB 1ZU2A 3SY2A 3AU5A 2VGXA 4LNUD 2IO3C 3RJVA 2LNIA 1EF1C 3AS4A 3AS5A 3ZRHA 4H7XA 3DSSA 4ABNA 3TWVA 4DUIA 3UM0A 2XRZA 1PAQA 3FU6A 1K3ZD 2J8SD 4KZ0A 5JMND 3OAWA 4BSXA 2XENA 3UT4A 2ETBA 3HYMB 1O1SA 2A4ZA 3QWWA 4J8DA 2V8SE 4MS6A 4E85A 1KZOA 3AJIA 2A5EA 5M72A 3FH5A 5ENNA 1TJFA 3ZHEB 3CVXA 1TN6A 3V79K 3ULQA 4BESA 4XZ4A 3HVEA 2PQRA 3E37A 4QQIA 5BXOA 3CVLA 4LNGA 3DSXA 4ILGA 2JEKA 1KLXA 3B7TA 2MRIA 2VTBB 4TXPA 4J0UA 4WWNA 4GA0A 4L9PA 4Z68A 2VYIA 4D10C 3ULYA 5DIZA 1N0RA 4KVOA 3JXIA 1N4RA 4O1OA 3ESLA 2AVPA 3FU0A 3BEEA 1D9SA 5KWDA 3OXGA 5BPPA 3S7JA 4ANXA 3JCKC 2KC7A 2V4HC 3B95A 3ASOE 3PZ4A 1NA3A 2I1KA 3I4RB 2J09A 3R7QA 3DPYA 5AN8A 4Q94A 4JXTA 1U2VG 3U3WA 3UMVA 4CCAA 3ZVVA 4MLPA 3PZ1A 4AEZC 4HOSA 4PH4B 2QC9A 5FZSA 4TUMA 3TG4A 1O1RA 4HXIA 1WDYA 4TV3A 3FTXA 4CDNA 3UKRG 2WXFA 1Q2ZA 4UWLA 2GRLA 4HRMB 5EKQD 4KXKB 3V31A 2GRPB 3ESKA 2J9QA 3FULA 4I2WA 3CHSA 2EILE 5ENSD 2GGFA 3RO2A 5AQ9A 2L6JA 2P9IG 2LUHA 3NF1A 1JWGA 2KCKA 2M63A 3KSQA 3ZPJA 5AARA 2KZTB 2P58C 3FDHA 2WXMA 4AV7A 1DCEA 1JWFA 3VTYA 2KCVA 3TGOA 3RRUA 3EHRA 2NXPA 3RAUA 1OY3D 2P9SG 4R7LA 3ZHEA 2EIKE 4C0EA 1JCQA 4UUCA 2XZDG 1H6KA 4ZHBA 3LJNA 4YDOA 1NFIE 3APDA 5JJ6A 1S63A 5BUZA 4I1OB 4BWRA 3FTSA 3RRMB 1IXVA 3UT8A 5ENOD 5IY5E 1GW6A 2L6BA 2UY1B 1OWMA 1HH8A 2XEEA 4JB8P 3U4TA 3ZYLA 3MKQB 5J08A 4BTBA 1OCOE 1K1AA 2DZNA 4AM9A 3IEGA 3EJNA 4CDMA 4HVBA 3Q47B 3FUIA 4OVVA 3FH7A 2XS1A 1NI1A 3FTVA 4HOTA 4G23A 4APFA 5ANLA 2WXIA 4BX8A 3T5VA 2X6KA 3MEKA 3UINC 5ITZF 2KM4A 2GROB 3DSVA 2XEVA 4U0ZA 1MX2A 3Q15A 3CHOA 1TNZA 3HXEA 4KMOA 1OXJA 3EHMA 3D9IA 2YHCA 1U3DA 1OCZE 3EHNA 4K0RA 2B6CA 5BV1A 3S7FA 5BW8C 1MQSA 1FT2A 5G2NA 3N71A 5HS0A 3TXNA 4AY6A 4U8VD 4JL0A 3T5XA 4RVBA 4DX5D 5AYWD 5AQ7A 1FCHA 3NB2A 5CEDB 4Q69A 4HI8A 2NSZA 4JVSA 1U3CA 3VLDA 3MKRA 3PDNA 1RZ4A 3P1UA 4WAFA 4WNDA 4B8CB 2X3MA 4JEHA 1N4PA 1S0PA 2DCPA 2KZTA 5G05C 3IBEA 1EDUA 3JUEA 3B7RL 1SA5A 2PQNA 3LY8A 2ZU6B 1SVXA 3V2XA 1BPOA 3O48A 5FQ8A 3Q7FA 4F1SA 2RFMA 2J07A 4YVOA 1SZ9A 3SF4A 4N3CA 4LG6A 4GZ5A 3DEOA 3D9JA 3WG7E 3BQOA 3L9TA 1DCQA 4DRXE 4F7AA 5J90A 3G2TA 3SGHA 3SBSA 3JYSA 3SI5A 2H6FA 3QARA 4B0ZA 2OEWA 2UY1A 4A3VA 3DSUA 4GTTA 