2GRRB

Crystal structure of human rangap1-ubc9-d127s
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
157
structure length
157
Chain Sequence
PADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 I
publication title Lysine activation and functional analysis of E2-mediated conjugation in the SUMO pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 57
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2grrB00
2IO2C 2GROB 5D2MC 1Z5SC 3UIOC 2GRRB 3UINC 2IY0C 2GRPB 3UIPC 2GRQB 1KPSB 2IO3C 2GRNB
chains in the Genus database with same CATH superfamily
1VDYA 2E2EA 1K3ZD 1A17A 3JQ0A 2WXJA 3PZ2A 4N3BA 3SZ7A 1HS6A 2ONDA 1MJ0A 3RO3A 3NOGD 4DI4A 3PUKA 3J5QB 3D9PA 5LP0A 2VQ2A 1V55E 1U3CA 5AIJA 1S63A 2Y3AA 4O60A 3CVPA 4APFA 2X6HA 4LEUA 2KXPC 3URZA 1IQRA 3FUMA 4L23A 2X38A 1HG5A 3R7QA 4N2QA 3APCA 1PY1A 2DIWA 2J49A 5CERB 3ULQA 1JCSA 5EYLA 4JZYA 2AXZA 4MBGA 3QOUA 2C0MA 5ITZF 5AJDA 3E32A 5G04C 5EIDA 4JHKA 2P9SG 3UIPC 3D9HA 3UQ3A 4UWGA 3BU8A 3VLEA 4KT6B 2L6JA 1N0RA 4ILGA 2JEKA 4KBQA 3W9GA 2OCCE 3D9MA 3SY2A 2WVIA 1HH8A 3FTSA 1D8DA 2X6FA 2GGFA 4I1AA 2WXIA 4ANVA 5AARA 3CEQA 3Q9UC 3JUEA 3UXGA 1HZ4A 1GW6A 4WUYA 4I43A 5D0OD 4JXTA 1KZOA 2I9CA 2OEWA 2J9QA 2BUGA 3C98A 1OWOA 4NACA 3CKBA 1QYMA 2GRNB 2C2LA 1E8XA 5ENOD 2IJGX 2XENA 2RKKA 3G2SA 2CFZA 3B7BA 3EHRA 1N94A 4PH4B 2YQ8A 2KM4A 5ANRA 5LX8A 2NSZA 3TJPA 4F7AA 3GYZA 4GA1A 2AXUA 3V2OA 4O1OA 4J8DA 1JCRA 3UINC 4KYOB 2H6IA 4RSYA 4OAUC 2FBNA 5JHBA 3V30A 4LCTA 4U96D 4FC8A 4KMOA 3AJIA 3RO2A 3U66A 2L0IA 3HXCA 3FU5A 2XGMA 3GZ1A 5JJ6A 5H7PA 5CBOA 1QZ2A 4HXIA 2IO2C 2X6IA 1E8YA 5JMND 2VSXE 4BERA 5FIOA 3SD5A 1LTXA 3V31A 3QK0A 3UM2A 1HX8A 5HRYA 1B89A 3CHRA 4ILIA 4BX9A 3APDA 1OXJA 2FEZA 1MYOA 4LNBA 4G8LA 1HXIA 4HS2A 2J09A 4N2SA 3B7RL 4O6FA 3EDTB 3ML9A 2WXGA 4XI9A 5FJYA 2XQ0A 4NQ0A 1S70B 5CMYA 4AVXA 5FQ4A 4CCAA 4U7EB 2DVWA 3ASHA 4BSZB 4GTRA 5KCMA 3Q7AA 3T5XA 4UQXA 3CR3A 4IULA 2WXHA 4UWHA 3FTXA 2P9PG 3D9OA 3UM1A 3TXNA 2PZIA 5BXOA 3D9KA 4UQZA 2R59A 4UI9C 4DUIA 1KPSB 2I1KA 3DRAA 3DEPA 5A23A 2ZIRA 2HO1A 3ABME 2E0IA 3TWTA 3IKOB 4L7TA 4J8YA 3LVQE 3OXGA 5EKQD 1Z6TA 3TAXA 3CLJA 2ETAA 4JPSA 5BV1A 4HLLA 4LUNU 5EILA 4A1GA 2RFAA 4G26A 3LY9A 4GYWA 4I6JA 4JHJA 3TWUA 4GTTA 3EIJA 4NRHB 3C3RA 1ELKA 5FT9A 4RQIA 2VSNA 3FU3A 3SFZA 3RIBA 2WXMA 4R7LA 4B8CB 1LD7A 3PDNA 1FPPA 4UWKA 3FFLA 3TGOA 3R9AB 3SI5A 3ZGQA 4K03A 2MYOA 5J90A 1JUQA 4GZCA 4EQFA 4ANXA 1H19A 2J07A 1TJFA 2J08A 1E8ZA 3MKQA 3AS5A 5LOZA 3QWWA 1N9AA 1TN8A 2IONA 3BG1B 4QQIA 5FINA 4EECA 4UQYA 5CRVA 4C9BB 2XEEA 3PZ4A 3HVEA 1EF1C 2V4HC 2Y4TA 2ZXWE 1OWMA 3SHFA 3BUAA 4I2WA 3S7JA 4ANUA 2HM8A 2H6FA 2WM9A 1N4RA 3D9JA 4KVOA 4BSXA 5HS0A 3PZDA 1OCZE 4DX7D 3ZXSA 4HQDA 4WNFA 4EPZA 3MKRA 5BV0A 3PNLB 2XEHA 4XEIG 3CHPA 4YDYA 4EHMA 3TWVA 2XPYA 1OCCE 3X2QE 3ZYMA 4Y6CA 1V54E 5EYPF 4L1BA 2QFCA 4LRZA 1IHGA 4PUCA 4FU3A 1KT1A 3WXXA 2AJAA 1Q2ZA 1WY6A 2DZOA 4J8FA 3PS6A 1YMPA 