2GSGB

Crystal structure of the fv fragment of a monoclonal antibody specific for poly-glutamine
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
QVQLQESGGGLVQPGGSLKLSCAASGFTFRDYYMYWVRQTPEKRLEWVAFISNGGGSTYYPDTVKGRFTISRDNAKNTLYLQMSRLKSEDTAMYYCARGRGYVWFAYWGQGTTVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal antibody light chain
publication title The structure of a polyQ-anti-polyQ complex reveals binding according to a linear lattice model.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 26
structure length 118
sequence length 118
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gsgB00
3PWLB 1J8HE 4G6AD 3UPAA 2P5EB 3DO7A 3IU3B 3LRHA 2MWCA 1JHLH 1FBIH 3FHAA 4JQIH 3FB8B 3MODH 1QVOB 2YD9A 1Q9OA 2V9RA 1PZUB 4PPTA 3G9AB 5DRXA 1TPXB 2VXVL 4U1IA 2RAMA 3RL1B 1CLYL 1PSKL 3VFMB 1E4KA 4ISVA 3DV6A 5BV7H 4FQJH 3ULUE 1FO0A 5DJ2A 5I74B 3KXFE 1HHGB 1A4KA 4ZAKB 1RHFA 2L4OA 4BQ8A 3TFKD 4NNPH 3L95B 4X9FA 3T4YB 3QFDB 3OKLA 4WU5B 1T3FB 1R3JA 4JRXA 3S35H 4Z7VF 5T3XH 2ESVB 2QQNL 3GSWA 2EH7H 5H35B 1X5ZA 4JLRB 5FYJD 4PRHE 1TITA 5ANME 3GSNH 3OR6A 3RNKA 4D0CA 1MCSA 3VDCA 5JORA 3X11B 1PKOA 3QHTC 2XY2A 3VRJB 2X1OA 3AY4A 4Y5XC 1S7XA 1CFVL 1YEIL 1B9ZA 2IQ9H 3I02B 3WJJC 1VFBA 5LCVH 1XMWA 3C08H 1ES0B 5JXEA 4YHOH 2EXYC 2DL9A 2ICWJ 1S9YB 1OT1A 1S7RB 5A16B 5TDOA 5DEGB 4F7MB 2AK1H 1IGIL 3HG1B 5IHZB 1RZKC 3BP4A 2IAMA 5BJTB 3QJHA 3NFPA 2DL2A 1F4WL 1W0VA 4U3XA 3HRZB 4G80A 3PWVB 3MCKA 4OUUB 1U91B 1BMGA 1I7ZA 3Q0HA 3IKKA 4JO2H 2NY3C 3NFSH 1G7IB 5F6HI 2VC2H 3FQRB 2CIKA 2EZ0C 3WE6A 4OLUH 5GZNC 5MEOB 4KXZI 4U3CA 1GGTA 1UB5B 5F93C 5DUBA 4NO0D 5EO0A 3REWA 2A74B 5J6HB 1CFNA 4TULL 1RJLB 2WUCH 1FJ1A 2XWJB 4G7VL 5TJWK 2CUMA 3DPBA 2DI8A 3IFPA 1YPZA 3A6OA 2CK0L 2G60H 2HFEA 4XI5D 3BZFA 4KKBC 3ARPA 1JCKA 4X5WB 4MAYA 1AGBA 2VSCA 1IGFL 1PG7W 4KK6D 1VGEH 3EO9H 3O4LD 3HZVB 5KS9E 1Z2KA 3D25B 1A1MA 2XN9A 3T0BA 3SE3A 4JHWL 3PHOB 3UTSD 1FZOB 1OOAA 1BQUA 2ICCA 3QR2A 2G9HB 2UVEA 4R9HA 3MBEA 4NN7C 4S0TD 3RA7L 2GITA 2YUWA 4HBQA 4YXLH 2IG2L 1HE7A 5E5MB 2PXYC 1UJTA 2ZJSH 4GAFB 3GJFH 3L5XH 4Y1AE 3RWDB 1UKQA 1G9NL 2DLFL 1S5IL 1AGDB 2JLLA 4L3EE 4J3WA 1XF4A 5GS1C 4R97C 3Q6GL 4OZGB 4Q0XH 4RAUA 2NX5B 4D9QE 3SPVA 2GYSA 4QF1B 3S35X 1JHTA 3HZMA 3IS0X 3BZ4B 3V6ZB 3EYOA 1NPUA 5E6YA 5T1LD 5DUMH 5CGYD 4YGAB 3KPPB 4MD5B 1JI2A 1UGNA 1QBLL 1SEQH 4UINL 5L2KE 2WIMA 1QTYT 1C08A 5KJRL 4Z0BL 4RX4D 5D6CB 1NGQH 4OBSA 3AREA 4JGUA 3WHXB 2PTTA 2VLRA 1AY1L 4YDJA 4YDLC 1FFNB 3O8XA 5EFIB 1JPTH 3S3SA 2VAJA 1IKFH 3I6LD 3MRJA 3QNXB 4F7CB 5K9QI 3EJYC 2QL1A 2CGRH 1SM3H 3RVTC 3DETC 1DQJB 1KIQB 5GS0H 2PYFA 1S3KL 32C2B 4X8JA 3SJVE 1NBYA 2V9QA 5CEZD 5EBWA 3KYMA 3RFZC 1BAFH 4Z8FH 4XWOD 3VFWA 2ED9A 1KJ2H 2VDML 5D96C 1LO5A 5EU4B 3LVEA 3L3KB 1SQ2N 4U1MB 3BT2L 1KB5B 1GAFH 4LLUB 3MYJB 1AQKH 1SBSL 4XH2B 4F7EA 2F54D 4JPVH 3RX7A 1JGDA 1UXSA 4OFYA 1YN7B 4MXWH 4GSDH 2EDQA 1FNEA 4YHLL 1EEYA 5AEAA 5J89A 3HZYB 5EH1A 1JZ3A 4HIXL 5FECB 5MENB 4RAVA 3IRPX 3ROLA 3T3MF 3U30B 1MCLA 4ODHH 1M1SA 4KMQA 1CDJA 4HWZA 2VYRE 4GXVL 3V95A 4P59L 2F9BT 2W65B 1I1AC 2GT9B 1CT8A 5F96L 4CMHB 5DK0A 4K3EH 5FKPA 4LHUG 3FB7B 3E3QE 3TVMA 3BQUD 2JJWA 3T1WA 1EAJA 1HSAB 3HAEG 4LL9A 2EYSB 4GLRH 1YMMB 4U6HA 3SKJL 1UH4A 2H32A 3MBXL 2B5IB 1KN4L 3VE0B 1JGLL 5D5ME 5DS8B 3WL9A 4D0BA 1EEZB 5A3IC 1N5YH 3H0TA 1TETH 4BZ2H 2UYLA 2IAND 3NPZB 1FPTL 1WFTA 5DA4A 1A5FH 2X4TA 4YHPA 5J12C 4FFYH 3WUZA 2YK1H 3DLQR 3QUZA 1I1RA 3QHFL 2BY0A 4U05A 5I1CL 5EZIL 3CXDL 1XGQA 5AAWA 1ZWIB 3L5HA 3OAUL 3QEUB 5HHOE 1FHGA 5EIVA 1UH3A 5ESQA 1VCAA 1ERNA 2DQDL 4LOUC 2NY5H 2HMIC 2DQUL 1F58L 3H3BC 1NUNB 1F2QA 3TIEA 2DMKA 1G6VK 1AIFB 3DROA 2EC9U 1XF5B 4PTUA 1MFCH 2EDYA 5FCUH 3UJTH 4JFHD 4WTZG 1DANT 3JWOH 5FM8A 2X44D 3GIZL 3VWJD 3U9UA 1V05A 1CN4A 5CEXB 5C0NC 3GI9H 3B9KC 4GKOA 1N0XH 4MQSB 5T1KB 1LO0H 2AXFB 2NY0D 2LU7A 3C6LD 4KRPC 5F89B 4HIIA 3WFCL 5ID1B 4MGXA 3QDJD 2P7TB 5IJVA 4P2RD 3OJDA 1BFSA 5HHQB 2PO6A 5B3JE 2X89A 4JHBA 4HBCL 1IGTA 2D7TL 4G9FA 1S7UA 4LVEA 5DO2C 2VDRH 4MNQA 3REVA 4YWGH 1K4CB 5I8OL 3O4OB 4PR5A 4DUVA 4C56E 5EC1A 3FAXA 3LRSB 4JDVA 5IVZA 1MI5B 2WIIA 3VRLE 4TVPD 1I3GL 3EFFB 2ZSWA 3IAPA 4NNYB 4BK4A 2LV4A 2AK4E 1B4JL 1MCNA 1XGUA 5KSUA 5TFSL 2J6EH 2YC1B 4Y16D 4MLIA 1KPRA 2DLHA 1FYTB 1ZHKA 4PGEB 4YXKH 4LSQH 1MQKL 1EMTH 1YQ2A 1TZIA 2Y1VA 4NQUA 4NZTH 3LCYA 4MQ7A 4DGVL 1J0KA 4P9HC 5D7JA 1AR1D 1DBAH 4M6NH 3FO1A 1HI6A 4KZEL 3O6KH 3K2MC 2QLVB 3P4LA 4KK8D 5IMKA 4ZNEE 4G42A 2AJSH 2HVJA 3RWJB 4HKJA 4OGXL 4H8WH 4PJ5D 1T21A 1Z9SA 3L9RA 5KSAC 3IGAB 4J4PA 1TMCB 3P40A 5FF6A 5IFAL 4M5ZL 3CLFL 4XVSH 1N5AA 1ZGLA 5DQJB 1Q9LA 3TV3L 4OLWL 2JB5L 4L4VB 4Z7UA 4GRWE 4LLVB 1QSED 1QA9A 1R5IA 3QDJE 35C8L 3LKOA 2FR4A 1A0QL 1AR2A 1AXTH 1QRNE 1RMFL 4Y2DB 5IOPA 3N9GL 1RIHL 1FZJB 4JCMA 2J8OA 5ESVB 9CGTA 4TRPH 1INQA 5AYQA 4EN3A 4LHUB 3T8XA 3VXUE 1EFXB 1IGCL 4JFFB 1WIOA 1FN4A 1T7XA 2J88L 4HFWA 2CLRB 4PJHF 3N50A 4P46D 4Z7WB 3HAEB 4OT1L 4EIZC 2GJ6B 3TA3A 4TVPE 4IDJH 4I8DA 4RNRA 2DM3A 4WTXA 2E6JA 5T1MB 4FNLH 1R3HA 1OAYL 4LCWD 3MLYH 4MB3A 3MLZH 1G9ML 1FNGB 4POYA 1HXMA 3MV8D 2J1KA 1CL7L 2H1PL 4IIQA 4PJ9C 5EU7E 4GRLD 2GFBB 4WHTA 1KULA 