5G05J 1O5MA 2WXHA 4J8SA 4DX2A 3RSEG 1E8YA 3MKQA 2WXOA 3CV0A 1FVHA 1INZA 2BEDA 3ZNGA 3O4ZA 3S7BA 4GCOA 2P9KG 3FU5A 3SZ7A 1UW4B 1ELKA 2WXPA 3KSLA 3SBTB 3C72A 1EPUA 4JHRA 4GCNA 4I6GA 4KT6B 3J5PA 1OWPA 5B3SE 4Y6WA 4ANUA 3UT7A 3CIAA 2VSNA 3HIZA 4EPZA 1L5JA 2I9CA 1SQMA 1DC2A 1SA4A 4HRNA 3ABKE 1K1BA 1QQEA 5B1AE 2CHWA 3TXMA 2P9LG 1IKND 2BTDA 3LXUX 4P29A 3UUXA 2R02A 3Q9UC 2KATA 3CVWA 1JCSA 3AAAC 2LXMA 4G24A 5LCWC 3OTNA 2BKKB 3ZYMA 3FUFA 3L17A 4FU3A 1XGWA 5JJ7A 1JUQA 2CG2A 3I4GA 1H0AA 2ZGDA 5EYLA 2P9NG 3DXMG 4GA2A 3CVYA 4KZCA 4ACLA 4GPMA 3CVUA 3E4BA 3LJ3A 2UWJG 5ENRD 2Y0BG 4YDYA 2XGMA 1IQRA 4APOA 4DJAA 2ZGGA 4V3IA 1H2TC 1MX4A 1V54E 4O60A 4KYOB 4RQIA 3PE4A 3LY7A 4GTRA 2B0OE 1TNOA 3PUKA 4JD2G 1LTXA 1QZ2A 4FC8A 2OV8A 1RW2A 4U95D 4LUNU 4U07A 3BG1B 1E8WA 3QJZA 2XHEA 1N54A 1YYHA 3LKUA 4EECA 3RK6A 5H7PA 2RKKA 3QK0A 5T8IA 5C1DA 5A23A 1X5BA 2LSUA 2VSXE 4UQZA 4PUCA 3SQVA 2F8XK 1TN8A 4G25A 3JXJA 4ILHB 4LCTA 1BU9A 2Y69E 1SW6A 4MBGA 2BKGA 5BNWA 3QC1A 3VLFA 4HS2A 3D9HA 1ZBPA 2ZISA 4HQDA 2JLBA 2PNNA 2V5FA 3HXBA 5EDSA 3LDZA 4I1AA 2X6HA 3T8MA 4HOQA 1QYMA 4XI0A 2ZIRA 1TEZA 4AVXA 2J4DA 1B89A 3Q9NC 3DSWA 2AW6A 2CG3A 3FUMA 2R5SA 4TXQA 1HZ4A 3ZW3A 1XNFA 4N2SA 2WQHA 4N3BA
chains in the Genus database with same CATH topology
2GRNB 2GRRB 2IY0C 1Z5SC 3UINC 2IO2C 2GRQB 2GRPB 5D2MC 1KPSB 3UIPC 2GROB 2IO3C 3UIOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRN B;  2GRR B;  2IY0 C;  1Z5S C;  3UIN C;  2IO2 C;  2GRQ B;  2GRP B;  5D2M C;  1KPS B;  3UIP C;  2GRO B;  2IO3 C;  3UIO C; 
#chains in the Genus database with same CATH topology
 3CKB A;  5EX3 A;  2P9P G;  1N9A A;  1UJK A;  4XKB A;  2P9U G;  3CK9 A;  4BT9 A;  2ETA A;  4CRW A;  3ASH A;  4LSZ E;  4X8Q A;  4FHK A;  4LER A;  4YND A;  3SO8 A;  4EZJ A;  1AP7 A;  3FP3 A;  4I6J A;  1FVF A;  2ETC A;  3I3N A;  2H6G A;  3ZXP A;  1OCC E;  2DZO A;  3CLJ A;  1NA0 A;  2C0M A;  4L2Y A;  4GML A;  1ELW A;  3G2W A;  2IOS A;  3PRZ A;  5FTP A;  2BF0 X;  1LD7 A;  4AXH A;  2Y4U A;  5FJY A;  5CCM A;  4M7C A;  5G55 A;  3PNT B;  3UXG A;  2DYS E;  1OWO A;  4NQ0 A;  4DX1 A;  4N2Q A;  1S70 B;  3PE3 A;  4GYO A;  