2GSPA

Ribonuclease t1/2',3'-cgps and 3'-gmp, 2 days
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Hydrolysis of a slow cyclic thiophosphate substrate of RNase T1 analyzed by time-resolved crystallography.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endoribonuclease
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2gspA00
3BU4A 1B2UA 1RGAA 1BNEA 1B3SA 1RGEA 1JBSA 1GOVA 3D4AA 7RNTA 2F56A 1LRAA 1T2IA 1I0XA 1MGWA 3GSPA 1MGRA 4HAAA 1GMPA 1X1XA 3HOHA 2KF4A 2RBIA 3AHWA 3DGYA 4RNTA 1B27A 1BRIA 2KF5A 2RNTA 3RNTA 1BSAA 9RNTA 4GSPA 3WHOA 1IYYA 1BNSA 5GSPA 1JBRA 1A2PA 1G02A 1BOXA 1R4YA 5BIRA 5HOHA 1RMSA 2ZA4A 1BSDA 3KCHA 1RGHA 4BU4A 1RN4A 1X1YA 3DH2A 1BNGA 1I70A 1BNRA 3D5IA 1I2FA 1BRSA 1B2XA 1UCKA 4HOHA 1SARA 1BNIA 1B2MA 1YGWA 2C4BA 1GMRA 2KAAA 1LOYA 1ZGXA 1FW7A 1BRGA 1RDSA 5RNTA 2AAEA 1BU4A 1AQZA 2KF3A 1TRPA 1BSEA 3AGNA 1RN1A 4J5KA 7GSPA 1RGFA 3URPA 1BGSA 1Q9EA 1BANA 6RNTA 1I8VA 1I0VA 1RHLA 1C54A 1LOWA 3AHSA 1RGCA 8RNTA 1RCLA 1CH0A 1YNVX 3WR2A 2HOHA 1LNIA 1GMQA 1BNJA 1RGKA 3SYUA 1TTOA 1X1UA 1FUTA 1GOYA 1B2SA 1BRKA 1RGLA 1RLSA 2F5MA 1B21A 1FUSA 1B20A 2BU4A 3BIRA 1RSNA 1LOVA 2SARA 4GHOA 1GSPA 1BNFA 1HZ1A 1I2GA 1UCLA 1UCIA 1BRNL 1RCKA 3A5EA 1I3FA 4J5GA 1GOUA 2AADA 1BVIA 1BIRA 1DETA 1PY3A 4BIRA 3AGOA 1RGGA 2KF6A 1JBTA 1BSCA 1RTUA 1I3IA 2F5WA 1AY7A 1BAOA 1HYFA 1PYLA 2F4YA 2GSPA 1FZUA 1UCJA 1BSBA 1I2EA 2BIRA 1BRJA 1BUJA 1RNTA 1B2ZA 6GSPA 1RNBA 5BU4A 3Q3FA 1T2HA 1TRQA 3D5GA 1YVSA 1DE3A 1X1WA 1FYSA 1BRHA
chains in the Genus database with same CATH superfamily
4LZIA 1B2UA 1CQSA 2PZVA 3V99A 3I0YA 5I97A 1BNEA 1HU9A 2WOFA 4H3UA 1B3SA 1RGEA 4K61A 4KVHA 4BTXA 3X3ZA 1QJGA 4LSOA 1JBSA 4ILFA 3RGAA 5IEOA 3N8BA 1I0XA 5CF2A 3MSOA 1W01A 3TDGA 1AVLA 2R41A 1GMPA 1T3BA 5AIFA 3VGNA 3WODG 3EC9A 3V92A 3HX8A 5CK6A 4AKZA 4PEJA 1IVXA 4FCMA 2YFLB 4KZ1A 3J7Yd 3CC73 3G0KA 4FMAA 1BRIA 2RNTA 3RNTA 1IT7A 9RNTA 1OF5A 2BMRB 3STDA 1JRQA 3FZWA 4WYKB 4WFOA 1IVVA 4O3VA 3I553 1JZOA 