4HCRH 1XGTB 3FT4B 3P0YH 3OWEA 1ZVSB 4ZPVB 1NFDF 3J8F7 1RSFA 3ZE0E 1KEGH 3ZKMD 5IF0A 4W6WB 3SGKA 4OJFH 4YHZH 1E6OL 4ZDHA 3STLB 5K33A 4I0PD 3F7YB 5C08D 1YNTB 2EIZB 4JREC 5FA4B 1BD2B 1ZV5A 2NXYC 5KW9L 1ZLWH 2HJFB 3I6GB 1GC1C 2C5DC 1ONQB 1CIDA 4Z6AT 5DLMH 5JPNA 4OV6F 5IIEA 3QQ3B 4QTIH 5J06A 4DCQA 1RUML 1Z3GL 4PJAE 3KJ4C 5GJTL 5I1LB 5DVOA 2C3VB 4OCXL 2BERA 4KTYA 5GRYA 1N4XH 5I1GL 4KHXL 2YD5A 2WV3A 4MJ6A 3L3JA 4ZTPH 4QHMA 1OVZA 1JUFB 2Z35B 5EPMB 3RY4A 4NQCD 3FT3A 4MJIE 4PJXE 1NAKL 1N3NB 4LCWE 2BSTA 3H2WA 2WP3O 3TN0A 3QI9B 3MOAH 1EO7A 3WMSA 2E7MA 1P7KB 4M43L 3RTQB 2B4CH 3CDCA 5SWSD 1G7MB 4PJ8C 3A6CL 2J2ZA 3VFNB 3PJSB 2MCPH 1J12A 2N56A 4JM2A 4ZFOB 5FYKH 3WN5A 2D7MA 2BCKB 5L88H 4FQXD 3GMRB 1NGPL 3TBTA 1RK1B 3V8CA 1J9CT 4P5TA 5JLZB 4JPKL 3OKKA 2WW8A 4G6JH 3FJTA 3KYKH 3ZKXC 5I9QC 2ZP0T 2EC8A 3GRWL 3K81A 4JZJC 1YQVL 3VXNB 1J8HB 3SDAA 1B2WL 3QWQB 2VDKL 3VFTB 4ZXBB 4PJBA 4NRZA 4LK4A 3MPCA 4NO5B 1PG7L 1SJEB 3NOIA 3TT3H 1P9MA 4YIQA 4G6ML 2VLMD 3SDXE 4NZRH 2HFFB 5F7YC 3QDGD 3MXWH 2CK2A 1DBKL 1Q72H 2XZCL 3V4VL 1OSPL 4OKVB 5JOFB 2OXGA 3QUYA 2AXJA 1EZVX 4EI5A 2OYPA 3WD5H 5GGTA 2ZKHL 4LLQA 4QHKI 4XC1L 3HZKB 4ZD3H 3L1OL 4G7YL 4MMZC 4JPIB 1BVKA 5C1MB 3DSNA 3MO1B 4U6XA 5CSBA 3DI3B 2BRRL 1YEFH 2E7LC 1P4BH 1YZZA 4I4WB 2QSQA 4APQA 3SDDC 2X4NA 1FQ9C 4QT5A 5DD3L 3QEGH 4QHLB 4N0CC 3BD3A 1UH2A 1IM3A 5ENWB 1IAIM 1AC0A 1KENL 3EOTL 3IDNA 1KYOJ 3LHPH 4YO0B 2VZUA 1EHXA 1F8TL 2K1MA 2R0WH 4PB0H 3EDFA 2DTML 5A2IH 4LMQE 3VXSB 1WT5A 1JF6A 1UADC 4N8VG 1OT2A 5T3XE 4LSTH 2A9MH 3PWPE 5A2KH 5MI0B 4DZBA 4F15B 1NCWL 3HE7D 2AABH 1U3YA 4NPYA 4PY7A 4RRPG 4NFDA 3MLPA 1Q38A 1WFNA 1D5ZA 4FTVA 4N8CL 1FO0L 4HUWB 4HFUH 4HQQL 3PWUB 1UWGH 4GW1B 3RIFK 4OLYH 5EOCL 4WI7A 5TQ2L 4NNXB 2Z4QB 3P4OA 4R90H 3JTSB 4LCUA 3S37L 1F6LL 3MJ7A 5HTSA 1LDPL 3LRGA 1TPXC 4UDTA 4UT7L 5JR1H 4I3RH 2ZCLL 1WAAE 2CKBL 3IT8D 5DVKA 5GGVY 5DRNA 1SMOA 1I85C 1DQMH 3D18B 4CAGA 1I8LC 1QO3B 3MJ8B 3VI4E 3RX8A 4ONHA 1A6PA 5I74C 1K4DA 2EDLA 1MOEA 3MRMB 1ND0A 4U1HB 4ZAKC 4LHQB 2GY5A 2IPUG 3L3DA 1T2XA 3T77B 5FO8B 4P2QA 1IGJB 1P7QB 5EU6D 1H5BB 5IG7A 3TM6A 1JNNH 1UM6H 4A6YA 1SBBA 1ZLVK 5ICYB 2BNQA 5EIIB 4X5XB 4LEOA 1GZPB 3BKCL 2YD2A 1I4FA 3CFDA 1KT2B 1R5VB 4TTDD 4QCIB 2ZUVA 1H3VA 5D8JL 2R0ZH 1MFBL 4LPUA 1DDHA 4M3KB 3MRIB 4J23A 2W0FA 1WK0A 4JDTH 3O2WH 1MF2L 3M1BA 1EJOH 4Y1AB 5JDSB 3PWJB 1AO7D 2WUBH 2Z31D 4P23D 1NJ9B 4I5BA 1VEPA 3HNVH 4I3SL 5IKCB 2LFGA 3BGMA 4OI7A 2F53E 5AZ2H 2PN5A 4NN5B 4ONGH 2B1AL 5IB5B 4D9LL 5FV1L 1QFWM 3B4NA 1OD9A 3HA0A 5L6YL 2BY3A 2ICWI 5D7SL 3DXAB 4GG6A 5DMYA 4Z5RA 2AI0H 3G9VA 2NY1D 3VI3E 5E94B 4PRIE 4AEHH 3V4PL 3WLBB 1UZ8A 4IRJD 3T0EA 4U6YB 4EDWH 1QFHA 2XTJC 3MGTA 4FFWC 1M7XA 4X98B 4AYFA 4RGNB 4HKBB 3V5HB 3D0LB 1XIWB 5B38G 1VADB 3CVIL 1GL4B 43CAA 3CSYA 3ZT6A 4FP8H 1I9JL 3PDOA 2DJSA 4QTHB 3JV6B 4BSWA 1T22B 3NFNA 1I7RA 2VXVH 3SKOA 3Q3GB 4Y4KA 3KDMA 3RVWC 2BVPA 2XQYG 3SOBH 3LKNB 5CINL 1KTRL 4R7DA 5DC0A 4WUUE 5GGSY 3O6FD 1GGCL 1IC4H 1R24A 3ARGB 3FONB 5D1QC 5E70A 5C0BB 2OZ4L 4OFDA 2HRLA 3X14A 3T2NH 1W0YT 1QPXA 4N8VB 4G8FB 1LEKA 3VDBA 4WDIA 5D7LB 2R39A 2VDLH 5DJAB 3UYPA 3X13A 3WNNA 1AO7E 4Z95H 4WW1A 5FUCC 3GGWB 1JE6A 4B50A 4YGVB 3CVHB 3DSFL 2FB4H 5DC9B 2PYED 4CJ1A 4Q9RH 1T7ZA 2QQNH 2XZAL 4KJQC 4QYOB 3QIUA 2E9IA 2E6QA 4PRAB 1RIVL 3OGCB 3U7YH 4FQQB 2C1OA 2FATL 3KLAA 1GHFH 4QOKE 5TE7H 4WFHD 4P3WA 3NA4A 4KTEL 1CFVH 2KQNA 4L9LB 5J9PA 2FD6H 4Y88A 5DHXB 1N6UA 3MQIA 4I2XE 1LHZA 3UTTB 2HRPL 5DJCB 4G43A 5ISZB 1ZA3A 1GPOL 1KPUA 4Q2ZA 3EO1B 1Z9OA 4K2UH 1CLZL 2X1WL 4BH8B 5T1DL 2QEJA 2R2BA 3QG7H 4B41A 4LCIL 1X3DA 3V0WH 5ADPH 1F4WH 1BJ1J 5DJYB 2B39A 4JM2F 5I18L 3V4UH 1T0MA 4N0YL 3V6OA 1Q9OB 5HHOB 4K94H 5GRJH 5DRXB 2Y7QA 1FZKA 1DL7H 1MVUB 1JNLL 3EDEA 4MB4A 3VFSB 3CFIC 3JVGA 1KJVA 2QQLH 2YN3A 1P4LA 1IJ9A 4AH2B 3PXHA 3I84A 2HKFL 2EIEA 3QIBC 4HS8H 2CK0H 1HDMA 5CJXC 1A4KB 2VNCA 3RL2B 1OF2B 1IGFH 2APVA 3QHZL 4LFHG 3U30C 2XZQL 1OQOA 1MEXL 3QPXL 4Y5VA 4NWUH 3KPLB 4TYUA 4U7KA 5I1KL 3MOBL 4HPYL 5B4MD 4N9GA 2MSPA 3DX6A 4WFHE 1IQDA 2XQBL 4N1EA 1F11B 1GIGH 3HPLB 1OP5K 5D1XD 3RNKB 4D0CB 5ITBH 3BDYL 5JORB 4ODUA 1G0XA 3EYQC 4MQTB 2YPLD 1JV5A 3Q6GH 2B5IC 4YJZL 4WI9A 5IV2B 4MXQD 1P5UA 3GJEA 1CIUA 4DGYL 3FQUA 1QYGL 3QAZB 1D9KD 2UY7A 1OTSD 5B38B 3EHBD 1ZT1B 5DF0A 1YEDA 3BMWA 3LDBB 4LKCA 5E4IA 5TGBA 2NPLX 4Z0BH 2IAMB 4Z0XA 4ELMA 4EXPX 3QJHB 3NFPB 5HD8D 4X4ZA 1W0VB 2ICES 5KSBE 5HHNA 4G8EA 1I7ZB 3VD4A 4XCCL 4L3EA 1BREA 2HT4C 4U1SA 5DJ6B 3MLVH 1A1OA 4CBPA 1LO3L 4HWEL 2Q86A 1A4JA 2CIKB 3EJZD 5FGSA 3KHQA 1CFSA 1G7LB 4FXGB 5C07D 5BXFA 3MLUL 3T0WA 3JWNC 3REWB 5IFHL 4PJGE 3RY5A 1CFNB 4X6DE 3DYMA 5B8CC 4HXBL 5D7KD 4KQ4H 1NFIA 3OJMB 1C5BL 4KHTH 3ZDYF 1YPZB 4UMGA 4NKQB 2HFEB 3BZFB 2VDMH 2VLJD 4MAYB 2H6PA 1AGBB 4EVNA 3VXRD 1CI5A 5TE6L 5I1EL 3BT2H 3OR7A 4P3DB 3IVKA 1JPFB 4ZFGH 1A1MB 2XN9B 4WJ5B 3ARQA 5GSVA 2ZSVA 3NAAH 2AKRA 3RWEB 4RMQA 4L5FH 4OF5A 2GITB 3X12A 1E4XI 4U1JB 3IKCA 3O4OC 1MRFH 4YHLH 1K2DA 4PJCE 4HIXH 1MCHA 3R0NA 1F97A 1MHHB 3MRQA 1XF4B 3O4LA 4GXVH 4P59H 2W9DL 3SPVB 4XTRD 3MLSH 1JHTB 1XCQB 3HZMB 5E1AA 5F96H 3EYOB 3UTSA 4DVRL 1OM3L 1DEEA 3UJJL 4GQPH 2VZTA 