4PDX A;  5AJL A;  3VTX A;  3ASF A;  2HYZ A;  1HG5 A;  5D2M C;  3RIB A;  3HDX A;  5FWQ A;  1KT0 A;  3IKO B;  2EIJ E;  1IHB A;  1E7U A;  4G1T A;  3FFL A;  4FLH A;  4B8A A;  3AG2 E;  2X6I A;  4A55 A;  3AG1 E;  3PEV B;  3U66 A;  2LSV A;  4JZY A;  3EU9 A;  1Y6I A;  2RD0 A;  3B7S A;  1Z6T A;  2EIM E;  2X6J A;  3DST A;  3NAW A;  4WWP A;  1HXI A;  3CK8 A;  2AXU A;  3SFY A;  5D0O D;  3RKV A;  2Y1L E;  3PVL A;  3SFZ A;  2A5U A;  3L22 A;  4FJZ A;  3TG5 A;  3EIQ C;  5KJN A;  4GZD A;  3UM3 A;  3IHY A;  1KT1 A;  2XRY A;  2R59 A;  1TR4 A;  3CQG B;  3Q75 A;  4Q96 A;  4NAC A;  5CBN A;  2GRR B;  3CQC B;  3ML8 A;  2BUG A;  3D9L A;  2R03 A;  2YIN A;  3VLE A;  4MKT A;  4O1P A;  3I5P A;  3RRN B;  4GPK A;  4GZ6 A;  2VTB A;  3CVQ A;  4ATG A;  4DX7 D;  4TXR A;  4GTV A;  3ASN E;  2V4L A;  1YA0 A;  2WXJ A;  1Y8M A;  2EIN E;  3W9G A;  2IU1 A;  1Z5S C;  3GYZ A;  5KJM A;  1ZB1 A;  1P5Q A;  4DLO A;  2QZA A;  4JEU A;  1MX6 A;  3DXK G;  3B13 A;  3ZEF A;  3GZ1 A;  2FI7 A;  2WQ6 A;  4XE0 A;  5EX0 A;  3E30 A;  5BXU A;  3FUH A;  2DVW A;  4I2Z A;  5E76 A;  3ZYK A;  3ASD A;  2J4B A;  3KAE A;  4GTO A;  2GRN B;  4E6H A;  3KS2 A;  2R17 C;  3C98 A;  3LY9 A;  5FT9 A;  2GRQ B;  3TWX A;  4BY6 A;  4GMR A;  1DNP A;  1IYG A;  2RG8 A;  2WXL A;  4K5B A;  3QNK A;  4ILI A;  5FQ6 A;  2WB2 A;  3F6Q A;  1TNB A;  2ZXW E;  3UM2 A;  2IF4 A;  3KEZ A;  2XS8 A;  4JW1 A;  4UWF A;  3D9N A;  4UI9 K;  5ANR A;  4A1G A;  1H6O A;  5D66 A;  3PUJ A;  2ILR A;  1WG0 A;  2F37 A;  3MX3 A;  1TNU A;  4JHJ A;  4OAU C;  5AIJ A;  4FHJ A;  3L54 A;  3LS8 A;  5ENT D;  3T9K A;  3C3Q A;  5HKP A;  4C9B B;  3SHF A;  3U9W A;  2MHK A;  2KXP C;  3Q5M A;  2XQ0 A;  1EYH A;  1QNF A;  2HM8 A;  2L0I A;  3FY4 A;  2L0T B;  4G8L A;  2LO6 A;  3K9I A;  2FO1 E;  3DWL G;  5A6C A;  2IY0 C;  1BI7 B;  4GYY A;  5ENP D;  2H6I A;  3E32 A;  4HBD A;  4I6E A;  2MOW A;  3LCA A;  4WWO A;  3CR3 A;  4DPR A;  2VSO E;  3FH8 A;  5CMW A;  1OUV A;  4GYW A;  3B7U X;  3PEU B;  3MYV A;  3UPV A;  4U7E B;  3T8K A;  4EHM A;  3CST A;  1SZA A;  1IQU A;  4BET A;  2XPY A;  3HG0 D;  4I43 A;  4J8Y A;  5ARF A;  2VGX B;  4L1B A;  1VDY