3WOEB 1JKGA 3F7XA 5GSPA 2CFDA 3T0UA 5EVHA 1FUWA 1BOXA 3KIIA 5HOHA 4J9AA 3T8UA 1Z1SA 1UDII 3DUKA 5HGRA 2RCDA 2F99A 2Z6BA 3K5TA 3NM7A 2OQEA 3RGRA 4IPBA 1U8CB 1E97A 2WOHA 5JPUA 1MOLA 2JQ5A 1N9EA 4BU4A 1X1YA 3F9SA 1BNGA 1WMPA 3D5IA 3QK9A 4CDLA 1UCKA 5STDA 3DY5A 4GB5A 1VQO3 1N8R4 2H0IA 2HMOB 1B2MA 2F98A 1DMQA 3LYGA 1CYUA 2KAAA 1Q864 1GD3A 1IQ8A 5M19A 4K90B 4JRFA 2KCDA 1VZZA 2E2UA 5IG4A 3DXOA 1NO3A 3KSPA 1G96A 4OVMA 4J5KA 3LXUX 1O7GB 7GSPA 3G713 3CPW2 3URPA 5CF1A 5IG0A 5IERA 1BGSA 1UGHI 3NXJA 4HM7B 4KFFA 1L5GB 3X41A 3N9HA 1RKYA 1A67A 3LTBA 1AV4A 3X3YA 2CH9A 3SOAA 3FF2A 1TU5A 2E2VA 8RNTA 1JB5A 3Q1CA 1JV2B 3LMLA 1D6ZA 3NQYA 4BTYA 1JN5B 1ISKA 1TP6A 4DKIA 2D1WA 1B21A 2OOVA 3VF1A 1FUSA 3HZPA 1LQGC 3HI7A 1N8QA 4EC6A 4O8SA 3MG3A 2Q07A 3CU3A 4HM0B 2O3OA 1LQMB 4FMBA 3KKGA 1PFPA 4GHOA 3IPTA 3LT8A 3H51A 4R9LA 4EYCA 1BNFA 2V1LA 4XBXA 2BT3A 1AVKA 2L1SA 4J5GA 1YGEA 3EJVA 1FGOA 1W6YA 3M8CA 1BIRA 1CYVA 1UGIA 3N54B 5IENA 1FGRA 1MWTA 1O7MB 1O7HB 1RGGA 2OTL3 4L8PA 1Q814 1RTUA 3U97A 5IF6A 1PYLA 1Q40B 1RRLA 2BMQB 4HM4B 5KP4A 1NJI4 2K54A 2F4YA 3S5CA 2GSPA 3PXMA 3NBJA 1FZUA 1NWWA 3EF8A 5TGNA 1JB4A 3NX0A 3SVAA 1M9GA 3EN8A 6GSPA 1RNBA 2CKFB 2GXFA 2XGLA 4FR9A 4MMYB 1TRQA 3NQZA 4R9KA 1M1K4 1EG9B 1DE3A 3BU4A 2CX0A 4HM3B 3S67A 1S723 3F8HA 1RGAA 4R1KA 1ZS7A 2W6JH 5ELUA 1VQ43 2CFLA 3PYJA 1OGXA 5AYRB 2HMLB 1VQ83 4HM5B 3JUPA 4O02B 4HAAA 2ML6A 3DM8A 4N6TA 2WGOA 1W02A 3UNLA 4RNZA 1K28A 3IMAB 2KF4A 1D6YA 1SIIA 2RBIA 2FXTA 4RNTA 1IV7A 2A15A 2IMJA 2KF5A 1D6UA 2CIUA 3PCRA 3OW22 4IIAA 1K9M4 3LTCA 4GSPA 4MMZB 4HM2B 3B4PA 3DMCA 5LC6A 1VQP3 2KXGA 2XRXB 3WHOA 1BNSA 1VQN3 1IQYA 1Q40A 4LMIA 4N6V0 1A2PA 2JDIH 3AMOB 2INXA 3WMDA 1PU4A 3CD63 5KP3A 3H3HA 5ELJA 2ZA4A 1N9JA 2CG0A 5DREA 3WDGB 3KE7A 3UL6A 1MWUA 4N6UA 3LT9A 4EV2A 3PGBA 2BNGA 3NHXA 2F86B 3D9RA 2CG1A 1W6CA 4N6MA 1OACA 1T5YA 1EEJA 1B2XA 3MYTA 1VQM3 1A2KA 2XEPA 2ZHXB 3WA3A 1BNIA 1LOXA 1YGWA 3KZTA 1K734 4QWTA 1OCVA 2OOVC 2C4BA 2RFRA 2QEX3 3CCV3 