1QRKA 1CXEA 5I1IL 1KG0A 2Z8VC 4Y5YA 5IT2H 3DOSA 3KHOA 2NY4B 3Q5TA 3SKJH 4RMSA 5EN2A 3LQZA 2HG5A 2AJUL 5C9JA 5D70H 4FQHA 1C08B 5F1KC 1EO5A 5C0IA 4PGDA 3MCLH 5E6ID 3ZE2E 3AREB 2B2XL 4K7PY 2VLRB 4HLZG 3ZMRA 4YDJB 4LPVA 4U4BA 3AUVA 4XAWL 4X6EA 5FYKD 3UP1A 3MGAA 4EIGB 3RWGA 4L8DA 2VDNH 2K7PA 3QHFH 4LQ1A 3MRJB 3CFJB 4UIMA 3MSPA 4TVSa 4XPBH 2HT3D 2GKIA 5HHXH 5CJBA 3P11L 3BH8B 1KGCD 2PYFB 2DQDH 1T7VA 5J57B 4RX4A 1F58H 1PY4A 4M5YH 3KYMB 4B7IA 4PJAB 4UQ3A 1ZT7A 4Y2DC 5D5MA 3FT2B 1LO5B 5FYLL 3BGFB 4XMPL 2VISB 3LS4L 3PGCA 3WNMA 2VQ1A 3TWCL 1YC8A 1K8IB 4OGAD 1CG9A 4FQ1L 3ARUA 4D8PA 2NY2D 5HYIA 1SMAA 3IFNL 4JO3H 3UTZA 2C3WA 2RHEA 4MS8C 1UXSB 1OP9A 4Z18A 1DR9A 1EEYB 3K7UA 3DRTA 3S5LA 3BN3B 5EZOH 3WFCH 4ALAH 1YY8B 3ZT5A 3ILPB 4R2GB 1JGEA 1XCTB 3WSQL 4HWZB 2A6DA 2R2EA 4O02L 3GMLB 2D7TH 4XBGA 1MCRA 4YPJA 4RBPH 1M05B 4LLWB 5GZOD 4FXLA 2YHGA 2F54A 5DK0B 3UDWC 3TVMB 3BKYL 2A38A 3NA9L 1KXTB 4TQEH 4IRZL 2YA0A 4U6HB 2FH8A 3B9EA 2H32B 1CCZA 5I75B 1B4JH 5TFSH 3O0RH 3CH8A 5FYKE 5DHVB 4CVWA 3S8WA 3WL9B 4D0BB 1OL0A 3NCYS 4EBQL 5I2IA 3DIFA 2UYLB 1DQDL 3LN4A 4Y4HD 1MQKH 1UA6H 1OCWH 3LEXA 2HH0L 1GOGA 1ZHLA 1BGXL 4BK5A 3PABA 1JFQL 3BQUA 3HI5L 3QUZB 3ULUF 5FO9A 4JQXC 3SBWA 2P8PA 1X5KA 3IJSA 4TUJA 2OL3A 4PYHA 4JN2A 5HVGB 2Z92A 4NQED 5LAXA 5ESQB 1MCOL 4LDLB 5FM5O 2NTFB 3TIEB 5EA0H 2IANA 4OZHE 1OP3H 1OW0A 3DROB 3VXTA 5IQ9A 2MFNA 3QQ9D 4PTUB 2OTWB 1HKLH 3ARZA 5C3TA 4M5ZH 4H1LH 1UJ3C 3U9UB 4OLWH 3DV4A 5KTEL 2JJTA 1A14H 2BVOA 1Q9KA 35C8H 1UVQA 1UC6A 4PRDA 4ENEC 5EDXA 3RTQC 4HIIB 2WBWB 4OCRL 2M2DA 3EGSB 3ZHKA 5IJVB 3OJDB 5T5FL 1BLNA 2FHFA 4WY7L 5F1NA 4LSUH 3B2VL 4MNQB 4KJPD 3REVB 2DKUA 1MCWM 4QHNA 3NBNA 1G6RA 4PR5B 3KR3H 3QUMH 5EC1B 4JDVB 1G9MH 5IVZB 2ITDB 2VR5A 2WIIB 4FFZL 3C6LA 3ZYJA 1Z5LA 3BSZH 2KH2B 1CL7H 5AYUL 3DVGB 5C86A 2ZSWB 4RWYL 3ES6A 3SE8H 5SX5H 1XGUB 4O5LL 1VFUA 3QDJA 5KSUB 4LRIC 4P2RA 1KPRB 5E5UB 3T3PE 1SVCP 3OSKA 5BMFL 1ZHKB 4OD3L 2YN5A 1GOFA 5EZJA 3KPMA 4QHUA 1HILA 2VITA 4F58L 4L8SC 4I0KA 2W07A 5D7JB 2A77L 4JAMA 1HI6B 1HHKA 4O4YH 1X5HA 5KZCD 5IMKB 2J5LB 4G42B 1T04A 4Y19D 3ULVC 4Y16A 1MFAL 5KS9F 5L7XH 1T21B 2VTFA 3L9RB 4TSBH 1CS6A 2W59A 3QXTA 4GRMA 3QUXB 1RZGA 4O9HL 5FF6B 1WTLA 3HI6H 2DQHH 5BS0E 1N5AB 1ZGLB 1Q9LB 1KLGA 1EGJA 1YEGH 4NQSB 1MCWW 4Z7UB 1P1ZB 1LGVA 2EYTA 5SX4H 1W8NA 2FO4B 5EUOB 3LKQB 4JO4H 3LKOB 1YECL 4PJ5A 3SGDI 1TVBA 2BP3A 2AXGA 3HUJE 5IOPB 3TCLA 4HKZB 1NKOA 5F9WB 4HWBH 5IHBA 4E5XB 3P0GB 2EDDA 3ARWA 2JELH 2PW1A 3L6FA 2HT2C 4O2CA 4F15C 4J3TA 4NQDE 4P2CG 3TA3B 3GBMH 1OB1A 5IMMA 5ERWA 2I07A 3T65A 4LRNH 4KDVA 1R3HB 2IFFH 3U48A 4EOWH 1T7YA 1HXMB 3QDMD 4HUKB 2NW3B 2WBJD 4R0LC 4IIQB 4XRCA 1KTDA 5CEYB 4NBXB 4F9LC 1JIBA 1A7RH 4IMLA 3RU8L 1LMKA 3HMWH 4P46A 4U1KA 1IKNC 2IH1A 5I1AA 4DKDC 3IF1A 3MGOA 3BEWB 4EI6B 1INEH 3CX2A 3GO1H 3BPCA 3VFUB 5JXAH 4MJ2A 4GAGL 4AT6A 4NBYB 4MJIA 4PJXA 3N1MC 1DLFH 5IF0B 4LCWA 4Z77A 1VEOA 3FFDB 4JY5L 5I1HH 3K0WA 3G04A 4JFXA 3MV8A 1B6UA 2DWEA 2R1WB 3CDFA 4UV7H 5FYJU 1NMCB 4GRLA 1EVTC 5INDB 4FFVC 4PBXA 1WV7T 4G6MH 1H8NA 4GFTB 4XPFL 3V4VH 4U1NA 3R1GL 5JPNB 5IIEB 2I26N 5HBBA 1MY7A 4OCMC 2FJFA 2ZKHH 3I3BA 1CICD 3ZT7A 3FZUC 3OAYH 4I0PA 3L1OH 4G7YH 12E8L 4XCEA 5C08A 3C2AH 5D1ZB 2XFXA 4GMSL 1N7MH 5HI3D 1T1ZA 4M4RA 2WLYA 5IP4A 4I18A 4KK9C 3S88L 1MUJB 3L3GA 3L3JB 4QHMB 4YDVA 1G1CA 4F3FA 5FGCE 4X4YA 5LBSL 5IWLC 4OD1H 4R4FH 4U31A 3FT3B 1T03L 2CRMA 5C6PB 3GMOA 3MNZA 1B88A 4YH6A 1U8JA 5EC2A 3GSRA 1CFTA 3SQOH 1XGYL 1L0YA 5I17A 3DVIA 5D5MF 4DKFL 2BX5A 1FFPA 5HHMD 1DBJL 5CBAA 1HSBA 5IROC 4Q74A 4IJ3C 2FL5A 4GT7A 5F1SA 1T2QH 1ZLVH 2BVEA 4JE4B 4NQCA 3CSBA 1KCLA 5DK2B 2OJEA 5CKGA 3FQTA 3H9HA 1PZ5A 3TBTB 2GJZA 4P5TB 3OKKB 4PJIB 2D7OA 4HQQH 4RGNC 2BOBB 2BSSB 3FB5A 3MNVA 4FQLL 1XIWC 3D39D 4K55A 4NC1E 5SWSA 3BW9A 4NRZB 3KVQA 5TQ2H 4AEEA 4XXCC 4TSAH 4PB9L 4M8VA 4LSRH 5F71A 3P4MA 3UCRA 1LDPH 4YIQB 4FQXA 4PP1C 2ZCLH 4KKCD 2CKBH 1LO2H 3NVQA 1LNUA 2WQRA 3SGEH 3GSNA 5GISH 3ARGC 4N0UE 3TJHC 4ONFL 4EI5B 2M1KA 3BN9C 1X5GA 1WTGT 4LLQB 3NCBB 3U6RA 3NPSB 3ULUL 2HN7A 1EHLL 5FAAA 5EO1A 2X42A 4PV9B 4HMCA 1GC1H 4H26A 4FZ8L 4ZNCD 5A2FA 3ARTA 4U6XB 2Q7YA 2Y06H 1KCUL 3O3DA 1KCVL 2P8LA 3QDGA 1QLEL 4Q97A 2X4NB 4Z7QE 5I6XB 4Q6YA 2RBLA 3RVXD 3TO2A 3VRLF 1R5WA 3K74B 1F4YL 1IM3B 2OS7A 1MFBH 3IDNB 4KVCH 4XBPA 5BVJA 4S1RH 1G7PB 2ZZUT 3W0WD 2AJVL 2LABA 4HULB 4L9LC 5IVXA 2RR3A 5LKNA 4BFIA 3PWNA 1IAOA 4I3SH 4DZBB 1FFRA 4WNQA 5KOMC 1U3ZA 4W4OA 3F7RA 4I13B 4NPYB 1NEUA 5FHAL 4KUCF 1D5ZB 3QWOB 3ARDB 3MMEA 4FTVB 3WNPA 2JCCA 1CD0A 5L6YH 1NCNA 4JRYE 3ZO0A 4GQ9L 3ZTJH 6CGTA 1UZ6E 3K1DA 4Q6IA 4UTAH 4PG2A 2CIIA 2NZ9C 2I5YH 4LCCC 3FFCE 5IVOA 2VXUL 1TDQA 5I19H 1NCCL 2AJXL 4QXTA 1BQHA 4OB5L 4PREB 2F58H 3P4OB 5TH2B 1MIEH 3LKRA 4NDMA 3MJ7B 1I3RA 3LV3A 4TNVK 1G7QA 4P2OC 3S34L 4AEIH 4J3OC 1NAMH 2R2HA 1S7VA 1U8MB 2YD3A 3C5ZB 4GBXD 4GRWF 3KPQA 3CJJA 5DRNB 4ESKA 3GJFA 3M45A 1WEJL 2W92A 2XWTA 4WFFE 3U0PA 4QRSA 2IALB 3SCMB 4ONHB 4Q7DA 4X6DB 3THML 1K4DB 3NCEB 4MYWB 1ND0B 3BP5A 3L3DB 1BX2B 3DVFA 3SDCB 4HIJA 4P2QB 4WFGE 3EYSL 4J8RA 4DTGL 3ZKQD 4H20H 5IG7B 1MJ8L 1NLBL 5D6DA 3UTPD 1GGCH 3RY6A 2VL5B 4BFGA 2VLKB 