5T8IA 3LDZA 5FZSA 5CECB 1ELWA 5CHEE 1LD8A 3LKUA 3L13A 1UJKA 3KS2A 1O1RA 3FTVA 4GYYA 2C0LA 3ABKE 3ZPJA 3DSVA 4ZHBA 4U63A 1N11A 3HDXA 4UWFA 3CVVA 2F8YA 2P2CP 5G05J 5CEAA 2WXRA 3CVUA 4GA2A 4GTMA 1TYQG 1QNFA 2KCKA 2NYJA 3ZXPA 4LSZE 3IHYA 3DXKG 2ZU6B 2L6BA 2Y4UA 3Q47B 1XNFA 4FJYA 4G8KA 4B8AA 2NC9A 1HU3A 3D9IA 1UW4B 5JHAA 5IY5E 2FO7A 4GTQA 4BT8A 5LCWC 4WWNA 3VTYA 4HLEA 1ZBPA 4G25A 4IYPA 3ZNGA 3Q5MA 2XHEA 3JCKC 2XZTG 3CHQA 4JEUA 4U8HA 4BETA 4HOTA 4K5BA 4CRWA 4HNAD 5JA4D 3UKRG 1BPOA 2AW6A 2VGXB 4TXPA 3ZHEB 4GMLA 4BFRA 4HI9A 4H7YA 1N4SA 4QFVA 3DSTA 5A6CA 4FP7A 1IKND 4MLPA 2XRYA 3EHNA 1NP7A 2AVPA 4G2VA 3I5PA 4URKA 2VSYA 2DYSE 2A5EA 4I6GA 3OXLA 3AG3E 4AY5A 3B13A 2Y1LE 3L22A 5BPPA 1EPUA 3HXEA 2WXKA 4WWOA 3FUFA 2CG3A 3MGBA 4HOQA 4W9RA 5ENRD 4LNGA 1MZCA 2V5QC 2I1JA 3UKUG 4XIFA 3ASNE 2KBXA 3TG5A 1N95A 4RVBA 2FULA 5CRUA 4P29A 3DXMG 2R02A 3WG7E 5AQAA 4CEMA 4CDMA 3T5VA 3ZFWA 1EYHA 5G04J 2LAIA 3EHQA 4JA7A 3T9KA 2WMOA 5D0QD 2LO6A 4HOUA 4BWRA 5KNHD 3RRUA 3UUXA 3HIZA 3DBSA 3B7TA 4M3OA 4C48B 2CFUA 3Q79A 2P9IG 3QJZA 1K8KG 2IEJA 3LYAA 3E4BA 3UTMA 3SF4A 1H2TC 2OV8A 2IOSA 2P9KG 2R05A 4ACKA 2F0YA 4TRQA 2R17C 1OWPA 4OVUA 4FHKA 4KVMA 2WXLA 3QB2A 4YDEA 4BX8A 4PS8A 3PVLA 3Q49B 1MX2A 4A55A 4JHRA 1HO8A 1TNYA 1K1AA 4TXQA 1JPLA 3C5RA 4BY6A 3R9MA 3MCXA 4DK5A 3JYSA 2RD0A 2IF4A 3T8KA 2GRRB 2LUHA 3AG2E 5B3SE 2VTBA 3GZ2A 4AIFA 2R5SA 4HI8A 4IN3B 2L9BA 2X6JA 4CDRA 4U04A 4U07A 1L5JA 1MQSA 3MA5A 4AXHA 5M72A 4RG9A 3SO8A 4EZJA 1O1SA 2Y69E 4N3CA 3HXBA 4GB9A 1N4PA 3FTYA 4J0UA 2YHEA 4B94A 3MV2B 2WMNA 5HQ8A 3ZIMA 3FTWA 3CIAA 3CVQA 3PEUB 1NI1A 4GTPA 2KCVA 3ZRHA 1TNBA 3DSWA 4G11A 5KJNA 3GW4A 4HORA 2CHWA 2HR2A 4L2LA 4PS3A 1TEZA 2YNQA 3S7DA 3FTUA 3PUJA 2ZISA 3PZ1A 3PRZA 4F3VA 4CGVA 4GMJA 5CCLA 3FDHA 2EIJE 3QAQA 1Y6IA 3TG4A 3ZYLA 3JUIA 5KBAA 3AG4E 4IRUA 2VSOE 4YVQC 5KJKA 1H6PA 3J5PA 3C3OA 4I1OB 2LNIA 3RK6A 1QQEA 1H0AA 2OVFA 4N3AA 1IQUA 2R2LA 4LG6A 1OUVA 1OWLA 2FI7A 1UG3A 2JLBA 1N54A 3IBEA 2A4ZA 1E7VA 1RW2A 3AG1E 4YVOA 3ENEA 4FLHA 3PE3A 3CHSA 3CGHA 4NURA 3AS4A 4EZKA 1DVPA 2DYRE 1TNZA 1NL4A 3CVLA 3FEYA 1U3DA 5FZRA 4JL0A 2FF4A 5BT1A 1ZU2A 2NXPA 5FZQA 4L9PA 5FWQA 4DLOA 3OXFA 1BI7B 4YDOA 5CBNA 3FUNA 4CT4A 3SBTB 4JC8A 1LF8A 4F1SA 3UPVA 4WWPA 3EU9A 4HBDA 3QWPA 3NBNB 3CSTA 3QKYA 4DPRA 3ZEFA 3I3NA 3RRMB 4MKTA 3B7SA 1G3NB 1Z3YA 2EIKE 1BU9A 4D10C 5AN8A 3TL5A 1DNPA 4HRLA 4GPMA 3G2VA 2OOEA 4ILHB 2QYJA 4EZLA 3B7UX 4U8VD 1RZ4A 5FTPA 5ENPD 4N39A 5AAOA 3FUHA 4FHJA 2IU1A 3NZSA 3QDNA 4GZ5A 1DCEA 1UOHA 3IHVA 4XZ4A 3ZYQA 4J8EA 3D9NA 1OCOE 3D9LA 5ENNA 3ASOE 4ZFHA 5E75A 1JWFA 4AM9A 2ETCA 3HVEB 3Q4AB 3E33A 4GZ3A 3R7RA 1N4QA 1X81A 2WXOA 2WXPA 1DCQA 3KSLA 5FQ8A 2F8XK 3PREA 4GA0A 3KSQA 3N71A 2WQ7A 3HXFA 3IXEA 3NOCD 2XGSA 3LXUX 2YHCA 2GROB 1OWNA 4WNDA 4GTSA 3CQCB 4DI3A 2Q7FA 3NF1A 2ETBA 4K0RA 5CMWA 3PE4A 3BG0B 3TXMA 2IO3C 2UY1B 4A3VA 2LSUA 2BKKB 2GRPB 3ML8A 3EUVA 2P58C 2WPVA 4U0SA 