1W5ZA 4BL3A 1LOYA 1ZGXA 1VQQA 1BRGA 3F40A 1ULJB 1RDSA 3GWRA 2AAEA 1BU4A 3LZAA 2MF7A 1AQZA 5FGOA 3CCE3 3LH4A 2KF3A 1E3VA 5JPPA 1TRPA 3Q90A 3AGNA 2YFIB 3GAXA 1MWRA 2Z77A 5EQLA 4TX4A 2W56A 2J8XB 2CW9A 2BHMA 3F14A 3JUQA 5G2GA 5M1AA 1JB2A 1C54A 2P0MA 4XM4A 2IUJA 3AHSA 3NBRA 3NUVA 1RCLA 2W9QA 5G1LA 1LVNA 2UUGC 5D81A 3S29A 3WR2A 1GMQA 2B24B 1RGKA 3JUNA 5CXOA 1JJ22 1X1UA 1RGLA 3CCQ3 2XFSA 3CNXA 3LTDA 1ASKA 3E99A 1UUWB 1QVF2 1N5PA 2GU3A 2R4IA 3ALAA 3G6E3 4RBNA 1LOVA 3B7CA 1GSPA 1GY6A 3GZBA 1QVG2 1DYUA 1HZ1A 3NV0B 5BXQA 3OV4A 1DVCA 1VQK3 1DMNA 3K63A 1SJWA 1BVIA 3MHEA 4LEHA 4BIRA 5EEOA 1O7WB 1HKXA 3FCSB 5IG5A 1N5HA 1QAKA 4WYKA 3EN1B 1JBTA 1I3IA 2E2TA 4HZ9B 3FLJA 2GBWB 2XSHB 1JNQA 2ZL8A 3SXXA 4LGQA 1FGTA 1UW1A 4HVNA 3CNMA 4OUQA 1DVDA 4U13A 3UB1A 5A0OB 1TIJA 2IUKA 3BNDA 5IW9A 4XDWA 1CEWI 1T2HA 2ML5A 1YVSA 3FG1A 3OXAA 2D42A 3CCR3 4L8OA 3OWSA 1GS3A 1FGMA 1FYSA 2GEXA 4AEQA 1OH0A 3MWZA 2YX9A 2XGNA 3EBYA 3DGOA 3BLZA 3EQQB 4HM1B 8CHOA 1SIHA 2ZDJA 4HM6B 2CFWA 3DGMA 1LRAA 1GD4A 2XSOB 4FMDA 1G0TA 1MGWA 4STDA 1YHQ3 3EBTA 4N6LA 1MGRA 4EXRA 1IT8A 4CCVA 3PZWA 3IJEB 5G1KA 3HOHA 4ORLA 3D3LA 1OHOA 3FKAA 3JUOA 1NNVA 3NV0A 1KD14 3AHWA 3DGYA 3FF0A 1B27A 2W04A 2XF3A 4RZMA 2Y73A 3RDEA 4OK0A 3V98A 2Z7AA 1JZDA 4LYLB 1KC84 3LOYA 5AIGA 2W2CA 1QALA 4O2HA 1W7CA 2CC3A 3Q2PA 1G02A 1M1XB 1R4YA 4KFEA 4R80A 5BIRA 1M904 1QAFA 2IY2A 6STDA 3KCHA 1JN5A 4EV5A 3T8NA 2KRTA 3KN4A 4FCZA 3ECFA 1GYBA 1K8A4 2HMKB 2OTJ3 1RN4A 1J2BA 1IV9A 3DH2A 1I70A 1YIJ3 2CWVA 1BRSA 1V74A 2K0MA 3FH1A 3X40A 3OX9A 3HIIA 3PCSA 4HOHA 1YIT3 4N3VA 1EKMA 2Z76A 3HK4A 1VQ53 2CFGA 1TFOA 4NHFA 2GU1A 1S5AA 2OWPA 4HBRA 1GY5A 1FW7A 3EB8A 5RNTA 1Q42A 3DGLA 3I563 1WMOA 2CFKA 2CX1A 2I9WA 1RN1A 4AKYA 1OF5B 1W2ZA 2W0QA 1BANA 1GY7A 1MWSA 1OHPA 1ZX2A 4HYZA 6RNTA 2MC8A 1RHLA 1W6GA 1RGCA 4J8TA 3NBBA 1EUIC 1CH0A 1NB5I 1BUQA 5AI1A 1LNIA 5AEUB 5IG3A 1TTOA 3FGYA 4N6NB 1OGZA 4HZBB 1FUTA 4BL2A 2C10A 2BO9B 1Q824 2PNCA 2F5MA 3BNEA 1B20A 1IVWA 1E3RA 