4A6YB 3T09A 2BNQB 4X6BA 1RZIA 2OZ4H 3AXLA 4K3HA 1HN1A 2YZ8A 4LEOB 3NACH 2DOCA 1V3LA 4LLMA 4N68A 4RA3A 4X7SH 2LE9A 1REIA 1II4E 1BJ1H 1DDHB 3EDDA 3PV6A 4MDJA 4YHNA 2EZ0D 3C5SA 4OV5A 4UILH 3D85B 3TBWB 1T66C 3AY4C 3BIKB 5EU6A 2FGWL 2DQCL 3DSFH 1H3GA 1OQXA 4I5BB 3ZE0F 1J05A 4ETYA 2X4RA 3QEQD 3PHQB 1VEMA 2PR4H 3KPSE 3PXJA 5T33L 3VXMD 1Q94B 2R15A 4MA8H 1CLOH 3LDBC 3FRUA 2Q8AH 4GG6B 1INDL 2IAMC 1WUNT 1U58A 4K9EL 1KJ2A 2X6MA 1KF9B 1EO8L 5HI4C 2ZPKH 1QR1B 4NQXA 1GPOH 1AO7A 5TDPA 1NUDA 3MJ9H 1CLZH 5DD6B 2C26A 3TO4A 4KMTH 4OCLC 1ZGLM 1OPGH 3WDJA 3P77A 4BQCA 3CLEL 2YR3A 5IHLB 5I18H 1OSZB 4HUUB 4CMMA 4KDTA 5BVPH 1OAUL 43CAB 3PDOB 1CGXA 4BSWB 3CU7A 3NFNB 1I7RB 4MAYC 3NTCH 4IRJA 3SKUD 4PJXF 3BOVA 4Y4KB 1JNLH 3JWDL 3L7EA 4X99A 5E9DE 2BVPB 3MV7D 4I2XA 3PGFL 2CUIA 3S97C 4HKXA 1KELL 4R7DB 1AFVL 3B6SA 3RGVD 2HKFH 3QEHA 2DAVA 1R24B 5IB2B 1N6QL 1FRGL 3D2UD 4M48L 5I15H 1I8IA 4OSUH 4U7SA 1IEBA 3RJQB 3F12B 1AGEA 3VRIB 3X14B 1FGVH 2F8VA 1JMXA 3S36L 5CZVH 5DURD 5HGHA 5IEHA 1LEKB 2F5AL 4WDIB 5LQBH 1T6WA 4HK0B 1J0IA 3X13B 3MUHL 4WW1B 3FMGL 1IILE 4PJFE 1LD9A 3LKPA 4NP4H 3DETD 4NM8L 1A22B 4UDUA 1DVFD 3WIIL 3O6FA 1J1PL 1QBML 4E42A 3QIUB 2XQBH 4QRUA 2IADA 3DMMB 1RZJL 3P30L 1BFTA 1EXUB 4XPTH 4DKEL 2C1OB 5E2WH 4P3CH 1UCBH 1OLLA 2NY4C 2MCG1 4HZLA 1G7JA 4O51A 4CDHA 1O7SA 1IEHA 5J9PB 2B8OT 1I3VA 3SDXF 2RJMA 1QYGH 4G43B 1OTTC 2PYEA 1ZA3B 2HJKB 1KPUB 2FX9L 1CGSL 4G8GE 5E6ZA 1PKQB 5H37G 2HJLB 1S7QA 2ENYA 3RUGE 1TCRB 5ABDE 2R2BB 1IEAA 4DQOL 1LP9E 1CDYA 2VXTL 1YEJL 3MV01 3RKDC 2B0SL 1PDKA 5CEZL 1AKJD 4QRPE 1NANH 3O45A 4YHKH 4R96A 2A6KA 4XC3L 3U2SB 4CUCA 2Y7QB 3CDYA 1KIRB 1KBGL 3ARBA 3BGFC 5F6IB 1C5CL 4XNYH 1MJJA 1P4LB 4BH7A 1NLDL 4HWNA 4C58B 5IFHH 1JGVL 4NKDB 4OZIB 3BD4A 4F7TB 5A3ID 3O9WC 1N8ZA 2J6EA 2CSPA 5DD5L 5I1EH 3LEVL 4KU1A 4DOHB 1UB6A 1R3IL 4Y5VB 2ZG2A 3QCVH 4NO3A 2ATPA 1U36A 3CFCH 4P4KC 4N9GB 3DX6B 1YMHA 2HMID 3MRKA 4H0IA 3QFJE 3TVMC 4D9RD 4MQXC 3WXWL 1EX0A 5FB8A 3LD8B 2DYPB 4AZ8A 5I75C 4R3SA 3AS1A 3U9PL 3VCLA 6FABL 2IBZY 5D9SB 2WLZA 1K3ZA 1AQDA 3K2UL 5JW5B 1WAAF 3T0VA 3W5MA 4L9DA 5I1IH 2P5WD 4XNQA 1DZBA 4QXUH 3MA9L 15C8L 1P2CB 1YEDB 3O41A 3VI4F 2BNUA 4AM0B 5D1XA 2W9LA 5TGBB 4JZOA 3ZYZA 2YPLA 4ELMB 3D0VA 5C0CE 4X7CC 4LSPL 4TUKL 5HHNB 2W9EL 5TDNB 1GXEA 4G8EB 3IB4A 2R0LL 4RSVA 4DUWA 4U1SB 1RJZA 1KC5H 2PKDA 1A9EB 1A1OB 4KRMB 1D9KA 2R2CA 2Q86B 2X41A 2N7AA 3EYVA 1CFSB 3VW3L 5FGBA 4NKOA 5BXFB 1DEDA 1LO4H 3SQBA 3FN3A 4LSSL 2BNRE 3F58L 3OF6D 1SY6L 5ESAB 3QDAA 1P5VA 4TSCH 5F88A 4NJAH 1G6RL 4PJEB 3VGDA 4GXUM 2Y5TA 3H7BA 5F7EL 1VESA 4UT6L 2P49B 3ZKND 2SEBB 4HCRA 3UAJD 2UWEB 4DFHA 2O5XH 3IVKB 3AM8A 1SYSA 5C07A 1TZGH 1JPST 4NO0B 4BKLB 1U8LA 3KLDA 1XFPA 2ZSVB 2P48B 1FNSL 1NCBL 5IFJB 5DWUL 4LPYA 5IMLA 3UJIL 2EEAA 3IKCB 4OCYH 3D69B 4TVPL 2VH5H 4JR9H 1K2DB 5IHUH 3MC0A 4WEBH 3U7AA 2NNAA 2VKWA 3VI3F 1JZ2A 2VLJA 1HHHA 5KSAD 2ADFL 3G6JA 3MRQB 3WSQH 3VXRA 3QUKA 4UOJA 2JE8A 1HYSC 3O4LB 2P43B 3ET9F 1UWEH 1PY9A 2X1PA 1JGUL 3MR9A 1TVHA 4XNUL 2VMFA 3UTSB 1BPVA 1MHCB 1DEEB 3OB0K 1IGMH 5F9OH 1MPAL 4HD9A 3AC0A 1KG0B 4LGPB 4NFCA 3X17A 2EXWC 1IAIH 1LILA 1UYWH 3H3PH 3SE4A 1T0NA 4RISH 4QWWD 2AGJL 1BM3L 2J5LC 4L3CA 2YXMA 3AROA 4GH7B 2PUQT 4G5ZL 3JV4B 4V1DD 5T1LB 4X6EB 4OQTH 1BGXH 3RWGB 5DFVC 4L8DB 3RAJH 1W0WA 5CJOL 3QUXC 4UIMB 4J4PC 2BFVH 3BWAA 4CJ0A 4KJYA 4PJ9D 2NXZB 1FL6A 2VZVA 1I8MA 1U3JA 1LDSA 5D7IE 2D3VA 3EW3B 4HS3A 5E6IA 1FNLA 4MSWA 2DLTA 3ZSTA 2APFA 5FO7B 3BO8B 3ILQC 4UQ3B 4WW2B 1ZT7B 1QBBA 5JA9A 1NMAL 5KVDL 1UACH 1CYGA 1MJ7H 4NJ9L 3RHWF 5F9WC 1PFCA 1T20A 3GMMA 4S2SB 5JO5A 1QOKA 5DTFA 1BVLA 1CG9B 5BRZD 4XBEL 3WNLA 1X5JA 4JQVC 3VFVB 1PLGH 4G9DA 4HG4K 3KPRE 5IBLD 2NXYD 2R69H 4LIQL 3CAFA 3DRTB 2DTSA 4XNXL 5JHDD 1JRHL 1JNHA 4KPHH 3FO2A 5T5FH 5ALBH 2A6DB 4NQVA 2DN7A 2R2EB 5DMKA 3GKWH 4X4MA 4XBGB 4OZHA 5E0QA 3G5ZA 2HVKB 2F54B 5HXMA 1OAXL 3LQAC 5SWQA 3IAGC 4PRPD 5D2LE 3G5YA 2X9YA 2AV7A 2Y36L 2OP4L 3BPNB 3SGKC 2V7HA 3LMJL 5L0QB 2ZCKL 5DVLA 1S9XA 3HB3C 2I27N 3SE9H 4RWHA 2FX7L 4JFDD 2XPGA 3TBYA 4OD3H 1NMCC 1OAKH 3GHEL 4E41E 3CC5B 5E2VL 3RWHA 1U8HB 4Y89A 1V5JA 1ZHLB 4OBRA 3GSUA 5JUEH 3BQUB 2J8UE 2OTUB 3IS1X 5FO9B 2P8PB 4RDQG 1QFWH 2OL3B 1JHLL 4JQIL 4GKZA 3PQYD 3MODL 2Z92B 5LAXB 3TPUA 3BXNA 4OI8A 5D1ZC 1A7NH 1HEZA 2IANB 4WEUD 2UUDH 1TTUA 1E28B 5DQ9A 5C2BH 3K80A 2OQJA 4ODSH 5IQ9B 1OGAD 3IDGB 4U1GC 5BV7L 4FQJL 2ED7A 1W72B 3DV4B 4KK5C 2IPTH 2VXSL 4NQEA 5HYJD 1MAMH 1UVQB 3FTGA 4NNPL 3HC4L 1GRWA 2HP4A 3HAEH 3S35L 3VGHA 4PRPE 1BLNB 5T3XL 1EBPA 1C5DB 5FK9B 2XIDA 3BAEH 2MHAA 1LK3H 3VWJB 3N1GC 5L9DL 3QNZB 3V7MA 3VXOB 5C09D 1G6RB 3GSNL 3D3VE 1F4AA 2NY0B 2AJ3A 5KSBF 3C6LB 2BC4A 1FLRH 5EORH 2X4UA 1URLA 4EEEA 3HC0A 1BZ9A 2IQ9L 3RI5F 3ES6B 3SDDD 5LCVL 4BZ1H 1ETZA 4P2RB 3O8XD 3IDJB 4YHOL 3FFCB 1F2XK 3FN0H 4L4JA 4UUJA 3WCYA 1RHHA 1A7OL 5EZJB 4QHUB 1P9MC 1HILB 4X9BA 5J1TC 4PJGF 1CGTA 2AK1L 2EDNA 5CBEA 4L4TE 4Y4FD 1Q0XH 5DJZA 2DQJL 2YRLA 4YX2H 2A83A 4PGBB 1FDLL 1CD8A 1NDMA 3OKMB 4Q9CA 1JHKH 1T04B 4XWGH 5JOEA 4UU9A 3NPSC 3KNBA 4JO2L 4Y16B 2GUOA 3NFSL 1OGAE 1OWWA 4NUGH 2VC2L 4OLUL 3N06B 5MEQA 4GRMB 1RZGB 4ZSOE 4XGZB 2VZ1A 1WJ3A 