A;  2KBX A;  2R2L A;  4DLQ A;  3NBN B;  4CT0 A;  4XKC A;  3E34 A;  3W9F A;  4L23 A;  4CT4 A;  4HRL A;  3RU0 A;  2CFU A;  3SNX A;  1Z3Y A;  1JPL A;  4K03 A;  3EHQ A;  4U8Y D;  2PM6 A;  2CHZ A;  3CHQ A;  4UQY A;  5LX8 A;  4WUY A;  3GW4 A;  1H19 A;  3JQ0 A;  3TWR A;  5JA4 D;  4U0S A;  5FZR A;  5JJT A;  2AXV A;  3G2V A;  3HRA A;  1KPS B;  2VGE A;  1UG3 A;  3LYA A;  1DVP A;  4I17 A;  1D8E A;  2VJ8 A;  3FTY A;  2QFC A;  3FU3 A;  4GU5 A;  3RO3 A;  5A7D B;  4XEI G;  5KNH D;  4CDR A;  5CMY A;  2NYJ A;  3V2O A;  2V5Q C;  1HE8 A;  4XI9 A;  4A63 B;  3J5Q B;  5E75 A;  3SD5 A;  2FBN A;  4I9C A;  4ANV A;  2XGO A;  4F3V A;  4HI9 A;  3L16 A;  5KNG A;  3EIJ A;  1HO8 A;  4K5C A;  1UN8 A;  1H2U A;  4HFG A;  4YDW A;  1LF8 A;  4G2V A;  4EBA G;  5BT1 A;  3UIP C;  3TAX A;  1PY1 A;  5HQ8 A;  3CVV A;  3AG4 E;  4HB5 A;  2QY7 A;  5ENQ D;  4L2L A;  5LP0 A;  3OXF A;  3ISM C;  3PH0 C;  1FPP A;  3Q73 A;  3NOG D;  3QKY A;  3S7D A;  2ION A;  4NUR A;  3TL5 A;  3PRE A;  4A3T A;  2XZT G;  3MV2 B;  1E7V A;  5CER B;  3NOC D;  5AAO A;  2I1J A;  4UI9 J;  4JC8 A;  5T4Y A;  3TWS A;  5CRU A;  3ZIM A;  4G8K A;  5AEN A;  4ACK A;  3D9P A;  3D3M A;  3QAQ A;  1OCR E;  4EZK A;  2AXZ A;  4BFR A;  3E33 A;  2FF4 A;  2XEH A;  4TUU A;  3NQP A;  2E2E A;  3HXC A;  2WVI A;  4GAA A;  3AS8 A;  2IOL A;  3FUJ A;  4AJW A;  2P2C P;  4J7W A;  2DWZ A;  2WXG A;  2OCC E;  3BU8 A;  1N94 A;  2OND A;  3QWV A;  3CSF A;  4U04 A;  5FIO A;  1PC2 A;  3G2S A;  4G26 A;  4TRQ A;  2WPV A;  3TJP A;  4FP7 A;  4EQF A;  4BT8 A;  5AQA A;  2VSY A;  1G3N B;  3Q49 B;  3Q7A A;  4WNF A;  4RG9 A;  4CYM D;  3UQ3 A;  4IRU A;  2H6H A;  4QFV A;  1JCR A;  3QWP A;  4OYS A;  1N4S A;  2LXL A;  4NIK A;  3CVN A;  5B1B E;  5FQ7 A;  4EZL A;  3ZXS A;  4OVU A;  3ABL E;  3PS6 A;  1YMP A;  4ZFH A;  4I1M A;  3APC A;  3DEP A;  2IEJ A;  4LEU A;  1D8D A;  3BUA A;  2I6H A;  4U96 D;  1HU3 A;  4HLE A;  2VQ2 A;  4Y6C A;  4B89 A;  3UIO C;  3ZGQ A;  1HG2 A;  4N5Q A;  4L7T A;  5KCM A;  5C2Y A;  1TJC A;  2WMN A;  3S2A A;  2F8Y A;  3TWW A;  1UOH A;  3CK7 A;  2V0P A;  5G04 C;  3TWU A;  3AU4 A;  3ASG A;  2L9B A;  3CHR A;  