3CPOA 4XBYA 3BIRA 2H0GA 1RSNA 3WOFB 1YJW3 1STDA 3U1WA 2B1XB 4MJDA 3CXC2 1OUNA 4XDVA 1UCLA 1I2GA 1UCIA 3ER7A 4HM8B 5CLKA 5DRVA 3SX1A 5M18A 1BRNL 1I3FA 1QMAA 2SBLA 3ZFZA 1GOUA 2AADA 3CC23 4I4KA 3MKIA 1DETA 1LNHA 1BSCA 2F5WA 1AY7A 1HYFA 2UGIA 4WP5A 3F7SA 4X2HA 2OCTA 3AMOA 2WGQA 4NPBA 2CWTA 3G16A 1UCJA 1YVBI 1BSBA 2BIRA 1WNHA 1BRJA 1YI23 1BUJA 1DMMA 2Y74A 3GZXB 1RNTA 1B2ZA 2H0HA 4EW5A 5BU4A 3SOYA 4MEIA 3D5GA 1X1WA 4WHAA 1AR0A 4IT7A 3FG4A 3A76A 4FMCA 3FG3A 3WA2X 2W03A 3JVCA 1O7PB 1IK3A 2QA43 1TFKA 4CPKA 1W4NA 3O8YA 1VQ73 1GOVA 2CK3H 3D4AA 1UI8A 7RNTA 3K9MC 1KSIA 2F56A 1O7NB 4FCJA 1A2VA 1T2IA 2IYJA 1RN7A 4H61A 1US1A 2XR8B 3GSPA 1KQS2 2CHCA 1X1XA 1SQWA 1YJN3 3S27A 1ROAA 2FNQA 3X42A 3CMA3 4N6OB 3OWYA 1RRHA 1V57A 1NU3A 4CJNA 1BSAA 2XH9A 3JUMA 1IU7A 3CCM3 4GL6A 1R4CA 1IYYA 3EHCA 2QGUA 1JBRA 2P0XA 3CCU3 1NDOB 5D83A 5KP1A 1RMSA 4K1VA 1BSDA 1UI7A 3NM2A 1RGHA 4XBTA 5D82A 4KT3B 1LXEA 2HMMB 1IDPA 4RNYA 3CME3 5AIIA 1FA3A 1EA2A 2RSXA 1C7HA 1FGQA 2W9PA 2LQVA 3DZLA 2L4VA 1F8NA 2BMOB 2IA7A 1K41A 1BNRA 3K7CA 1I2FA 4Q53A 4G1MB 1SARA 5IEPA 3GRDA 3KSED 3UL5A 3KFQC 3HIGA 4XB5A 2RGQA 3G8ZA 3ZG5A 5AYSC 1STFI 1GMRA 5AIHA 5LC7A 4BTWA 3MPHA 3CCS3 3PS8A 1A90A 5AEWB 3UJMA 4HJLB 3QRDA 1BSEA 1UUVB 3F8XA 2FGTA 4EBGA 1RGFA 2K3DA 1ZO2A 3GZYB 2WO0A 1Q9EA 7STDA 1OPYA 1I8VA 1Y4KA 3ROBA 3G4S3 1I0VA 2YFJB 2GBXB 1LOWA 3FSDA 1YNVX 2HOHA 1VQ63 3SYUA 1BNJA 4KFDA 1Q7HA 2C11A 5FW5A 3X3XA 4JF8A 1GOYA 3OWUA 1B2SA 1BRKA 1W2B2 1RJOA 1RLSA 3DGNA 1IVUA 3EE1A 3CCJ3 3SEDA 2LYXA 4R4KA 3D79A 2QIYA 2BU4A 2O9UX 3BB9A 3SLUA 4ZM8A 1YJ93 2SARA 1KWIA 3S28A 3L0RA 2M7OA 3CC43 3B4OA 3CCL3 4NREA 1RCKA 1WQLB 1MNLA 3A5EA 3EX9A 3B8LA 1WTHA 2P09A 2OQEC 1ULIB 1ROVA 2HMJB 3VSYA 5BVBA 1PY3A 2STDA 2HMNB 2CWUA 3AGOA 1UUGB 4L7KA 1TJDA 2P38A 1JKGB 2KF6A 4MMXB 1BAOA 5JBSA 1EQKA 4WWUC 1V58A 2W56B 2GEYA 3ZG0A 1IQXA 3LTAA 4K1UA 1VQL3 1WMNA 4HKVB 1I2EA 3K0ZA 4I5QA 3GZRA 1SPUA 3BNBA 3MG1A 1NB3I 3MG2A 2UX0A 3BNCA 2P05A 1OHSA 1W00A 3Q3FA 4X2OA 1Q7Y4 1U5OA 1TUHA 1VQ93 2XFTA 1BRHA