4OD2B 5DD1H 4PJCF 5I6XC 1ZHNA 5KBNC 12E8H 2G60L 1EBAA 4Y19A 2AV1A 4QLRA 2EYTB 3LAFA 3S88H 4PJ5B 1IBGH 1WC7A 1VGEL 3EO9L 4OFKA 1FZMB 3ARXA 3C09B 2X05A 4RFEA 1TENA 4IRSA 1JNJA 2PW1B 3L6FB 5C09E 3QWRD 4O2CB 1OB1B 5ERWB 1O7VA 4YEEA 2I07B 2ZJSL 3L5XL 3ARDC 3KPSB 1QSEB 2CDEB 3ZE2F 1JPGA 3GSXA 1DBJH 5AD0A 3PDDA 1NC2D 3VJ6A 4XRCB 4Q0XL 1KTDB 2ED8A 1K9TA 4XMKH 2ICWA 1FVCA 1U92A 5DUML 1P7HL 7FABL 4P46B 4U1KB 2IH1B 5I1AB 5DI8B 5LGHH 2FIKA 3IF1B 2DIBA 4HIEA 1SEQL 3BPCB 3WO4B 5JPMA 4AT6B 1DUZA 3C5ZC 4KGLA 4F9PC 3OKEA 1VA9A 2IBBA 3QDMA 3B83A 4JFXB 3MV8B 1NGQL 5M7QA 2DIJA 3SCMC 2WBJA 5LG1A 2DWEB 4OIAA 3MOQA 3QCTH 3GBNH 2HLAA 3CPLA 4GRLB 4HHAA 5DEFB 2P5EE 1A6AA 2A0LD 3JV0A 1ORSA 3SDCC 5CGTA 3I75A 1JPTL 2FSEA 1IKFL 3VD7A 1SEBA 4U1NB 5J3HC 2IGFH 5J8OA 4CVXA 1NKRA 5GS0L 2FJFB 3ULVH 1B0RB 3ULUH 3BZDA 1HQRA 4I48A 4I0PB 1EHLH 4LPCA 5C08B 5ID0A 1BAFL 1HH6A 2XFXB 1QSVA 3TT1L 4AIOA 3QIWC 1NCAH 2XTJD 4I18B 4NCC1 1EFQA 4FFWD 4JJHA 4YDVB 4YZFE 1GAFL 5F7HA 4JHAH 2CDFA 2F15A 3TYFA 1AQKL 1BJ8A 1JWMB 3K1KC 4GMTH 5CFHA 1F4YH 3OPZH 3MNZB 1U8JB 1CICA 2CUHA 4MXWL 2YPKA 4GSDL 3TNNB 3IDIB 5I17B 3B2UD 4KVNH 3RVWD 1FFPB 1NH6A 2ITCA 2R1XB 1GZQB 43C9B 4X6CE 2ESVE 4ODHL 5CBAB 5F3BA 1G84A 1DN0A 5DDHA 1RUKH 4NRXA 5E00B 4XHQA 5D1QD 3CZJA 4NQCB 3TZVC 1N64H 4K3EL 2OJEB 3FQTB 3H9HB 4HW6A 5K9KB 1P4IL 1YDPB 4LNVA 5C0EA 3HNSH 3FB5B 2EIBA 3MNVB 5HHPA 5CSZB 2VXUH 1PX3A 3M07A 4U6VL 5SWSB 4OZHF 3HI1B 1LP9B 1N5YL 1TETL 2HAZA 3G6AA 4MA3A 1A5FL 3P4MB 4QRRD 1CDHA 2VXQL 3HG1E 4FQXB 2YK1L 1R3LA 1ZT4A 2V5YA 1EK3A 4P4RA 4JKLA 4YUEL 4ZUUA 2ARJB 3EZJB 4O00A 3D39A 5HJ3A 5DGRA 3RWCA 3THMH 2NY5L 3U6RB 3IFLH 1TTGA 5EO1B 4ZFZA 4WI6A 3DGCR 2JF1A 2ZG1A 3NGBB 5K9QG 5HYQA 1TVDA 1L6ZA 1MJ8H 3BFOA 1DE4B 5TPWH 2Q7YB 1QBAA 1F4HA 4PJ7A 3O3DB 4CN1A 1MFCL 5FCUL 2P8LB 4N1HB 3UJTL 3JWOL 4YHML 4K3DH 2YD6A 3V52H 2APBA 3GI9L 5CZKA 1N0XL 1F42A 1R5WB 2FNBA 1AHWA 3QIUC 1B3JA 4ORZC 2Y07H 3DMMC 3RPIA 1JZ6A 4R4BA 4XBPB 3TC9A 1WCBA 3RVUC 3QFJB 2X4SA 3DBXB 3T3PF 1QSFD 2M26A 1E27A 5IVXB 4W70A 1D6VL 4N0RA 5SV4A 5I71B 4LLAA 2ZCHL 2VDRL 3QIBD 4WNQB 5E95B 4YWGL 1I1FA 5FUCE 3ABZA 5EO9A 1T5WB 4O58L 3HN3A 3DGGB 1GYAA 3A6BH 1G9EA 5JZ7C 4D94A 4GW4A 3MMEB 1RFDH 2JCCB 2EDEA 4OZGE 2NX5E 3AAZA 2Z8RA 4EUPG 2W38A 3W0WA 1U93A 1WF5A 4TOYH 2CIIB 2CKNA 1OHQA 1H0DA 4JZNA 3C60D 1RZ8A 1U8PB 2X10A 4EQ3A 4N0FB 4YXKL 1NC4D 4CW1B 4LSQL 1EMTL 5CJ5A 2ADGA 3FRPG 3HE7B 1I3RB 3LV3B 3O6MH 1SJXA 3QJFA 4QY8B 1MLCB 1NQBA 1S7TB 4N1CA 4NZTL 2R2HB 4WVRA 1S7VB 5F6IC 4POUB 4M6NL 3GMPA 3KPQB 3GJFB 2XWTB 1IZKA 1KJMA 1N0LA 4KUZL 3U0PB 2JJSA 4QRSB 3HUJF 3CFKB 1GVIA 1IFHL 1NGXB 1GGIL 2ZUXA 4H8WL 5C70A 1J18A 2IJ0C 1XEDA 5DJ8A 2FJHA 4HS6A 3ARFD 3PGFH 4J8RB 1KELH 1QNZH 1AFVH 5B22A 3T4AA 4GBXA 4Y5VC 4M48H 4OLVL 4XVSL 3U36B 4XB7A 2VAAA 2AVGA 3UYRH 4X6BB 3P0VH 3WJJA 4JFQA 1L7TH 1AXTL 3CSGA 3FMGH 3PV6B 4MDJB 4NZUL 4YHNB 3C5SB 3LD8C 4WUKH 3TFKC 3L7FB 4KZDH 1YEHL 4KKNA 2LU3A 4JM2D 2E8YA 5EU6B 1MSPA 4NM8H 3SGJA 5F8QC 5INCA 1T80A 4NHCL 3WIIH 4O2EA 1I1YA 1J05B 3MRRA 5E9DA 3W9EA 5MENE 4IDJL 5T1KD 3RI5K 2FYYB 1A6UL 3MLYL 1K85A 1NGYA 3MLZL 3VMOA 3F7VA 4F2MA 3SDAD 5AZEH 1CU4H 3OXRA 3FRUB 4AENA 3DI2B 3SHSA 1KJ2B 5DQDH 1V8HA 5TDPB 2FX9H 2Z31B 4P23B 1YMME 3QEQA 1BHGA 3L3IA 1EAPA 3QUYD 3VXMA 1A9BB 5DJDA 1MI5D 1ZA6A 3OZ9L 3P77B 2VXTH 3FQXA 4YHZL 4NIKB 3U79A 2BK8A 5FEBA 1BZ7A 1KIUA 3CUPB 4XAKE 5DVNA 2NY1B 3IJHA 1KBGH 4IRJB 5IVNA 3L7EB 4X99B 4H0HB 4NC2B 4OLZH 3RIAF 5DLML 3GI8H 2X7LA 1NLDH 4HKXB 1X7QB 4HLJA 4NUJB 2VR9A 3QEHB 3OJVC 5GS1A 1IEBB 4KI1A 1D7FA 3K8MA 2AP2A 5HGHB 2I25N 2ORBH 4F57H 4K8RC 1N4XL 4XI5C 3GIVA 4OLXH 1I8KB 3KPRB 4ZTPL 4J3VA 5I30L 1A6ZA 4KK6C 3MV7A 3S98A 1MIMH 4C55A 1LD9B 3FL7A 3RGVA 1F6AB 5ALCH 3O6FB 2BSED 3DO3A 4E42B 4EUPB 3D2UA 2YSSA 3TH4T 1IM9A 2IADB 1UG9A 3CX5J 3WXWH 5EOTA 5IMOA 3MOAL 4HZLB 2Q6WA 1S9WA 4O51B 1J0ZA 5ITFA 4ZPTA 4HK3N 2MCPL 5GS3A 4M6MH 2GTZA 5FYKL 5TE4H 2E3VA 2XOTA 3AB0B 2VDOH 4KFZC 4H1LA 4Q9QH 1WBXA 3B3IB 3QZWA 4M1CD 2EEBA 5EBGA 3CFBB 3KYKL 5C71A 4L1DA 2VL4A 1S7QB 2P4AB 2QSVA 3D9AL 2YA1A 3E6FA 3L5JA 1FYTE 3VGGA 1V3KA 2NXZC 4P5KB 4TUKH 4RIRA 3SY0B 3O45B 3SO5A 4WCYH 2ZUSA 2A6KB 3TT3L 1WBYA 5JNYA 3FB6A 2A2QT 2GSIA 4NZRL 4WW2C 4Z7QF 3VW3H 3OKYA 3MXWL 4W68A 1Q72L 4ZTOH 2KDGA 1SY6H 1MJJB 1X5XA 4P9MH 4WI3A 2WWKT 3QUMA 1ZMYA 2IMMA 3ME0A 3V6FA 4UT6H 1AKJA 1N8ZB 5F3HA 4ZD3L 1WITA 4LBEB 2KPNA 2QADD 5C0CA 1IC7H 4ZYKA 4HUVA 1YEFL 4JEGB 4JPWL 1P4BL 1X4ZA 1MLBB 4L4VE 5KG9B 2K3TA 4NO3B 2ATPB 3CZFA 1NCBH 2Q8BH 5F97E 4J1UB 1RUAH 4XP9H 1Q0YH 1UZ6F 1AD0A 2R23B 3MRKB 3LHPL 4I9WD 2X4PA 3T1FA 4MCYA 4UBDC 1HXYB 2R0WL 4JFFE 1E4WL 4PB0L 3DYPA 4N5EC 4Z7WE 3BPNC 4CN6A 5L0QC 2GJ6E 4X7TA 4LSTL 5F44A 2A9ML 4MAUH 4Z78A 1HHJB 2VQUA 3T0ED 4XNUH 4M6AA 3DARA 3GMNA 5DMIH 4XHJC 4D2NA 3MJ6A 2AABL 4IOFC 5ACZA 3IFOA 4BELD 4MLSA 4S1QH 2EO1A 1A8JH 4YDIH 2FHCA 3BQUC 3OBAA 5J11B 4H0GA 5JW3H 4DK6A 2BNUB 5D1XB 5DC4B 2BRQA 4JZOB 1I9IL 1UWGL 1BM3H 3RRQA 4L4TB 4OLYL 4JGMA 4HWBA 1QACA 2B1HH 4R90L 4NYLA 2APTA 1RJZB 1LE5A 1S9VA 1FH5H 4I3RL 4IMKC 2P5WA 5CJOH 3V7AG 3PGDA 1JRHI 2FBJH 4P99A 2N7BA 1DQML 1BD2E 1J8HD 