3FUK A;  2EQX A;  2Y3A A;  4U8H A;  2HO1 A;  4ANW A;  1MZC A;  4URK A;  2KCL A;  1Z3X A;  2XCC A;  2I2O A;  1AWC B;  5FQ4 A;  1H6P A;  4GTP A;  3FUN A;  2Y4T A;  3FTW A;  2XPZ A;  2OEV A;  3ABM E;  1NZN A;  3NZS A;  1N0Q A;  3ONK A;  4N5C A;  2C0L A;  4HNA D;  2E0I A;  3L6A A;  2CHX A;  2HR2 A;  2XPI A;  2X38 A;  1W3B A;  4GTQ A;  4K5A B;  3CHP A;  1O1T A;  4RLY A;  4UWG A;  5G04 J;  3MGB A;  3HXD A;  5EIL A;  4DX6 D;  3IHV A;  4FAD A;  3U64 A;  3UKU G;  3ZKJ A;  1H2V C;  4WNG A;  5HRY A;  3URZ A;  3APF A;  3OXL A;  1KZP A;  1MHQ A;  4HOR A;  4XX5 A;  4U63 A;  1MYO A;  1A17 A;  4PS8 A;  3UTM A;  3KEA A;  4HOU A;  5EYP F;  3SFX A;  5CEC B;  2VGY A;  3CHM A;  1X81 A;  1E96 B;  2NC9 A;  5KBA A;  4GZ3 A;  4JPS A;  4DI4 A;  3L82 A;  4F6R D;  3MV3 B;  3IXE A;  2WQ7 A;  2GRM A;  3DPD A;  2YQ8 A;  2IQC A;  4U0U A;  1WM5 A;  4B94 A;  3TWT A;  3B7B A;  4I9E A;  1HF8 A;  4CZ2 D;  2XGS A;  1E8X A;  3ZU7 B;  3CVP A;  5CRV A;  4J6I A;  2RFA A;  3HXF A;  3UI2 A;  3FUE A;  2LAI A;  3PZ3 A;  2YNQ A;  5T3R A;  2J49 A;  1OWN A;  2QYJ A;  3Q79 A;  3EU5 A;  1IHG A;  1HS6 A;  1WAO 1;  4IUL A;  4BER A;  3PZ2 A;  1QBQ A;  3ONL A;  1N11 A;  3V30 A;  4YVQ C;  4FA6 A;  4FJY A;  4GA1 A;  4C0M A;  5CBO A;  3C3R A;  5JHB A;  4BEP A;  3FHE A;  5BV0 A;  3JQ1 A;  2QYU A;  3P2B A;  3LEW A;  5LFA A;  3R7R A;  2WM9 A;  4C48 B;  4BSZ B;  3D9K A;  5FIN A;  3KD7 A;  2OVB A;  2IFU A;  1MJ0 A;  2JAB A;  4EBA A;  4BX9 A;  2YHE A;  1K8K G;  3DBS A;  5EN5 D;  3ZN3 A;  2J08 A;  4N3A A;  5EIB E;  1UN9 A;  2WXR A;  4FUL A;  4JA7 A;  3CGH A;  3ZYQ A;  5KJK A;  4B93 B;  1WY6 A;  4PS3 A;  4H7Y A;  4NRH B;  5CCL A;  3R9M A;  3R9A B;  3Q78 A;  4JA9 A;  3D9M A;  1NL4 A;  3IV0 A;  4LNB A;  3FTZ A;  1FT1 A;  5CHE E;  1OWL A;  2PZI A;  4BTA A;  3X2Q E;  5LOZ A;  1V55 E;  2R05 A;  3C3O A;  2MYO A;  4GZC A;  2LAH A;  4G11 A;  4OAV B;  4KVM A;  5CEA A;  1E90 A;  4PS7 A;  2IJG X;  2FO7 A;  4DK5 A;  1N52 A;  2DBA A;  3PNL B;  4M3O A;  4AP2 A;  3Q4A B;  3BG0 B;  1BD8 A;  4CEM A;  5D0Q D;  4A1S A;  5DBK A;  4GTM A;  4CGW A;  5EID A;  4MRU A;  4FLB A;  1LD8 A;  2FEZ A;  3JUI A;  1BLX B;  4KBQ A;  3UX4 A;  3HHM A;  3C5R A;  1TYQ G;  1NP7 A;  2GW1 A;  3ZFW A;  1OT8 A;  3GZ2 A;  3ML9 A;  3UM1 A;  4J8E A;  2WXQ A;  2WXK A;  2C2L A;  3GZS A;  3WXX A;  4JHK A;  3QB2 A;  3CKC A;  3ENE A;  3CEQ A;  1ELR A;  1N4Q A;  2XCB A;  5AQB A;  3EUV A;  4HLL A;  3AG3 E;  4CGV A;  2AWI A;  1A5E A;  4ATZ D;  2WMO A;  3HVE B;  1E8Z A;  4YDE A;  5AJD A;  3ZUV B;  4LRZ A;  4IN3 B;  2HE0 A;  4W9R A;  3FTU A;  2X6F A;  3G2U A;  3NZU A;  4IYP A;  3PZD A;  4DI3 A;  3FEX A;  1TN7 A;  3MA5 A;  4N39 A;  4ME2 A;  3LVQ E;  1UJJ A;  3MZL B;  3FWV A;  3QOU A;  2CFZ A;  4F1P A;  3L08 A;  5JHA A;  3LPZ A;  2F0Y A;  3QDN A;  4UI9 C;  3TWQ A;  2OOE A;  3MJW A;  2AJA A;  5FZQ A;  2OVF A;  1BI8 B;  1TNY A;  3LVR E;  3D9O A;  3L13 A;  1N95 A;  1YCS B;  4F53 A;  3MCX A;  5HI7 A;  4O6F A;  4WNE A;  4RG6 A;  4UQX A;  4AOF A;  4RSY A;  3DRA A;  5ARG A;  4UWK A;  2FUL A;  3FEY A;  3FUD A;  4GB9 A;  4XIF A;  4UWH A;  2DYR E;  5KJL A;  1HX8 A;  5LCW J;  4AIF A;  4AY5 A;  4J8F A;  2PL2 A;  2DIW A;  2WXN A;  4GTS A;  2PM7 A;  3ULE G;  2IO2 C;  1S64 A;  4GMJ A;  2Q7F A;  1HFA A;  3EDT B;  1ZU2 A;  3SY2 A;  3AU5 A;  2VGX A;  4LNU D;  2IO3 C;  3RJV A;  2LNI A;  1EF1 C;  3AS4 A;  3AS5 A;  3ZRH A;  4H7X A;  3DSS A;  4ABN A;  3TWV A;  4DUI A;  3UM0 A;  2XRZ A;  1PAQ A;  3FU6 A;  1K3Z D;  2J8S D;  4KZ0 A;  5JMN D;  3OAW A;  4BSX A;  2XEN A;  3UT4 A;  2ETB A;  3HYM B;  1O1S A;  2A4Z A;  3QWW A;  4J8D A;  2V8S E;  4MS6 A;  4E85 A;  1KZO A;  3AJI A;  2A5E A;  5M72 A;  3FH5 A;  5ENN A;  1TJF A;  3ZHE B;  3CVX A;  1TN6 A;  3V79 K;  3ULQ A;  4BES A;  4XZ4 A;  3HVE A;  2PQR A;  3E37 A;  4QQI A;  5BXO A;  3CVL A;  4LNG A;  3DSX A;  4ILG A;  2JEK A;  1KLX A;  3B7T A;  2MRI A;  2VTB B;  4TXP A;  4J0U A;  4WWN A;  4GA0 A;  4L9P A;  4Z68 A;  2VYI A;  4D10 C;  3ULY A;  5DIZ A;  1N0R A;  4KVO A;  3JXI A;  1N4R A;  4O1O A;  3ESL A;  2AVP A;  3FU0 A;  3BEE A;  1D9S A;  5KWD A;  3OXG A;  5BPP A;  3S7J A;  4ANX A;  3JCK C;  2KC7 A;  2V4H C;  3B95 A;  3ASO E;  3PZ4 A;  1NA3 A;  2I1K A;  3I4R B;  2J09 A;  3R7Q A;  3DPY A;  5AN8 A;  4Q94 A;  