chains in the Genus database with same CATH topology
3BU4A 1B2UA 1RGAA 1BNEA 1B3SA 1RGEA 1JBSA 1GOVA 3D4AA 7RNTA 2F56A 1LRAA 1T2IA 1I0XA 1MGWA 3GSPA 1MGRA 4HAAA 1GMPA 1X1XA 3HOHA 2KF4A 2RBIA 3AHWA 3DGYA 4RNTA 1B27A 1BRIA 2KF5A 2RNTA 3RNTA 1BSAA 9RNTA 4GSPA 3WHOA 1IYYA 1BNSA 5GSPA 1JBRA 1A2PA 1G02A 1BOXA 1R4YA 5BIRA 5HOHA 1RMSA 2ZA4A 1BSDA 3KCHA 1RGHA 4BU4A 1RN4A 1X1YA 3DH2A 1BNGA 1I70A 1BNRA 3D5IA 1I2FA 1BRSA 1B2XA 1UCKA 4HOHA 1SARA 1BNIA 1B2MA 1YGWA 2C4BA 1GMRA 2KAAA 1LOYA 1ZGXA 1FW7A 1BRGA 1RDSA 5RNTA 2AAEA 1BU4A 1AQZA 2KF3A 1TRPA 1BSEA 3AGNA 1RN1A 4J5KA 7GSPA 1RGFA 3URPA 1BGSA 1Q9EA 1BANA 6RNTA 1I8VA 1I0VA 1RHLA 1C54A 1LOWA 3AHSA 1RGCA 8RNTA 1RCLA 1CH0A 1YNVX 3WR2A 2HOHA 1LNIA 1GMQA 1BNJA 1RGKA 3SYUA 1TTOA 1X1UA 1FUTA 1GOYA 1B2SA 1BRKA 1RGLA 1RLSA 2F5MA 1B21A 1FUSA 1B20A 2BU4A 3BIRA 1RSNA 1LOVA 2SARA 4GHOA 1GSPA 1BNFA 1HZ1A 1I2GA 1UCLA 1UCIA 1BRNL 1RCKA 3A5EA 1I3FA 4J5GA 1GOUA 2AADA 1BVIA 1BIRA 1DETA 1PY3A 4BIRA 3AGOA 1RGGA 2KF6A 1JBTA 1BSCA 1RTUA 1I3IA 2F5WA 1AY7A 1BAOA 1HYFA 1PYLA 2F4YA 2GSPA 1FZUA 1UCJA 1BSBA 1I2EA 2BIRA 1BRJA 1BUJA 1RNTA 1B2ZA 6GSPA 1RNBA 5BU4A 3Q3FA 1T2HA 1TRQA 3D5GA 1YVSA 1DE3A 1X1WA 1FYSA 1BRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BU4 A;  1B2U A;  1RGA A;  1BNE A;  1B3S A;  1RGE A;  1JBS A;  1GOV A;  3D4A A;  7RNT A;  2F56 A;  1LRA A;  1T2I A;  1I0X A;  1MGW A;  3GSP A;  1MGR A;  4HAA A;  1GMP A;  1X1X A;  3HOH A;  2KF4 A;  2RBI A;  3AHW A;  3DGY A;  4RNT A;  1B27 A;  1BRI A;  2KF5 A;  2RNT A;  3RNT A;  1BSA A;  9RNT A;  4GSP A;  3WHO A;  1IYY A;  1BNS A;  5GSP A;  1JBR A;  1A2P A;  1G02 A;  1BOX A;  1R4Y A;  5BIR A;  5HOH A;  1RMS A;  2ZA4 A;  1BSD A;  3KCH A;  1RGH A;  4BU4 A;  1RN4 A;  1X1Y A;  3DH2 A;  1BNG A;  1I70 A;  1BNR A;  3D5I A;  1I2F A;  1BRS A;  1B2X A;  1UCK A;  4HOH A;  1SAR A;  1BNI A;  1B2M A;  1YGW A;  2C4B A;  1GMR A;  2KAA A;  1LOY A;  