3NCFB 3Q48A 2Z93A 3OKNA 1YUHA 4FQIH 4YEFA 2Y5TB 4JG1H 3M8OL 4ORGB 2AW2A 2Z9TA 4YHYB 5KVDH 4X0KB 1PQZA 2EE6A 4DFIA 3CFEB 3RPKA 3GM8A 1JNNL 3B9VA 1UM6L 3R06A 4XBEH 3DUUA 4F7PA 5HVWA 4OAWA 1MWAL 3JUZA 4PRNA 1IGYB 2YWYA 3ZSSA 3VWJC 3EUUA 5EU5B 5AG9A 1FVDA 1TIUA 3TH3T 3ULUD 4PY8J 3HHRB 3KXFD 1T83C 2NNAB 1MCCA 4JDTL 3O2WL 3C6LC 2VLJB 1HHHB 4RFOH 4HMEA 3G6JB 1FV1B 5D7IA 1RZ7H 3QUKB 1T1WA 2KKQA 3CDGB 2WUBL 5I66A 4QRTA 4NCC2 4U33A 3HNVL 2R56H 3MR9B 4U3HA 4XCFH 4CNIB 2JIXD 4JKMA 4NN6B 3QG6A 5KVFH 4X9IA 2DBLH 4ONGL 5CD3A 5BQ7A 5JMRA 2OP4H 3C8HA 4ELKB 4N8PA 1AC6A 5HPMA 4PRHD 2WSKA 2HLFC 3G6DL 4JY6A 4PBWD 1CGYA 5DHVH 2AI0L 5KSAA 4KROD 3C2SA 5K93A 4U2YA 2VKXA 3AU1A 5C0FA 1RULH 5HGDB 4PJDB 5E8EA 2HT2D 5E2VH 4L3CB 3EBAA 5GQBA 2I9TB 1ZKAA 4F33A 1ACYL 1QQDA 4DGIL 3E0GA 1RAMA 5C0DA 3OTTA 5E8NA 1W0WB 5IW6A 3ECBB 3DX8A 3BDBA 2CR3A 2GSGB 1NDGB 5EBLA 2QKIA 3ZE1E 1FL6B 4HH8A 3LN9A 1KUMA 4M8QB 4KY1H 4X4XA 4FP8L 4X6FA 4KK8C 4HS3B 4M4PA 1IT9H 2DKMA 3MROA 4MSWB 4PJFF 4K3GA 1N6VA 2C4FT 1V7MH 5A43C 4V1DA 1VACB 3SOBL 4OI9A 5FA3A 3C09C 3GMMB 2Q3ZA 1NBVL 5JO5B 3K8LA 3ULVE 1BVLB 2OJZH 1IC4L 2QSTA 3MRDA 3BKJH 1O0VA 3F7QA 5FKAA 4J2XA 4PJ9A 1NCUA 2V9TA 2VXSH 3T2NL 4Z76A 5FDYA 3BHBB 3HC4H 4FFVD 2VDLL 1RZFH 2CLZB 3CCHA 4AG4L 3DRQA 4Z95L 3O3AB 3RWFA 1JNHB 5FDWA 1A02N 1ZVHA 2H3NA 5BCAA 2FB4L 4X6CB 3ZL4L 5DMKB 4Q9RL 2CKBA 5BRZA 2NY2B 3G5ZB 3RUGF 7CGTA 5L9DH 3VXSE 1KNOA 1LEIA 1LP9F 3U7YL 1GHFL 3G5YB 4C54A 1KPVA 2AV7B 5TE7L 3LSOB 3PP4L 5BOZG 2V7HB 5JHDA 4Y1AD 2FD6L 1XGPA 5CJQH 1S9XB 1BIIB 4TUOA 4L3ED 3N0PB 4YK4B 2V17H 3V79C 4D9QD 1A7OH 5TQ0L 4K2UL 3PDGA 5ACLA 4C57C 1JK8A 5GJSL 1D5MB 3GSUB 4PRPA 1CF8H 25C8L 3QG7L 4LU5H 3V0WL 4Y8DC 5ADPL 5T5NF 2QHRL 2DQJH 3KS0H 1FDLH 4M1GH 5L2KD 4MNHA 3V4UL 3RIAK 3D3VA 5AWNH 1F00I 3TPUB 1JYXA 3BXNB 3ZLQC 1GSMA 4K94L 5HGAA 4JFDA 2VERN 5GRJL 5EWIH 1HEZB 4IEFB 2ADJA 4Y4HB 4RFNB 1DL7L 2OQJB 4I18C 4AMKL 1HQ4B 3I85A 2EH8L 2QQLL 3O2VL 3OMZA 3QNYA 2V6HA 4RGND 3WUWG 2Q76A 4PJHA 4J7RA 4LASH 4BH8A 4OGYH 3P9MB 3S9DB 4HS8L 1HIMH 4WTWA 3PQYA 5I8CA 2EDWA 4OKDA 2UZXB 4S1SL 4NQEB 3SJVD 5CJ8A 4WO4B 4CVZA 1CK0H 3VXQB 4J3UA 1A3LH 3OXSA 2BDNH 4L8BB 1JTTA 5E2TL 5HGBA 4IHOA 4NWUL 1OGAA 3TJHD 4NO2A 1NAMA 3QP3A 4JZJA 1NCTA 2MHAB 4XXDA 5CLTA 1NFDA 1S7SB 1GIGL 2YS4A 5ITBL 5HYJA 1CFQA 4KJWC 4N90E 4HC1H 1CZ8H 5EU3A 4YQXL 4QGYA 1BZ9B 3R4DA 3L5WB 3EFDL 7FABH 1FAIH 1ZLSH 2UZYB 3LQAH 5LVEA 2Q87A 5CHNB 2VUOA 1RHHB 4OF6A 3PE9A 4OIIH 4C83A 1NSNH 3DXAE 3HE6D 3WFZA 4FQXC 2C3GA 2OZ4A 3MUJA 5KVGH 1C7SA 1F3JA 5C09A 4PG9A 2R9HC 5DUPH 3ZZ1A 3PNWA 5CBEB 4S1DC 4LSVH 5BZDA 5DJZB 2CLVA 1ZK9A 2A83B 3UTQA 1NDMB 3NN8A 2J12B 4FOMA 1TXKA 4EXKA 4UU9B 3DWTA 3SDDA 2BVQA 1CQKA 3KNBB 4ODBD 3MLVL 1NMBH 2MQCA 4RGNE 3FOLA 1G1YA 3NGBC 4DAGH 3PV7A 5MEQB 5E8OA 4L8CA 1J0HA 2G75A 4FQCH 1XR9A 4BZYA 4ONOA 2NZ9D 3RVVC 4Y4FA 2GTWB 4CADA 1ZHNB 4KQ4L 4KHTL 1TQCB 3RKPA 1D3CA 4OFVA 3HKFA 3TT1H 2AV1B 5HHOD 3C8KB 4PD4J 1SYVA 4P2OD 4GLRI 3JTTB 1KIPA 3MJ9A 4PD4K 5C0BE 3B8SA 2VZSA 4ZFGL 3OAZH 4RFEB 1O5DT 1ITBB 3K8KA 5SWZE 2AQ3A 3LPFA 5I71C 1KFAH 5D7LE 5C7XL 3NAAL 5C0RH 5EUKA 5JIHA 4OTXL 4L5FL 1AH1A 1JL8A 5E8DH 1H8OA 1MRFL 5DXWA 2EDBA 1J0JA 1N59B 2R0KL 5TF1L 1BP3B 3MLRH 4JO1H 2DDQH 2ERJB 4MXVE 2QBWA 5AD0B 3H9SE 3MLSL 5DEZA 5CIPB 3VFMA 2ICWB 1FVCB 1I85A 1MFNA 3QWRA 1I8LA 3U82B 1M7DB 1TJGL 1X5AA 2FIKB 3P3YA 3HE7C 2H41A 3KWWA 4HIEB 5IT2L 4MMXC 2JJVA 1P4IH 1ZLUH 5C0AB 4LHJB 1DUZB 4PS4H 5D7IF 3UTTE 4C56D 5D70L 5ISZE 3OKEB 2G5RA 4U6VH 3T4YA 3QFDA 4BSVA 4IOIB 3MCLL 2O5ZH 1T3FA 1NC2A 2WBJB 4WENB 2AK4D 4HHAB 2FH6A 2VXQH 3LKSA 5GSRB 3WUWB 4E0RB 1A6AB 2ESVA 2JKXA 2VDNL 4Z7NE 5C8JA 1RZKL 3SDYH 1MHPH 4WU7B 3RQ3A 4XPBL 4YUEH 5CCKL 4AK1A 3V5KA 5HHXL 3X11A 4CVXB 3ESUF 4RGMB 2MTPA 5HI4D 4ZQKB 4KUCD 1HQRB 4I48B 4XVTH 2D7NA 1VFAB 4M5YL 1HH6B 5I0DA 1D6EB 1TJHH 1J5OL 1S7RA 3M17B 4W81A 1YEEH 1QSZA 4YHMH 1PVHA 4ZMAT 2Z8WC 2CDFB 5D72L 3HG1A 4JO3L 5D2LF 3FHQA 1F45A 1T1YA 4YAQB 3LH2L 1OAZH 1CICB 3HRZA 2X4QA 4AIXA 1V7NL 4OUUA 1FGNH 4TTDC 1CE1L 5EZOL 5F1OB 4ALAL 1G7IA 5MEOA 1D6VH 5F3BB 1QRND 2IMNA 1XF3B 4NRXB 2ZCHH 3KPOA 3VXUD 5E99L 2A74A 2J8UF 2Z31C 4P23C 3QYCA 4O58H 2XWJA 1CDCA 4HDIA 4TQEL 5KAQG 2DICA 1X6LA 2MKLC 1SJVA 2FECL 5DJ0A 1XH3B 3QO1A 3AMLA 5K59E 3O0RL 5HHMB 3VD3A 3D25A 1QEWA 4HGKC 2NY1C 3VU2A 1FZOA 2W60B 4ZG1A 1UA6L 1OCWL 5D1QA 4MA3B 4XPHH 4ODVH 2G9HA 1M71A 5A1AA 2NY4D 1R3LB 1U3HB 1E6JH 1ZT4B 3EO0A 1AGCB 1OY3B 3UBXI 2MQ0A 3V0VA 1AGDA 4ZUUB 3MUGB 4KUZH 4ZODA 3SO3B 4NHUB 3Q5OA 5DMJB 4LEXH 4A2MA 1IFHH 3D39B 1GGIH 4U0RB 3RWCB 4QF1A 1MCKA 1OTTD 3MRPB 5EA0L 3BZ4A 4ZFZB 4ETQB 4P2YA 1U8KA 1FL5A 3K4ZA 3KPPA 4QRRA 4BQBA 5CGMA 2ARJQ 4JANB 4YBQC 1HKLL 4PJ7B 1YPZE 4RBPK 2D31B 4OLVH 5ICZB 2CDGA 3HNTL 3O6FC 1A14L 5B39A 4LFHD 1AHWB 5GGVL 3WHXA 3RPIB 4NZUH 4NZJA 2XN9E 4G6KL 4R4BB 4HT1L 1WCBB 5MHSE 1YEHH 2X4SB 3IDYB 1FFNA 3WJLA 2ICEB 3QRGH 2G5BA 1A7PH 4PLNC 2Y5EA 4NHCH 1VENA 3ARSA 4LSUL 3IU4H 4OFPA 5FUZH 3AB0C 3O3EB 1KIQA 4MJID 1I1FB 3O9WD 5EO9B 1A6UH 3KR3L 3QUML 4P5MA 1YEKH 4GW4B 3ROOA 3QXDB 1FP5A 5ICXA 3BSZL 2V2XB 2VIRB 5E7FA 3W0WB 3UEZA 2RQ8A 4L3AA 5EU4A 5J1SC 