4JXT A;  1U2V G;  3U3W A;  3UMV A;  4CCA A;  3ZVV A;  4MLP A;  3PZ1 A;  4AEZ C;  4HOS A;  4PH4 B;  2QC9 A;  5FZS A;  4TUM A;  3TG4 A;  1O1R A;  4HXI A;  1WDY A;  4TV3 A;  3FTX A;  4CDN A;  3UKR G;  2WXF A;  1Q2Z A;  4UWL A;  2GRL A;  4HRM B;  5EKQ D;  4KXK B;  3V31 A;  2GRP B;  3ESK A;  2J9Q A;  3FUL A;  4I2W A;  3CHS A;  2EIL E;  5ENS D;  2GGF A;  3RO2 A;  5AQ9 A;  2L6J A;  2P9I G;  2LUH A;  3NF1 A;  1JWG A;  2KCK A;  2M63 A;  3KSQ A;  3ZPJ A;  5AAR A;  2KZT B;  2P58 C;  3FDH A;  2WXM A;  4AV7 A;  1DCE A;  1JWF A;  3VTY A;  2KCV A;  3TGO A;  3RRU A;  3EHR A;  2NXP A;  3RAU A;  1OY3 D;  2P9S G;  4R7L A;  3ZHE A;  2EIK E;  4C0E A;  1JCQ A;  4UUC A;  2XZD G;  1H6K A;  4ZHB A;  3LJN A;  4YDO A;  1NFI E;  3APD A;  5JJ6 A;  1S63 A;  5BUZ A;  4I1O B;  4BWR A;  3FTS A;  3RRM B;  1IXV A;  3UT8 A;  5ENO D;  5IY5 E;  1GW6 A;  2L6B A;  2UY1 B;  1OWM A;  1HH8 A;  2XEE A;  4JB8 P;  3U4T A;  3ZYL A;  3MKQ B;  5J08 A;  4BTB A;  1OCO E;  1K1A A;  2DZN A;  4AM9 A;  3IEG A;  3EJN A;  4CDM A;  4HVB A;  3Q47 B;  3FUI A;  4OVV A;  3FH7 A;  2XS1 A;  1NI1 A;  3FTV A;  4HOT A;  4G23 A;  4APF A;  5ANL A;  2WXI A;  4BX8 A;  3T5V A;  2X6K A;  3MEK A;  3UIN C;  5ITZ F;  2KM4 A;  2GRO B;  3DSV A;  2XEV A;  4U0Z A;  1MX2 A;  3Q15 A;  3CHO A;  1TNZ A;  3HXE A;  4KMO A;  1OXJ A;  3EHM A;  3D9I A;  2YHC A;  1U3D A;  1OCZ E;  3EHN A;  4K0R A;  2B6C A;  5BV1 A;  3S7F A;  5BW8 C;  1MQS A;  1FT2 A;  5G2N A;  3N71 A;  5HS0 A;  3TXN A;  4AY6 A;  4U8V D;  4JL0 A;  3T5X A;  4RVB A;  4DX5 D;  5AYW D;  5AQ7 A;  1FCH A;  3NB2 A;  5CED B;  4Q69 A;  4HI8 A;  2NSZ A;  4JVS A;  1U3C A;  3VLD A;  3MKR A;  3PDN A;  1RZ4 A;  3P1U A;  4WAF A;  4WND A;  4B8C B;  2X3M A;  4JEH A;  1N4P A;  1S0P A;  2DCP A;  2KZT A;  5G05 C;  3IBE A;  1EDU A;  3JUE A;  3B7R L;  1SA5 A;  2PQN A;  3LY8 A;  2ZU6 B;  1SVX A;  3V2X A;  1BPO A;  3O48 A;  5FQ8 A;  3Q7F A;  4F1S A;  2RFM A;  2J07 A;  4YVO A;  1SZ9 A;  3SF4 A;  4N3C A;  4LG6 A;  4GZ5 A;  3DEO A;  3D9J A;  3WG7 E;  3BQO A;  3L9T A;  1DCQ A;  4DRX E;  4F7A A;  5J90 A;  3G2T A;  3SGH A;  3SBS A;  3JYS A;  3SI5 A;  2H6F