4JEHA 4BT9A 4Q94A 5DBKA 2LSVA 4FJZA 3AU5A 3KAEA 4FADA 2DCPA 2XCCA 5AQBA 5LCWJ 4GU5A 5D2MC 3TWQA 1HG2A 3LCAA 3KEAA 3ZVVA 5AENA 4G23A 3U9WA 3QWVA 3SFXA 1Z3XA 4FLBA 1SQMA 5C1DA 1MHQA 3G2UA 3UM0A 2WQHA 2IFUA 1U2VG 3O48A 1KZPA 3HXDA 3S7FA 4DX2A 2BF0X 4EBAA 4I9EA 3FH7A 3G2WA 4K5AB 4DJAA 4ABNA 2X3MA 3TWSA 3PZ3A 3CK7A 3ZYKA 2KZTA 4HRMB 3RJVA 3E34A 4OAVB 1IHBA 2Y0BG 1SVXA 3RU0A 2FO1E 1ELRA 3EIQC 4F1PA 1FVFA 4K5CA 4E6HA 3LJNA 2JABA 2V4LA 3ULEG 3ZHEA 4FA6A 3ESLA 3UMVA 3K9IA 2V5FA 2QZAA 2L0TB 3FUKA 3L17A 5AJLA 2I6HA 5HKPA 3GZSA 4DX6D 1INZA 3TWWA 3RAUA 1BI8B 1NA3A 1OCRE 3CQGB 3DSUA 3DSSA 3FUJA 5T4YA 5EDSA 1YYHA 3AS8A 4G1TA 3TWRA 3FP3A 2GRLA 4AV7A 3LPZA 3W9FA 4X8QA 4CZ2D 2IQCA 1W3BA 1E90A 3Q73A 4B89A 2XS8A 1E7UA 2EQXA 5EN5D 2A5UA 2PQNA 4JW1A 3EU5A 4O1PA 5JJTA 4ATZD 2P9UG 5FQ7A 2VGYA 4UUCA 3L6AA 3RKVA 3LJ3A 1H6KA 3IV0A 3UM3A 4RG6A 3FUDA 1FCHA 3Q78A 2QYUA 1TNOA 5AQ7A 4GYOA 4HB5A 3CKCA 3ZU7B 1SW6A 3FU6A 3Q7FA 4U8YD 1YA0A 2XPZA 1H2VC 3L82A 2P9NG 4I9CA 5CCMA 2OVBA 2WXNA 5A7DB 3CVXA 3RSEG 1HE8A 1E96B 2GRMA 3ZN3A 1FT2A 2DZNA 1TJCA 2XEVA 1N52A 3UIOC 3IEGA 2PM6A 3FY4A 5D66A 4HFGA 3ZUVB 5BXUA 3CHOA 2VYIA 4ANWA 1BD8A 1QBQA 3U4TA 3DEOA 3PH0C 3Q9NC 1SA5A 4A1SA 1UN8A 2XCBA 1FT1A 4KXKB 3JQ1A 2VTBB 1IXVA 4GZ6A 4L2YA 1SA4A 4J7WA 3BQOA 4I1MA 5EIBE 3AU4A 3L16A 2HE0A 4I6EA 3FEXA 2GW1A 4ATGA 3EJNA 3S7BA 1MX4A 4WNGA 4JA9A 3LY8A 4C0MA 3QNKA 5E76A 4I17A 1WDYA 2VJ8A 4M7CA 3DSXA 3P1UA 1SZAA 4MS6A 2P9LG 3B95A 3MZLB 4MRUA 2ZGGA 3FUEA 4XKCA 5B1BE 2J4DA 4BEPA 2XS1A 4APOA 2ILRA 2OEVA 5AQ9A 5G2NA 4NIKA 4TXRA 3LVRE 1H6OA 3MX3A 4XKBA 5JJ7A 1WM5A 4TUMA 3ASDA 4DRXE 4KZCA 2PQRA 5C2YA 3CHMA 3FULA 3FHEA 4HVBA 3TWXA 3CK8A 3AAAC 4J6IA 4Q69A 1MX6A 4UI9K 1TNUA 1TR4A 3APFA 3CVWA 3T8MA 2WB2A 4C0EA 4B93B 3MYVA 3OAWA 4EBAG 3ONLA 4I2ZA 4DLQA 1EDUA 3ONKA 2EINE 1UJJA 1YCSB 3FWVA 4UI9J 1D8EA 3LEWA 4BTAA 1HFAA 4JD2G 1ZB1A 3NB2A 3QC1A 4Z68A 2WQ6A 2PL2A 2IY0C 2RG8A 3ESKA 3NAWA 4WNEA 2IOLA 2CHZA 4ACLA 4GAAA 1N0QA 4LERA 3KEZA 3KD7A 2H6GA 3MV3B 4DX1A 4GTOA 3S2AA 4F53A 1PC2A 1NA0A 2MHKA 3V79K 2EILE 1K1BA 3MEKA 3ZW3A 2LAHA 2B6CA 2AXVA 2VGEA 3C72A 1SZ9A 3SBSA 4UWLA 4Y6WA 4HRNA 3I4GA 4A63B 5EX0A 3JXIA 4OVVA 5KWDA 1KT0A 2R03A 2H6HA 3JXJA 4HOSA 2XRZA 1PAQA 3FH8A 2HYZA 5ARGA 3G2TA 1X5BA 2QY7A 2I2OA 4GZDA 3MKQB 3CVNA 1TN6A 2WXQA 4BESA 2RFMA 3LS8A 3FTZA 5DIZA 5B1AE 5ENSD 4Q96A 3E37A 3CVYA 3ISMC 4XX5A 3SGHA 1OT8A 5AYWD 1S64A 4CGWA 4GCNA 4JVSA 3FH5A 4TUUA 3L54A 3RRNB 1OY3D 2V8SE 3UI2A 3P2BA 2BKGA 3Q75A 3SNXA 4PDXA 3DPDA 4CT0A 1D9SA 3NZUA 3V2XA 2M63A 5T3RA 3ABLE 3L08A 2J8SD 1WG0A 2DBAA 5ARFA 4V3IA 2KC7A 5LFAA 1P5QA 3ULYA 2CG2A 5KJMA 3CV0A 1IYGA 4PS7A 4XI0A 4CYMD 2J4BA 4JB8P 1H2UA 2MRIA 3DWLG 4F6RD 1A5EA 2DWZA 3SFYA 3HHMA 4J8SA 3SQVA 5ENQD 3F6QA 5J08A 1KLXA 5ENTD 4AP2A 2XGOA 4AY6A 5ANLA 3U3WA 3BEEA 2X6KA 3HG0D 4G24A 2WXFA 4XE0A 3OTNA 1XGWA 2UY1A 4GPKA 5FQ6A 2B0OE 3Q15A 1Y8MA 4ME2A 5G55A 