1ZGX A;  1FW7 A;  1BRG A;  1RDS A;  5RNT A;  2AAE A;  1BU4 A;  1AQZ A;  2KF3 A;  1TRP A;  1BSE A;  3AGN A;  1RN1 A;  4J5K A;  7GSP A;  1RGF A;  3URP A;  1BGS A;  1Q9E A;  1BAN A;  6RNT A;  1I8V A;  1I0V A;  1RHL A;  1C54 A;  1LOW A;  3AHS A;  1RGC A;  8RNT A;  1RCL A;  1CH0 A;  1YNV X;  3WR2 A;  2HOH A;  1LNI A;  1GMQ A;  1BNJ A;  1RGK A;  3SYU A;  1TTO A;  1X1U A;  1FUT A;  1GOY A;  1B2S A;  1BRK A;  1RGL A;  1RLS A;  2F5M A;  1B21 A;  1FUS A;  1B20 A;  2BU4 A;  3BIR A;  1RSN A;  1LOV A;  2SAR A;  4GHO A;  1GSP A;  1BNF A;  1HZ1 A;  1I2G A;  1UCL A;  1UCI A;  1BRN L;  1RCK A;  3A5E A;  1I3F A;  4J5G A;  1GOU A;  2AAD A;  1BVI A;  1BIR A;  1DET A;  1PY3 A;  4BIR A;  3AGO A;  1RGG A;  2KF6 A;  1JBT A;  1BSC A;  1RTU A;  1I3I A;  2F5W A;  1AY7 A;  1BAO A;  1HYF A;  1PYL A;  2F4Y A;  2GSP A;  1FZU A;  1UCJ A;  1BSB A;  1I2E A;  2BIR A;  1BRJ A;  1BUJ A;  1RNT A;  1B2Z A;  6GSP A;  1RNB A;  5BU4 A;  3Q3F A;  1T2H A;  1TRQ A;  3D5G A;  1YVS A;  1DE3 A;  1X1W A;  1FYS A;  1BRH A; 
#chains in the Genus database with same CATH topology
 4LZI A;  1B2U A;  1CQS A;  2PZV A;  3V99 A;  3I0Y A;  5I97 A;  1BNE A;  1HU9 A;  2WOF A;  4H3U A;  1B3S A;  1RGE A;  4K61 A;  4KVH A;  4BTX A;  3X3Z A;  1QJG A;  4LSO A;  1JBS A;  4ILF A;  3RGA A;  5IEO A;  3N8B A;  1I0X A;  5CF2 A;  3MSO A;  1W01 A;  3TDG A;  1AVL A;  2R41 A;  1GMP A;  1T3B A;  5AIF A;  3VGN A;  3WOD G;  3EC9 A;  3V92 A;  3HX8 A;  5CK6 A;  4AKZ A;  4PEJ A;  1IVX A;  4FCM A;  2YFL B;  4KZ1 A;  3J7Y d;  3CC7 3;  3G0K A;  4FMA A;  1BRI A;  2RNT A;  3RNT A;  1IT7 A;  9RNT A;  1OF5 A;  2BMR B;  3STD A;  1JRQ A;  3FZW A;  4WYK B;  4WFO A;  1IVV A;  4O3V A;  3I55 3;  1JZO A;  3WOE B;  1JKG A;  3F7X A;  5GSP A;  2CFD A;  3T0U A;  5EVH A;  1FUW A;  1BOX A;  3KII A;  5HOH A;  4J9A A;  3T8U A;  1Z1S A;  1UDI I;  3DUK A;  5HGR A;  2RCD A;  2F99 A;  2Z6B A;  3K5T A;  3NM7 A;  2OQE A;  3RGR A;  4IPB A;  1U8C B;  1E97 A;  