2LVEA 3SE8L 1QSFA 3L3KA 4JZNB 3IRZA 1RZ8B 1T5XA 4LLUA 4P4KD 1TQBB 1OP3K 3QIBA 2ADGB 5A2LH 4MQXD 3QJFB 5BW7C 3OZ9H 4M93B 1TFHA 1VFMA 4WWKD 3BUYA 2GI7A 3GMPB 2XTLA 2VLRE 4O4YL 4FA8A 1KJMB 2HKHH 4JVWA 5DR5L 3C60A 5L7XL 3D87B 5FFLA 5A2JH 1NC4A 5DJ8B 4TSBL 4HS6B 2OCFD 2K9UA 1I1CA 4GBXB 1YMMA 2BY1A 3HI6L 2DQHL 1MHEB 2VAAB 4ZUWB 1YEGL 4UQ2A 5DS8A 2V5RA 4JO4L 3VFOB 2P24A 1JF5A 4WFEE 5I30H 4HWBL 5SX5K 2ADIB 3ARFA 4HUXA 5ILTH 4OQTA 1BEYH 2DWDA 2JELL 1JN6A 5INCB 4Z7OE 1LQSR 1I1YB 3MRRB 3T0XA 3GBML 3LQMA 3W9EB 5L2JA 4YLQT 2R29H 5MEPA 1HNFA 4LRNL 2LQRA 2IFFL 4OZFG 4Z9KB 3RZCC 4EOWL 5J11C 2W91A 5D1XC 3OXRB 1AIFA 4F80A 4AENB 2VLLB 3LOWA 1A7RL 4ACPA 3H9YA 4OM0L 3HMWL 5T3XD 3PWPD 3U0WH 3QEQB 5B8CA 1INEL 3GO1L 2P8MB 5JXAL 4G6FD 5T1KA 3VA6A 3VXMB 1DLFL 2AXFA 1MELA 2Y6SD 1ZA6B 2CRZA 1OTSC 2FZ3A 5C0JB 5GRUL 3D9AH 2HTLC 4UTBH 5I1HL 4FZEH 4P0DA 1HYSD 2P7TA 4UV7L 3GKZA 1CTNA 3IJHB 4YZFF 4YHYC 3QISA 1Q9WB 3MREB 1K4CA 1BQLH 5K9JH 2EXWD 4RZCA 4M03A 1CXIA 1NL0L 1WWWX 2VO5A 3C9NA 3G5XB 1MI5A 4KV5E 4ZO9A 1BOGA 2A73B 3CMOL 4LQFL 3UO1L 4LVNB 1AJ7H 3EFFA 4Z7VB 4NOBA 5HDQH 1EH9A 1JYNA 3C2AL 4X6CF 2DI9A 1N7ML 1L7IL 1N26A 4PGEA 3JV5A 2XNAB 2QSCH 3GIVB 4JPWH 1AI1L 2IFGA 3QUXD 4TPRH 4PRBA 2VOTA 4OD1L 4R4FL 3MLWL 5GGQH 2NY6D 4ZUSA 2AS5M 3RGVB 2IPKA 4HAGA 3W11C 1WGOA 1U6AH 2YSSB 3BI9X 4NN6C 4DEPC 5F7MC 3SQOL 1E4WH 5IMOB 4YHIB 3S96A 1KYOK 5DURB 4U7MA 5KN5A 2Q6WB 1S9WB 3SE4C 1KJ3L 5MP6H 1A3QA 4MNQE 1CD1B 2YD8A 4P57A 1BJMA 1MCBA 1R3KA 5ITFB 3VFPA 5E2UL 1T2QL 3IGAA 1HOCB 2WWMD 3GSQA 3MA7A 3LB6C 1OARH 5DQJA 1DVFB 4S11A 1WBXB 3BP6B 1PYWA 4L4VA 2PF6A 2F53D 4LLVA 3EIFA 4XVUC 1U9KA 5DRZA 1I7TA 3BUTA 1I9IH 3E6FB 1TJIH 4ZS6D 3TGXA 3L5IA 3OAYK 1CLCA 4OZ4A 5LGJA 4LHUA 4AQOA 2RCSH 4RIRB 1XR8A 4TSAL 2B4CC 2CLRA 4LSRL 4Z7WA 2FJGA 3HAEA 5JNYB 1A6WL 2GJ6A 4PRID 4ODXB 5IJKC 1LO2L 3WKMH 1WFUA 1FVEA 2RFXA 1MH5B 2PCPA 4LKXA 5GISL 5FV2A 3M8OH 2NYYD 1FL3B 1XGTA 1GC1L 1EV2E 3UDWA 1U2CA 3ALXA 4OIBA 5MERA 2Y06L 3EOBB 4ZYKB 4HUVB 4JM4H 3WFBH 2MPAH 2EDTA 4R7NA 4Z7UE 1RK0A 1MWAH 3MV9B 5EUOE 3T0DA 4OZFB 3CZFB 4OZGF 5GS0D 3STLA 1U8OA 2GJJA 4WUUD 2VUYA 1DQQA 5I16A 1AD0B 2XG5A 4K8RH 1YNTA 4KVCL 5D1ZD 1IE5A 2EIZA 3T1FB 4MCYB 4S1RL 5EBMA 3FCTA 3KYOB 1A1NA 4MCZA 5D2NA 5HDBE 4WTZA 5AAMA 2HJFA 3I6GA 2X4OB 4X7TB 4R4ND 3EJJX 1MRDH 2W0LA 4H5SA 4JQXA 4YK4C 1ROWA 2GAZB 5F7LB 3QQ3A 4MNGB 3GMNB 3MYZA 3KPTA 2I24N 4KK5D 3TO4D 5JIKA 3HCVA 3IFOB 2AEQH 5FUOL 2DMBA 4W4NA 5GZOC 5I1LA 1DANU 3G6DH 1ZOXA 4UB0H 3H9ZA 5FYLE 4UTAL 4PP2B 4JG0H 2I5YL 2DB8A 4QOKD 5I19L 2H2SC 4WWID 5LGKA 2Z35A 4I77L 5EPMA 1WCQA 1LVEA 2F58L 1UJ3A 3FQWB 4NYLB 3TESA 3PL6B 2CPCA 1MIEL 1ACYH 4DGIH 1BBDH 4RFNC 4Y4HC 4PTTB 4AEIL 1NAML 2P5WB 3VMNA 1OWRM 3PGDB 3KPNA 2D4DA 1TNNA 3DURB 1P7KA 3E1F1 5IM7A 3RTQA 1IL1A 2NR6C 2OSLB 1ORQB 2Z93B 3OKNB 1YUHB 1FE8H 3PJSA 3U46B 2CJUH 3IAQA 4JFZL 2AJZA 5JHLH 4WO4C 1PQZB 3GFUA 1CXFA 4H20L 1NBVH 3MTRA 3NH7L 3QQ9C 2D9QB 3DUUB 4F7PB 5JW4M 4OAWB 4PRNB 2VJXA 5SWZB 3JXAA 3NACL 1J8HA 4X7SL 4KC3B 2FX8H 1HZHL 4HH9A 3WFEH 4LRIA 4KQ3H 1SJEA 4AG4H 4YXHL 4UILL 3ZTJG 3G08A 4R26H 4LLDA 1G7HB 2FLRT 1CR9H 3H3KA 4L8SA 3ZL4H 4JFEB 4OKVA 4QRTB 5D4QA 5JOFA 3E8UH 1JJUA 2PR4L 4K71B 5IK3B 4CU8A 3H9SB 1VHPA 1GOHA 1T89C 2GK0A 3QG6B 4LF3A 4MA8L 1CLOL 2P45B 4KJPC 3HZKA 1LK2B 5BQ7B 3PP4H 4GG8A 1YJDC 2Q8AL 3KXFA 1L0QA 5F7UA 5KSAB 5DYOB 1M7IA 4PBVC 4XCNB 2IBGA 4M7JL 3AU1B 1GGYA 2ZPKL 4GKNA 2QHLA 5E8EB 1X5LA 4I4WA 5TQ0H 3MJ9L 2H8PB 3ARBD 4PJIE 4JFPB 3MRGA 2JIXA 5GJSH 4ERSH 1K5NA 4JJ5A 4KMTL 5C0DB 3S3JA 25C8H 1OPGL 5E8NB 3U7WH 3DO7B 4PJBE 2QHRH 1MCDA 3HR6A 5F7DA 5EBLB 5J4MA 1S7WA 4PRHA 5ANMA 3QXUA 5BVPL 4KMLB 3HLAA 4X4XB 1R0AH 3MROB 4U1IB 3NTCL 4RGOH 4AMKH 1WIUA 4V1DB 2V5MA 2EH8H 3O2VH 3C5ZD 5KANG 4AY0A 1FAKT 4M9PA 4UZGA 5FA3B 4ISVB 1S9KC 4MD4A 3MRDB 1W72H 2NZIA 3DV6B 3BD5A 4MJ5A 1XF1A 1FIGL 3UPCA 1FO0B 4OSUL 3PWUA 5DJ2B 2D0GA 5I15L 3SCMD 1U42A 1Z9MA 4R0LA 1FGVL 4S1SH 4GW1A 3ZDZE 4F9LA 5CZVL 5LQBL 2BMKA 5DZOA 1IKNA 3CCHB 3SDCD 3DRQB 3JTSA 2ERJC 4K23H 3OKLB 3IETA 1J7VR 1R3JB 2E27H 1ZANH 5E2TH 3RWFB 3LPWA 5J3HD 4JRXB 5FDWB 5CWSA 2H3NB 4NP4L 1CVSC 3MRFA 2CKBB 3GSWB 4HJGA 4CMHC 1SJHA 3ZYIA 5BRZB 1JBJA 4M7LL 1KNOB 3MJ8A 3VFRA 4XPTL 2DQFA 3VD9A 3OR6B 2C9AA 1X5FA 3BIAX 1UCBL 4P3CL 4PUBH 5E2WL 2D7QA 3QIWD 5D71H 1KPVB 4XPGH 4YQXH 1S7XB 1CDIA 4OCWH 5FO8A 5JHDB 3QA3A 1VFBB 3GK8H 3EFDH 2WBJC 4KGJA 4FTVE 1RUPL 5ICYA 5DMGC 5KS9A 5TDOB 4X5XA 5I8EA 2O5YH 1VPOH 1R5VA 1JK8B 3MX0A 3BP4B 4ZO6A 1F4XL 3O2DH 1AXSA 3WKNA 4Y1AA 5JDSA 4RGMC 4G80B 1H3WM 3MCKB 5HDOA 1NCDL 5IWLA 4YHKL 2E7HA 1L6XA 5E56A 3TZVD 3WFHA 5HGAB 4JFDB 5T3ZE 3WE6B 1RURH 4RMRA 5DUBB 1J1OL 4NKIL 4XNYL 4KKAC 3QNYB 5EO0B 4F37F 2XWBA 2Q76B 4FQ2H 1S5HA 4PJHB 1FJ1B 2AXHA 2KZWA 2I60H 4PFEA 2EC9T 3IFPB 2QQQA 4P2QE 5L2KA 1CVRA 4Z7WF 3I9GH 1YNLH 3PQYB 5I8CB 3NIFE 3PUCA 3WLBA 2VLKE 3TH2T 4CVZB 2BNQE 5HI3C 2KL6A 2XI9A 2OBGA 3GSVA 5HGBB 4HIHA 1A3RH 3QCVL 5C7XH 1EHNA 5I9QB 5HPOA 3F5WA 4NO2B 1NAMB 4HKBA 3CFCL 2V2WA 3MBEB 4OTXH 4JZJB 3T2OA 1XIWA 4DVBA 4XXDB 1Z6JT 2R0KH 1NFDB 5TF1H 4XXCA 4Y7MA 3BMVA 5HYJB 3HR5A 3SJVA 1CFQB 3N1FC 