2KATA 5EX3A 3ASGA 3I4RB 1UN9A 2V0PA 3QARA 4TV3A 2BEDA 2XPIA 2AWIA 3L9TA 4H7XA 2QC9A 4GMRA 3CK9A 3NQPA 2ZGDA 3PEVB 4AOFA 4KZ0A 1NFIE 3D3MA 4LNUD 3VLDA 1AP7A 4E85A 5KJLA 3FUIA 4FULA 4RLYA 1FVHA 5BUZA 2UWJG 4YNDA 4AEZC 1WAO1 4B0ZA 1S0PA 4CDNA 2F37A 4U95D 4AJWA 4OYSA 4N5QA 3FU0A 3VLFA 2BTDA 4WAFA 5CEDB 1E8WA 1NZNA 1JWGA 2LXLA 3ZKJA 5G05C 3EHMA 4YDWA 2KZTB 3VTXA 5HI7A 3UX4A 3UT4A 2PM7A 3LY7A 2YINA 4N5CA 3O4ZA 2KCLA 1O5MA 2GRQB 3DPYA 1HF8A 3CSFA 3MJWA 4U0UA 3ASFA 3PNTB 4U0ZA 2MOWA 1BLXB 2VGXA 2CHXA 2XZDG 4GTVA 1O1TA 4GCOA 3U64A 3HRAA 5BW8C 4DX5D 3C3QA 5BNWA 1JCQA 4BTBA 3E30A 5KNGA 3UT8A 3HYMB 1DC2A 2LXMA 1Z5SC 2PNNA 1TN7A 4A3TA 3UT7A 1AWCB 2EIME
chains in the Genus database with same CATH topology
2IO2C 2GROB 5D2MC 1Z5SC 3UIOC 2GRRB 3UINC 2IY0C 2GRPB 3UIPC 2GRQB 1KPSB 2IO3C 2GRNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO2 C;  2GRO B;  5D2M C;  1Z5S C;  3UIO C;  2GRR B;  3UIN C;  2IY0 C;  2GRP B;  3UIP C;  2GRQ B;  1KPS B;  2IO3 C;  2GRN B; 
#chains in the Genus database with same CATH topology
 1VDY A;  2E2E A;  1K3Z D;  1A17 A;  3JQ0 A;  2WXJ A;  3PZ2 A;  4N3B A;  3SZ7 A;  1HS6 A;  2OND A;  1MJ0 A;  3RO3 A;  3NOG D;  4DI4 A;  3PUK A;  3J5Q B;  3D9P A;  5LP0 A;  2VQ2 A;  1V55 E;  1U3C A;  5AIJ A;  1S63 A;  2Y3A A;  4O60 A;  3CVP A;  4APF A;  2X6H A;  4LEU A;  2KXP C;  3URZ A;  1IQR A;  3FUM A;  4L23 A;  2X38 A;  1HG5 A;  3R7Q A;  4N2Q A;  3APC A;  1PY1 A;  2DIW A;  2J49 A;  5CER B;  3ULQ A;  1JCS A;  5EYL A;  4JZY A;  2AXZ A;  4MBG A;  3QOU A;  2C0M A;  5ITZ F;  5AJD A;  3E32 A;  5G04 C;  5EID A;  4JHK A;  2P9S G;  3UIP C;  3D9H A;  3UQ3 A;  4UWG A;  3BU8 A;  3VLE A;  4KT6 B;  2L6J A;  1N0R A;  4ILG A;  2JEK A;  4KBQ A;  3W9G A;  2OCC E;  3D9M A;  3SY2 A;  2WVI A;  1HH8 A;  3FTS A;  1D8D A;  2X6F A;  2GGF A;  4I1A A;  2WXI A;  4ANV A;  5AAR A;  3CEQ A;  3Q9U C;  3JUE A;  3UXG A;  1HZ4 A;  1GW6 A;  4WUY A;  4I43 A;  5D0O D;  4JXT A;  1KZO A;  2I9C A;  2OEW A;  2J9Q A;  2BUG A;  3C98 A;  1OWO A;  4NAC A;  3CKB A;  1QYM A;  2GRN B;  2C2L A;  1E8X A;  5ENO D;  2IJG X;  2XEN A;  2RKK A;  3G2S A;  2CFZ A;  3B7B A;  3EHR A;  1N94 A;  4PH4 B;  2YQ8 A;  2KM4 A;  5ANR A;  5LX8 A;  2NSZ A;  3TJP A;  4F7A A;  3GYZ A;  4GA1 A;  2AXU A;  3V2O A;  4O1O A;  4J8D A;  1JCR A;  3UIN C;  4KYO B;  2H6I A;  4RSY A;  4OAU C;  2FBN A;  5JHB A;  3V30 A;  4LCT A;  4U96 D;  4FC8 A;  4KMO A;  3AJI A;  3RO2 A;  3U66 A;  2L0I A;  3HXC A;  3FU5 A;  2XGM A;  3GZ1 A;  5JJ6 A;  5H7P A;  5CBO A;  1QZ2 A;  4HXI A;  2IO2 C;  2X6I A;  1E8Y A;  5JMN D;  2VSX E;  4BER A;  5FIO A;  3SD5 A;  1LTX A;  3V31 A;  3QK0 A;  3UM2 A;  1HX8 A;  5HRY A;  1B89 A;  3CHR A;  4ILI A;  4BX9 A;  3APD A;  1OXJ A;  2FEZ A;  1MYO A;  4LNB A;  4G8L A;  1HXI A;  4HS2 A;  2J09 A;  4N2S A;  3B7R L;  4O6F A;  3EDT B;  3ML9 A;  2WXG A;  4XI9 A;  5FJY A;  2XQ0 A;  4NQ0 A;  1S70 B;  5CMY A;  4AVX A;  5FQ4 A;  4CCA A;  4U7E B;  2DVW A;  3ASH A;  4BSZ B;  4GTR A;  5KCM A;  3Q7A A;  3T5X A;  4UQX A;  3CR3 A;  4IUL A;  2WXH A;  4UWH A;  3FTX A;  2P9P G;  3D9O A;  3UM1 A;  3TXN A;  2PZI A;  5BXO A;  3D9K A;  4UQZ A;  2R59 A;  4UI9 C;  4DUI A;  1KPS B;  2I1K A;  3DRA A;  3DEP A;  5A23 A;  2ZIR A;  2HO1 A;  3ABM E;  2E0I A;  3TWT A;  3IKO B;  4L7T A;  4J8Y A;  3LVQ E;  3OXG A;  5EKQ D;  1Z6T A;  3TAX A;  3CLJ A;  2ETA A;  4JPS A;  5BV1 A;  4HLL A;  4LUN U;  5EIL A;  4A1G A;  2RFA A;  4G26 A;  3LY9 A;  4GYW A;  4I6J A;  4JHJ A;  3TWU A;  4GTT A;  3EIJ A;  4NRH B;  3C3R A;  1ELK A;  5FT9 A;  4RQI A;  2VSN A;  3FU3 A;  3SFZ A;  3RIB A;  2WXM A;  4R7L A;  4B8C B;  1LD7 A;  3PDN A;  1FPP A;  4UWK A;  3FFL A;  3TGO A;  3R9A B;  3SI5 A;  3ZGQ A;  4K03 A;  2MYO A;  5J90 A;  1JUQ A;  4GZC A;  4EQF A;  4ANX A;  1H19 A;  2J07 A;  1TJF A;  2J08 A;  1E8Z A;  3MKQ A;  3AS5 A;  5LOZ A;  3QWW A;  1N9A A;  1TN8 A;  2ION A;  3BG1 B;  4QQI A;  5FIN A;  4EEC A;  4UQY A;  5CRV A;  4C9B B;  2XEE A;  3PZ4 A;  3HVE A;  1EF1 C;  2V4H C;  2Y4T A;  2ZXW E;  1OWM A;  3SHF A;  3BUA A;  4I2W A;  3S7J A;  4ANU A;  2HM8 A;  2H6F A;  2WM9 A;  1N4R A;  3D9J A;  4KVO A;  4BSX A;  5HS0 A;  3PZD A;  1OCZ E;  4DX7 D;  3ZXS A;  4HQD A;  4WNF A;  4EPZ A;  3MKR A;  5BV0 A;  3PNL B;  2XEH A;  4XEI G;  3CHP A;  4YDY A;  4EHM A;  3TWV A;  2XPY A;  1OCC E;  3X2Q E;  3ZYM A;  4Y6C A;  1V54 E;  5EYP F;  4L1B A;  2QFC A;  4LRZ A;  1IHG A;  4PUC A;  4FU3 A;  1KT1 A;  3WXX A;  2AJA A;  1Q2Z A;  1WY6 A;  2DZO A;  4J8F A;  3PS6 A;  1YMP A;  5T8I A;  3LDZ A;  5FZS A;  5CEC B;  1ELW A;  5CHE E;  1LD8 A;  3LKU A;  3L13 A;  1UJK A;  3KS2 A;  1O1R A;  3FTV A;  4GYY A;  2C0L A;  3ABK E;  3ZPJ A;  3DSV A;  4ZHB A;  4U63 A;  1N11 A;  3HDX A;  4UWF A;  3CVV A;  2F8Y A;  2P2C P;  5G05 J;  5CEA A;  2WXR A;  3CVU A;  4GA2 A;  4GTM A;  1TYQ G;  1QNF A;  2KCK A;  2NYJ A;  3ZXP A;  4LSZ E;  3IHY A;  3DXK G;  2ZU6 B;  2L6B A;  2Y4U A;  3Q47 B;  1XNF A;  4FJY A;  4G8K A;  4B8A A;  2NC9 A;  1HU3 A;  3D9I A;  1UW4 B;  5JHA A;  5IY5 E;  2FO7 A;  4GTQ A;  4BT8 A;  5LCW C;  4WWN A;  3VTY A;  4HLE A;  1ZBP A;  4G25 A;  4IYP A;  3ZNG A;  3Q5M A;  2XHE A;  3JCK C;  2XZT G;  3CHQ A;  4JEU A;  4U8H A;  4BET A;  4HOT A;  4K5B A;  4CRW A;  4HNA D;  5JA4 D;  3UKR G;  1BPO A;  2AW6 A;  2VGX B;  4TXP A;  3ZHE B;  4GML A;  4BFR A;  4HI9 A;  4H7Y A;  1N4S A;  4QFV A;  3DST A;  5A6C A;  4FP7 A;  1IKN D;  4MLP A;  2XRY A;  3EHN A;  1NP7 A;  2AVP A;  4G2V A;  3I5P A;  4URK A;  2VSY A;  2DYS E;  2A5E A;  4I6G A;  3OXL A;  3AG3 E;  4AY5 A;  3B13 A;  2Y1L E;  3L22 A;  5BPP A;  1EPU A;  3HXE A;  2WXK A;  4WWO A;  3FUF A;  2CG3 A;  3MGB A;  4HOQ A;  4W9R A;  5ENR D;  4LNG A;  1MZC A;  2V5Q C;  2I1J A;  3UKU G;  4XIF A;  3ASN E;  2KBX A;  3TG5 A;  1N95 A;  4RVB