A;  3QAR A;  4B0Z A;  2OEW A;  2UY1 A;  4A3V A;  3DSU A;  4GTT A;  5G05 J;  1O5M A;  2WXH A;  4J8S A;  4DX2 A;  3RSE G;  1E8Y A;  3MKQ A;  2WXO A;  3CV0 A;  1FVH A;  1INZ A;  2BED A;  3ZNG A;  3O4Z A;  3S7B A;  4GCO A;  2P9K G;  3FU5 A;  3SZ7 A;  1UW4 B;  1ELK A;  2WXP A;  3KSL A;  3SBT B;  3C72 A;  1EPU A;  4JHR A;  4GCN A;  4I6G A;  4KT6 B;  3J5P A;  1OWP A;  5B3S E;  4Y6W A;  4ANU A;  3UT7 A;  3CIA A;  2VSN A;  3HIZ A;  4EPZ A;  1L5J A;  2I9C A;  1SQM A;  1DC2 A;  1SA4 A;  4HRN A;  3ABK E;  1K1B A;  1QQE A;  5B1A E;  2CHW A;  3TXM A;  2P9L G;  1IKN D;  2BTD A;  3LXU X;  4P29 A;  3UUX A;  2R02 A;  3Q9U C;  2KAT A;  3CVW A;  1JCS A;  3AAA C;  2LXM A;  4G24 A;  5LCW C;  3OTN A;  2BKK B;  3ZYM A;  3FUF A;  3L17 A;  4FU3 A;  1XGW A;  5JJ7 A;  1JUQ A;  2CG2 A;  3I4G A;  1H0A A;  2ZGD A;  5EYL A;  2P9N G;  3DXM G;  4GA2 A;  3CVY A;  4KZC A;  4ACL A;  4GPM A;  3CVU A;  3E4B A;  3LJ3 A;  2UWJ G;  5ENR D;  2Y0B G;  4YDY A;  2XGM A;  1IQR A;  4APO A;  4DJA A;  2ZGG A;  4V3I A;  1H2T C;  1MX4 A;  1V54 E;  4O60 A;  4KYO B;  4RQI A;  3PE4 A;  3LY7 A;  4GTR A;  2B0O E;  1TNO A;  3PUK A;  4JD2 G;  1LTX A;  1QZ2 A;  4FC8 A;  2OV8 A;  1RW2 A;  4U95 D;  4LUN U;  4U07 A;  3BG1 B;  1E8W A;  3QJZ A;  2XHE A;  1N54 A;  1YYH A;  3LKU A;  4EEC A;  3RK6 A;  5H7P A;  2RKK A;  3QK0 A;  5T8I A;  5C1D A;  5A23 A;  1X5B A;  2LSU A;  2VSX E;  4UQZ A;  4PUC A;  3SQV A;  2F8X K;  1TN8 A;  4G25 A;  3JXJ A;  4ILH B;  4LCT A;  1BU9 A;  2Y69 E;  1SW6 A;  4MBG A;  2BKG A;  5BNW A;  3QC1 A;  3VLF A;  4HS2 A;  3D9H A;  1ZBP A;  2ZIS A;  4HQD A;  2JLB A;  2PNN A;  2V5F A;  3HXB A;  5EDS A;  3LDZ A;  4I1A A;  2X6H A;  3T8M A;  4HOQ A;  1QYM A;  4XI0 A;  2ZIR A;  1TEZ A;  4AVX A;  2J4D A;  1B89 A;  3Q9N C;  3DSW A;  2AW6 A;  2CG3 A;  3FUM A;  2R5S A;  4TXQ A;  1HZ4 A;  3ZW3 A;  1XNF A;  4N2S A;  2WQH A;  4N3B A; 
#chains in the Genus database with same CATH homology
 2GRN B;  2GRR B;  2IY0 C;  1Z5S C;  3UIN C;  2IO2 C;  2GRQ B;  2GRP B;  5D2M C;  1KPS B;  3UIP C;  2GRO B;  2IO3 C;  3UIO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...