3I3DA 4RAUB 1DSFH 3HFML 4X80H 4QGTA 3LKNA 4OM1H 4QHKJ 4RCAA 3R8QA 3LN5A 2R4RH 1TJGH 3KGRA 5C0BA 4GG6E 4QXUL 4G8FA 1U3HC 2GCYA 1F3JB 5DJAA 5IW1A 1G9NC 1D5BA 3F62A 3SO3C 2CLVB 4K07A 3UTQB 3L3HA 2PTTB 3NN8B 4RRPA 4U0RC 3IDMA 1G0YR 3SDDB 2BVQB 1KC5L 1BFVH 3O8XB 1MJUH 4HGWA 1K8DA 3AGVA 3FOLB 2OR8A 1RZKH 2WK2A 1EZVY 1OTUC 3HE6A 1LO4L 5CCKH 4FQQA 3Q1SH 5E8OB 4L8CB 2G75B 1XR9B 1RY7B 2NY7H 4NJAL 4TSCL 3QQNA 4QKXB 4X8JB 4L9LA 4Y4FB 4CADB 1NBYB 5EBWB 1AHWC 1T4KA 3VFWB 5ELIA 3UTTA 5KAQF 2NW2A 3LEYL 2DD8H 4XX1G 1SYVB 1J5OH 3WFDH 3IDYC 1KB5L 1KIPB 2LVCA 2O5XL 1IC5H 3CIQA 5BO1H 1FFOA 1TZGL 4G3YL 5D72H 4X83A 4F7EB 5FM5M 3MRBA 3VWKD 1HH9A 1JGDB 5EUKB 3LH2H 4LCCA 1HWHB 5DJYA 3D5OF 5HY9A 1V7NH 4OCYL 1FNEB 1MCQA 3RVXC 4GOSA 2VH5L 1CE1H 4JR9L 5IHUL 4RAVB 4WEBL 4XB8A 4V2BA 5HHOA 3ROLB 3AS2A 4MA1B 5B39G 4BFEA 1MVUA 3MUY1 4P2OA 4WGVB 4WI5A 3VFSA 1UWEL 1KV3A 3N85L 5IGXL 5LXGH 3H8NA 1CT8B 5E99H 2KQMA 4AH2A 5FKPB 1TQBC 1MVFA 1IGML 2XYCA 3ZTNH 4LPWA 5F9OL 3GHBL 3KWWB 3NABH 3ZE1F 1IAIL 4M93C 3RL2A 5HI5C 1UYWL 3H3PL 4K3JH 2CXKA 1OF2A 4RISL 3WS6C 2DYPD 2FCBA 2WWKO 4MA7H 4B0MM 5IBTL 4NBZB 5CP3H 4BSVB 5KVEH 3H0TB 1A6VH 3QQ4A 1NC2B 2JJSC 3UZQA 1FNAA 4KI5E 1DJSA 3ARVA 1PKQE 1IVLA 3KPLA 3CU1A 3LKSB 2X4TB 4RAHA 2YOCA 4XP6H 4YHPB 1KXVC 4OQTL 3ULVF 3RAJL 5C8JB 2BJMH 1IQWL 2WM0A 2X5PA 2XICA 1F11A 1XGQB 3HPLA 2BFVL 4WHYG 4GBXC 3V5KB 3V6OE 3T0AA 4C56A 5IV2A 1U8QA 2GY7B 1A7QL 4PLKD 2AK4A 3HMXH 1UACL 1MJ7L 4OF7A 4Q9BA 4OZIE 1DTUA 3W9DA 1CL7I 5B38A 1ZT1A 3S6CA 2E9WA 1MRCH 3SGJC 3PF2A 1JP5A 3HNTH 5GGVH 1T1YB 1PLGL 1UM5L 4DOHE 3INUH 4MDIA 3QI9C 5BS0D 2E8ZA 2X4QB 2MJWA 3QT2A 4G6KH 2R69L 4HT1H 4D3CL 1QKZH 1YY9C 4ZNEA 2ZUUA 5DJ6A 1WLHA 4KPHL 2PO6B 2XTJB 5ALBL 1G7LA 4FXGA 5HVHB 1IGTB 3GKWL 4G9FB 1S7UB 4TN9A 2V2TA 1K6QL 3KPOB 1OGTA 5E5RB 3GUTA 1SY6A 1X9QA 2AEPH 3BKMH 5F1IA 2WNGA 2NQCA 4NQDD 2F5BH 4HDIB 4WHDA 4KRNA 4K8RD 4NCDA 4MVBD 1C12A 1OAQH 5DJ0B 3D6GA 3QO1B 4OCNC 2HFGL 3UMTA 4ZXBC 3SE9L 4ZOCA 1FG2A 4YR6A 4P3DA 1QRNA 1JPFA 1QEWB 3QXAA 3SKMA 4WJ5A 1OAKL 5FYJE 5E1HB 1TZIB 3VXUA 5SX4I 1D5IL 5D1QB 4HJJH 3RBGA 3RWEA 2OM5A 5JUEL 1M71B 4GW5A 4MQ7B 4U1JA 4ELME 4PLJD 1CQYA 3EO0B 3FO1B 4M7KH 4KXZH 1QFWL 3V0VB 4LVNC 3P9WB 1MHHA 5DR5H 3VGEA 2HVJB 1RUQH 3HC3H 4HKJB 2J4WH 1A7NL 1XCQA 1QUNA 5F7KC 5C2BL 5F72S 1U8KB 1FL5B 4IRSD 4ODSL 4QRRB 4XNZB 4PJEE 4BUGA 1CXKA 1S78D 1BBJA 1ZTXL 3RDTD 2HA1A 2NXZD 3RGVC 2CDGB 2IPTL 1MCPH 1QA9B 1R5IB 2UWEE 5B39B 2FR4B 1UCTA 1MAML 3B5HA 4XZUA 3IJYA 1JZ7A 1INQB 3MUZ1 4EN3B 1DFBH 3T8XB 2G5BB 1FN4B 4HFWB 5MI0C 3CFJA 2PETA 3BAEL 1LK3L 5BOPA 1HK6A 1QD0A 2Y4SA 1YNKH 4RNRB 1VB9A 1DVFC 3BH8A 4P5MB 3O4LE 3ROOB 1XT5A 4PJAA 4PV8A 3WIHH 3JUYA 5ICXB 1FLRL 1MFDL 5EORL 3UTSE 3FT2A 5GPRA 1PJ9A 2VISA 4WHTB 4L29A 1QSFB 1RU9H 4E9LA 4OM0H 4BZ1L 4ZUVA 4J6RH 5GS2H 1K8IA 1JVKA 4HX1A 1T5XB 2UUDK 4CVUA 2JB6A 5JW4Q 3FN0L 4NC0B 4XP5H 3LIZH 2R8SH 1JMZA 3QIBB 3O9WA 4UBDD 2BOCA 5GRUH 3LS5H 4N5ED 1KCRH 4XVJH 4ZDHB 3BUYB 1Q0XL 3WXVH 1YY8A 3C8DA 4RQQA 5B3NA 1CGWA 1G9MC 4YX2L 3ILPA 3O6LL 1JHKL 1XCTA 1ULVA 2P44B 4YBHA 4XWGL 5KSVA 4F37K 3GMLA 4XHJD 3C60B 4U1LA 4IOFD 4CGTA 1M05A 4NUGL 4P4KA 4P9HH 3QDHA 1NC4B 4LLWA 3P4NA 1H5BC 2EIDA 1A47A 1NL0H 2RGSA 3UO1H 3CMOH 4LQFH 4DCQB 4M6OH 3GBLA 5DD1L 4WWKA 2APXA 2FHBA 4MXVF 4UQ2B 5DHVA 4HXAL 5F9JA 1L7IH 3WHE0 4DK3A 2P24B 3BWUC 3KYNA 1IBGL 1E4XL 3I6LE 1LWRA 3NIDE 4MJ6B 4QXWA 1AI1H 3U0TA 3UPRA 1W8OA 2X70A 4BJLA 1EEUA 2Z91A 3ARFB 4HUXB 3MLWH 2DWDB 1JN6B 3RIFF 3SDXA 2BSTB 4EUPH 3QO0A 5CEZE 2ZWLT 5JW4N 4NN5C 5L2JB 5EZLA 3TN0B 2MOVA 5MEPB 3F7PC 1I3UA 4B7LA 2NTFA 1WWBX 1KJ3H 2IF7A 2DQGH 5E8PA 2B20A 3SGEI 2OR9H 2D7PA 4M9OA 5E2UH 4ZFOL 2F54E 4JM2B 4UT9H 4XMKL 3WN5B 2OTWA 3MRHA 2XRAH 1WBZA 3BIBX 4Z7NF 4DJMA 2YPVH 1XGRA 5LGHL 3PL6C 5B8CB 2A1WH 1DBMH 2Z8SA 2H9GA 3QH3A 5EOQH 1QHOA 2FZ3B 1F5WA 3QPQD 3SDAB 1JTPA 3DJ9A 1J8KA 4JRYD 3BE1L 2M8XA 4PJBB 1IC1A 1Z9LA 3EGSA 2D03H 3OL2A 1KLUA 3QCTL 3GBNL 2YBRA 3FFCD 1A6WH 4N5UA 4ODTH 3PWPA 3TIDA 4BQ9A 1ZGLP 3BEVA 2L7JA 1UT9A 4QNPE 3W82A 4RZCB 3HPJA 3QUYB 2IGFL 3C9NB 3U1SL 2HLFD 2ITDA 3BVNA 1BOGB 4OLEA 3ULVL 2DM4A 3DVGA 2IANE 1NEZA 4XPAH 2WANA 5JQ6L 1F90H 4WFFD 5B3JF 1BVKB 3MRCA 5C6TH 1NCAL 2ZOKA 3ZKNC 5DFWH 4LARH 4NOFA 4CU6A 4PRBB 3UAJC 1UM4L 4WFGD 4APQB 4JHAL 1MCJA 4QT5B 4GMTL 2CMRH 4ZUSB 3GSOA 3OPZL 2IPKB 2Q20A 4K71C 1WAAA 2N4IA 3LY6A 5K59F 3IXAA 1J87A 5GRWA 4LGSB 3S96B 5HYFA 4KVNL 5KN5B 3I6KA 4JFHE 1PD6A 2YKLH 5HYEA 2EDKA 4P57B 1R3KB 3QUXA 5F8RC 3VFPB 1RUKL 3UC0H 5KOVC 4KKLC 3GSQB 4MJ4A 2C7UA 1N64L 3MA7B 3OX8A 2GQHA 4PY7B 5FUOH 1N2RA 2DIAA 1PYWB 4NQSA 4R8WH 1P1ZA 3KPSD 1Y6KR 3IDUA 4PGZA 5EUOA 2FO4A 3GNMH 1I7TB 3LKQA 5DRZB 3HNSL 4P2RE 1C16A 2EECA 4HKZA 4QWWC 4I77H 4E5XA 4OZ4B 5FXCH 5LGJB 1XR8B 4LCUB 2FJGB 5DGQA 4JQVA 4UDTB 4AIZA 1YPZF 3S3PA 2EDHA 4UI2A 5I8KH 2F53A 3A67H 5KANI 1E4KC 1FVEB 2RFXB 4GAYA 2UZIL 3VG9B 2PCPB 3CH1A 4LKXB 4DN4L 1C1EH 3W39A 3TP4A 2R4SH 4LCYA 2NW3A 3QCUH 3W2DH 5CEYA 1BFOA 3BISA 2EXYD 4HC1A 4JFZH 2VQTA 3E6HA 3IFLL 5GXBB 3LZFL 3BESR 4Y2OA 3K46A 2BHZA 1AE6H 4C4KT 4K7PH 3H42H 3ORJA 4PRIA 3BEWA 4TNWF 1CGUA 5MERB 5TPWL