A;  2FUL A;  5CRU A;  4P29 A;  3DXM G;  2R02 A;  3WG7 E;  5AQA A;  4CEM A;  4CDM A;  3T5V A;  3ZFW A;  1EYH A;  5G04 J;  2LAI A;  3EHQ A;  4JA7 A;  3T9K A;  2WMO A;  5D0Q D;  2LO6 A;  4HOU A;  4BWR A;  5KNH D;  3RRU A;  3UUX A;  3HIZ A;  3DBS A;  3B7T A;  4M3O A;  4C48 B;  2CFU A;  3Q79 A;  2P9I G;  3QJZ A;  1K8K G;  2IEJ A;  3LYA A;  3E4B A;  3UTM A;  3SF4 A;  1H2T C;  2OV8 A;  2IOS A;  2P9K G;  2R05 A;  4ACK A;  2F0Y A;  4TRQ A;  2R17 C;  1OWP A;  4OVU A;  4FHK A;  4KVM A;  2WXL A;  3QB2 A;  4YDE A;  4BX8 A;  4PS8 A;  3PVL A;  3Q49 B;  1MX2 A;  4A55 A;  4JHR A;  1HO8 A;  1TNY A;  1K1A A;  4TXQ A;  1JPL A;  3C5R A;  4BY6 A;  3R9M A;  3MCX A;  4DK5 A;  3JYS A;  2RD0 A;  2IF4 A;  3T8K A;  2GRR B;  2LUH A;  3AG2 E;  5B3S E;  2VTB A;  3GZ2 A;  4AIF A;  2R5S A;  4HI8 A;  4IN3 B;  2L9B A;  2X6J A;  4CDR A;  4U04 A;  4U07 A;  1L5J A;  1MQS A;  3MA5 A;  4AXH A;  5M72 A;  4RG9 A;  3SO8 A;  4EZJ A;  1O1S A;  2Y69 E;  4N3C A;  3HXB A;  4GB9 A;  1N4P A;  3FTY A;  4J0U A;  2YHE A;  4B94 A;  3MV2 B;  2WMN A;  5HQ8 A;  3ZIM A;  3FTW A;  3CIA A;  3CVQ A;  3PEU B;  1NI1 A;  4GTP A;  2KCV A;  3ZRH A;  1TNB A;  3DSW A;  4G11 A;  5KJN A;  3GW4 A;  4HOR A;  2CHW A;  2HR2 A;  4L2L A;  4PS3 A;  1TEZ A;  2YNQ A;  3S7D A;  3FTU A;  3PUJ A;  2ZIS A;  3PZ1 A;  3PRZ A;  4F3V A;  4CGV A;  4GMJ A;  5CCL A;  3FDH A;  2EIJ E;  3QAQ A;  1Y6I A;  3TG4 A;  3ZYL A;  3JUI A;  5KBA A;  3AG4 E;  4IRU A;  2VSO E;  4YVQ C;  5KJK A;  1H6P A;  3J5P A;  3C3O A;  4I1O B;  2LNI A;  3RK6 A;  1QQE A;  1H0A A;  2OVF A;  4N3A A;  1IQU A;  2R2L A;  4LG6 A;  1OUV A;  1OWL A;  2FI7 A;  1UG3 A;  2JLB A;  1N54 A;  3IBE A;  2A4Z A;  1E7V A;  1RW2 A;  3AG1 E;  4YVO A;  3ENE A;  4FLH A;  3PE3 A;  3CHS A;  3CGH A;  4NUR A;  3AS4 A;  4EZK A;  1DVP A;  2DYR E;  1TNZ A;  1NL4 A;  3CVL A;  3FEY A;  1U3D A;  5FZR A;  4JL0 A;  2FF4 A;  5BT1 A;  1ZU2 A;  2NXP A;  5FZQ A;  4L9P A;  5FWQ A;  4DLO A;  3OXF A;  1BI7 B;  4YDO A;  5CBN A;  3FUN A;  4CT4 A;  3SBT B;  4JC8 A;  1LF8 A;  4F1S A;  3UPV A;  4WWP A;  3EU9 A;  4HBD A;  3QWP A;  3NBN B;  3CST A;  3QKY A;  4DPR A;  3ZEF A;  3I3N A;  3RRM B;  4MKT A;  3B7S A;  1G3N B;  1Z3Y A;  2EIK E;  1BU9 A;  4D10 C;  5AN8 A;  3TL5 A;  1DNP A;  4HRL A;  4GPM A;  3G2V A;  2OOE A;  4ILH B;  2QYJ A;  4EZL A;  3B7U X;  4U8V D;  1RZ4 A;  5FTP A;  5ENP D;  4N39 A;  5AAO A;  3FUH A;  4FHJ A;  2IU1 A;  3NZS A;  3QDN A;  4GZ5 A;  1DCE A;  1UOH A;  3IHV A;  4XZ4 A;  3ZYQ A;  4J8E A;  3D9N A;  1OCO E;  3D9L A;  5ENN A;  3ASO E;  4ZFH A;  5E75 A;  1JWF A;  4AM9 A;  2ETC A;  3HVE B;  3Q4A B;  3E33 A;  4GZ3 A;  3R7R A;  1N4Q A;  1X81 A;  2WXO A;  2WXP A;  1DCQ A;  3KSL A;  5FQ8 A;  2F8X K;  3PRE A;  4GA0 A;  3KSQ A;  3N71 A;  2WQ7 A;  3HXF A;  3IXE A;  3NOC D;  2XGS A;  3LXU X;  2YHC A;  2GRO B;  1OWN A;  4WND A;  4GTS A;  3CQC B;  4DI3 A;  2Q7F