2WOH A;  5JPU A;  1MOL A;  2JQ5 A;  1N9E A;  4BU4 A;  1X1Y A;  3F9S A;  1BNG A;  1WMP A;  3D5I A;  3QK9 A;  4CDL A;  1UCK A;  5STD A;  3DY5 A;  4GB5 A;  1VQO 3;  1N8R 4;  2H0I A;  2HMO B;  1B2M A;  2F98 A;  1DMQ A;  3LYG A;  1CYU A;  2KAA A;  1Q86 4;  1GD3 A;  1IQ8 A;  5M19 A;  4K90 B;  4JRF A;  2KCD A;  1VZZ A;  2E2U A;  5IG4 A;  3DXO A;  1NO3 A;  3KSP A;  1G96 A;  4OVM A;  4J5K A;  3LXU X;  1O7G B;  7GSP A;  3G71 3;  3CPW 2;  3URP A;  5CF1 A;  5IG0 A;  5IER A;  1BGS A;  1UGH I;  3NXJ A;  4HM7 B;  4KFF A;  1L5G B;  3X41 A;  3N9H A;  1RKY A;  1A67 A;  3LTB A;  1AV4 A;  3X3Y A;  2CH9 A;  3SOA A;  3FF2 A;  1TU5 A;  2E2V A;  8RNT A;  1JB5 A;  3Q1C A;  1JV2 B;  3LML A;  1D6Z A;  3NQY A;  4BTY A;  1JN5 B;  1ISK A;  1TP6 A;  4DKI A;  2D1W A;  1B21 A;  2OOV A;  3VF1 A;  1FUS A;  3HZP A;  1LQG C;  3HI7 A;  1N8Q A;  4EC6 A;  4O8S A;  3MG3 A;  2Q07 A;  3CU3 A;  4HM0 B;  2O3O A;  1LQM B;  4FMB A;  3KKG A;  1PFP A;  4GHO A;  3IPT A;  3LT8 A;  3H51 A;  4R9L A;  4EYC A;  1BNF A;  2V1L A;  4XBX A;  2BT3 A;  1AVK A;  2L1S A;  4J5G A;  1YGE A;  3EJV A;  1FGO A;  1W6Y A;  3M8C A;  1BIR A;  1CYV A;  1UGI A;  3N54 B;  5IEN A;  1FGR A;  1MWT A;  1O7M B;  1O7H B;  1RGG A;  2OTL 3;  4L8P A;  1Q81 4;  1RTU A;  3U97 A;  5IF6 A;  1PYL A;  1Q40 B;  1RRL A;  2BMQ B;  4HM4 B;  5KP4 A;  1NJI 4;  2K54 A;  2F4Y A;  3S5C A;  2GSP A;  3PXM A;  3NBJ A;  1FZU A;  1NWW A;  3EF8 A;  5TGN A;  1JB4 A;  3NX0 A;  3SVA A;  1M9G A;  3EN8 A;  6GSP A;  1RNB A;  2CKF B;  2GXF A;  2XGL A;  4FR9 A;  4MMY B;  1TRQ A;  3NQZ A;  4R9K A;  1M1K 4;  1EG9 B;  1DE3 A;  3BU4 A;  2CX0 A;  4HM3 B;  3S67 A;  1S72 3;  3F8H A;  1RGA A;  4R1K A;  1ZS7 A;  2W6J H;  5ELU A;  1VQ4 3;  2CFL A;  3PYJ A;  1OGX A;  5AYR B;  2HML B;  1VQ8 3;  4HM5 B;  3JUP A;  4O02 B;  4HAA A;  2ML6 A;  3DM8 A;  4N6T A;  2WGO A;  1W02 A;  3UNL A;  4RNZ A;  1K28 A;  3IMA B;  2KF4 A;  1D6Y A;  1SII A;  2RBI A;  2FXT A;  4RNT A;  1IV7 