A;  3NF1 A;  2ETB A;  4K0R A;  5CMW A;  3PE4 A;  3BG0 B;  3TXM A;  2IO3 C;  2UY1 B;  4A3V A;  2LSU A;  2BKK B;  2GRP B;  3ML8 A;  3EUV A;  2P58 C;  2WPV A;  4U0S A;  4JEH A;  4BT9 A;  4Q94 A;  5DBK A;  2LSV A;  4FJZ A;  3AU5 A;  3KAE A;  4FAD A;  2DCP A;  2XCC A;  5AQB A;  5LCW J;  4GU5 A;  5D2M C;  3TWQ A;  1HG2 A;  3LCA A;  3KEA A;  3ZVV A;  5AEN A;  4G23 A;  3U9W A;  3QWV A;  3SFX A;  1Z3X A;  4FLB A;  1SQM A;  5C1D A;  1MHQ A;  3G2U A;  3UM0 A;  2WQH A;  2IFU A;  1U2V G;  3O48 A;  1KZP A;  3HXD A;  3S7F A;  4DX2 A;  2BF0 X;  4EBA A;  4I9E A;  3FH7 A;  3G2W A;  4K5A B;  4DJA A;  4ABN A;  2X3M A;  3TWS A;  3PZ3 A;  3CK7 A;  3ZYK A;  2KZT A;  4HRM B;  3RJV A;  3E34 A;  4OAV B;  1IHB A;  2Y0B G;  1SVX A;  3RU0 A;  2FO1 E;  1ELR A;  3EIQ C;  4F1P A;  1FVF A;  4K5C A;  4E6H A;  3LJN A;  2JAB A;  2V4L A;  3ULE G;  3ZHE A;  4FA6 A;  3ESL A;  3UMV A;  3K9I A;  2V5F A;  2QZA A;  2L0T B;  3FUK A;  3L17 A;  5AJL A;  2I6H A;  5HKP A;  3GZS A;  4DX6 D;  1INZ A;  3TWW A;  3RAU A;  1BI8 B;  1NA3 A;  1OCR E;  3CQG B;  3DSU A;  3DSS A;  3FUJ A;  5T4Y A;  5EDS A;  1YYH A;  3AS8 A;  4G1T A;  3TWR A;  3FP3 A;  2GRL A;  4AV7 A;  3LPZ A;  3W9F A;  4X8Q A;  4CZ2 D;  2IQC A;  1W3B A;  1E90 A;  3Q73 A;  4B89 A;  2XS8 A;  1E7U A;  2EQX A;  5EN5 D;  2A5U A;  2PQN A;  4JW1 A;  3EU5 A;  4O1P A;  5JJT A;  4ATZ D;  2P9U G;  5FQ7 A;  2VGY A;  4UUC A;  3L6A A;  3RKV A;  3LJ3 A;  1H6K A;  3IV0 A;  3UM3 A;  4RG6 A;  3FUD A;  1FCH A;  3Q78 A;  2QYU A;  1TNO A;  5AQ7 A;  4GYO A;  4HB5 A;  3CKC A;  3ZU7 B;  1SW6 A;  3FU6 A;  3Q7F A;  4U8Y D;  1YA0 A;  2XPZ A;  1H2V C;  3L82 A;  2P9N G;  4I9C A;  5CCM A;  2OVB A;  2WXN A;  5A7D B;  3CVX A;  3RSE G;  1HE8 A;  1E96 B;  2GRM A;  3ZN3 A;  1FT2 A;  2DZN A;  1TJC A;  2XEV A;  1N52 A;  3UIO C;  3IEG A;  2PM6 A;  3FY4 A;  5D66 A;  4HFG A;  3ZUV B;  5BXU A;  3CHO A;  2VYI A;  4ANW A;  1BD8 A;  1QBQ A;  3U4T A;  3DEO A;  3PH0 C;  3Q9N C;  1SA5 A;  4A1S A;  1UN8 A;  2XCB A;  1FT1 A;  4KXK B;  3JQ1 A;  2VTB B;  1IXV A;  4GZ6 A;  4L2Y A;  1SA4 A;  4J7W A;  3BQO A;  4I1M A;  5EIB E;  3AU4 A;  3L16 A;  2HE0 A;  4I6E A;  3FEX A;  2GW1 A;  4ATG A;  3EJN A;  3S7B A;  1MX4 A;  4WNG A;  4JA9 A;  3LY8 A;  4C0M A;  3QNK A;  5E76 A;  4I17 A;  1WDY A;  2VJ8 A;  4M7C A;  3DSX A;  3P1U A;  1SZA A;  4MS6 A;  2P9L G;  3B95 A;  3MZL B;  4MRU A;  2ZGG A;  3FUE A;  4XKC A;  5B1B E;  2J4D A;  4BEP A;  2XS1 A;  4APO A;  2ILR A;  2OEV A;  5AQ9 A;  5G2N A;  4NIK A;  4TXR A;  3LVR E;  1H6O A;  3MX3 A;  4XKB A;  5JJ7 A;  1WM5 A;  4TUM A;  3ASD A;  4DRX E;  4KZC A;  2PQR A;  5C2Y A;  3CHM A;  3FUL A;  3FHE A;  4HVB A;  3TWX A;  3CK8 A;  3AAA C;  4J6I A;  4Q69 A;  1MX6 A;  4UI9 K;  1TNU A;  1TR4 A;  3APF A;  3CVW A;  3T8M A;  2WB2 A;  4C0E A;  4B93 B;  3MYV A;  3OAW A;  4EBA G;  3ONL A;  4I2Z A;  4DLQ A;  1EDU A;  3ONK A;  2EIN E;  1UJJ A;  1YCS B;  3FWV A;  4UI9 J;  1D8E A;  3LEW A;  4BTA A;  1HFA A;  4JD2 G;  1ZB1 A;  3NB2 A;  3QC1 A;  4Z68 A;  2WQ6 A;  2PL2 A;  2IY0 C;  2RG8 A;  3ESK A;  3NAW A;  4WNE A;  2IOL A;  2CHZ A;  4ACL A;  4GAA A;  1N0Q A;  4LER A;  3KEZ A;  3KD7 A;  2H6G A;  3MV3 B;  4DX1 A;  4GTO A;  3S2A A;  4F53 A;  1PC2 A;  1NA0 A;  2MHK A;  3V79 K;  2EIL E;  1K1B A;  3MEK A;  3ZW3 A;  2LAH A;  2B6C A;  2AXV A;  2VGE A;  3C72 A;  1SZ9 A;  3SBS A;  4UWL A;  4Y6W A;  4HRN A;  3I4G A;  4A63 B;  5EX0 A;  3JXI A;  4OVV A;  5KWD A;  1KT0 A;  2R03 A;  2H6H A;  3JXJ A;  4HOS A;  2XRZ A;  1PAQ A;  3FH8 A;  2HYZ A;  5ARG A;  3G2T A;  1X5B A;  2QY7 A;  2I2O A;  4GZD A;  3MKQ B;  3CVN A;  1TN6 A;  2WXQ A;  4BES A;  2RFM A;  3LS8 A;  3FTZ A;  5DIZ A;  5B1A E;  5ENS D;  4Q96 A;  3E37 A;  3CVY A;  3ISM C;  4XX5 A;  3SGH A;  1OT8 A;  5AYW D;  1S64 A;  4CGW A;  4GCN A;  4JVS A;  3FH5 A;  4TUU A;  3L54 A;  3RRN B;  1OY3 D;  2V8S E;  3UI2 A;  3P2B A;  2BKG A;  3Q75 A;  3SNX A;  4PDX A;  3DPD A;  4CT0 A;  1D9S A;  3NZU A;  3V2X A;  2M63 A;  5T3R A;  3ABL E;  3L08 A;  2J8S D;  1WG0 A;  2DBA A;  5ARF A;  4V3I A;  2KC7 A;  5LFA A;  1P5Q A;  3ULY A;  2CG2 A;  5KJM A;  3CV0 A;  1IYG A;  4PS7 A;  4XI0 A;  4CYM D;  2J4B A;  4JB8 P;  1H2U A;  2MRI A;  3DWL G;  4F6R D;  1A5E A;  2DWZ A;  3SFY A;  3HHM A;  4J8S A;  3SQV A;  5ENQ D;  3F6Q A;  5J08 A;  1KLX A;  5ENT D;  4AP2 A;  2XGO A;  4AY6 A;  5ANL A;  3U3W A;  3BEE A;  2X6K A;  3HG0 D;  4G24 A;  2WXF A;  4XE0 A;  3OTN A;  1XGW A;  2UY1 A;  4GPK A;  5FQ6 A;  2B0O E;  3Q15 A;  1Y8M A;  4ME2 A;  5G55 A;  2KAT A;  5EX3 A;  3ASG A;  3I4R B;  1UN9 A;  2V0P A;  3QAR A;  4TV3 A;  2BED A;  2XPI A;  2AWI A;  3L9T A;  4H7X A;  2QC9 A;  4GMR A;  3CK9 A;  3NQP A;  2ZGD A;  3PEV B;  4AOF A;  4KZ0 A;  1NFI E;  3D3M A;  4LNU D;  3VLD A;  1AP7 A;  4E85 A;  5KJL A;  3FUI A;  4FUL A;  4RLY A;  1FVH A;  5BUZ A;  2UWJ G;  4YND A;  4AEZ C;  1WAO 1;  4B0Z A;  1S0P A;  4CDN A;  2F37 A;  4U95 D;  4AJW A;  4OYS A;  4N5Q A;  3FU0 A;  3VLF A;  2BTD A;  4WAF A;  5CED B;  1E8W A;  1NZN A;  1JWG A;  2LXL A;  3ZKJ A;  5G05 C;  3EHM A;  4YDW A;  2KZT B;  3VTX A;  5HI7 A;  3UX4 A;  3UT4 A;  2PM7 A;  3LY7 A;  2YIN A;  4N5C A;  3O4Z A;  2KCL A;  1O5M A;  2GRQ B;  3DPY A;  1HF8 A;  3CSF A;  3MJW A;  4U0U A;  3ASF A;  3PNT B;  4U0Z A;  2MOW A;  1BLX B;  2VGX A;  2CHX A;  2XZD G;  4GTV A;  1O1T A;  4GCO A;  3U64 A;  3HRA A;  5BW8 C;  4DX5 D;  3C3Q A;  5BNW A;  1JCQ A;  4BTB A;  3E30 A;  5KNG A;  3UT8 A;  3HYM B;  1DC2 A;  2LXM A;  1Z5S C;  2PNN A;  1TN7 A;  4A3T A;  3UT7 A;  1AWC B;  2EIM E; 
#chains in the Genus database with same CATH homology
 2IO2 C;  2GRO B;  5D2M C;  1Z5S C;  3UIO C;  2GRR B;  3UIN C;  2IY0 C;  2GRP B;  3UIP C;  2GRQ B;  1KPS B;  2IO3 C;  2GRN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...