A;  2A15 A;  2IMJ A;  2KF5 A;  1D6U A;  2CIU A;  3PCR A;  3OW2 2;  4IIA A;  1K9M 4;  3LTC A;  4GSP A;  4MMZ B;  4HM2 B;  3B4P A;  3DMC A;  5LC6 A;  1VQP 3;  2KXG A;  2XRX B;  3WHO A;  1BNS A;  1VQN 3;  1IQY A;  1Q40 A;  4LMI A;  4N6V 0;  1A2P A;  2JDI H;  3AMO B;  2INX A;  3WMD A;  1PU4 A;  3CD6 3;  5KP3 A;  3H3H A;  5ELJ A;  2ZA4 A;  1N9J A;  2CG0 A;  5DRE A;  3WDG B;  3KE7 A;  3UL6 A;  1MWU A;  4N6U A;  3LT9 A;  4EV2 A;  3PGB A;  2BNG A;  3NHX A;  2F86 B;  3D9R A;  2CG1 A;  1W6C A;  4N6M A;  1OAC A;  1T5Y A;  1EEJ A;  1B2X A;  3MYT A;  1VQM 3;  1A2K A;  2XEP A;  2ZHX B;  3WA3 A;  1BNI A;  1LOX A;  1YGW A;  3KZT A;  1K73 4;  4QWT A;  1OCV A;  2OOV C;  2C4B A;  2RFR A;  2QEX 3;  3CCV 3;  1W5Z A;  4BL3 A;  1LOY A;  1ZGX A;  1VQQ A;  1BRG A;  3F40 A;  1ULJ B;  1RDS A;  3GWR A;  2AAE A;  1BU4 A;  3LZA A;  2MF7 A;  1AQZ A;  5FGO A;  3CCE 3;  3LH4 A;  2KF3 A;  1E3V A;  5JPP A;  1TRP A;  3Q90 A;  3AGN A;  2YFI B;  3GAX A;  1MWR A;  2Z77 A;  5EQL A;  4TX4 A;  2W56 A;  2J8X B;  2CW9 A;  2BHM A;  3F14 A;  3JUQ A;  5G2G A;  5M1A A;  1JB2 A;  1C54 A;  2P0M A;  4XM4 A;  2IUJ A;  3AHS A;  3NBR A;  3NUV A;  1RCL A;  2W9Q A;  5G1L A;  1LVN A;  2UUG C;  5D81 A;  3S29 A;  3WR2 A;  1GMQ A;  2B24 B;  1RGK A;  3JUN A;  5CXO A;  1JJ2 2;  1X1U A;  1RGL A;  3CCQ 3;  2XFS A;  3CNX A;  3LTD A;  1ASK A;  3E99 A;  1UUW B;  1QVF 2;  1N5P A;  2GU3 A;  2R4I A;  3ALA A;  3G6E 3;  4RBN A;  1LOV A;  3B7C A;  1GSP A;  1GY6 A;  3GZB A;  1QVG 2;  1DYU A;  1HZ1 A;  3NV0 B;  5BXQ A;  3OV4 A;  1DVC A;  1VQK 3;  1DMN A;  3K63 A;  1SJW A;  1BVI A;  3MHE A;  4LEH A;  4BIR A;  5EEO A;  1O7W B;  1HKX A;  3FCS B;  5IG5 A;  1N5H A;  1QAK A;  4WYK A;  3EN1 B;  1JBT A;  1I3I A;  2E2T A;  4HZ9 B;  3FLJ A;  2GBW B;  2XSH B;  1JNQ A;  2ZL8 A;  3SXX A;  4LGQ A;  1FGT A;  1UW1 A;  4HVN A;  3CNM A;  4OUQ A;  1DVD A;  4U13 A;  3UB1 A;  5A0O B;  1TIJ A;  2IUK A;  3BND A;  5IW9 A;  4XDW A;  1CEW I;  1T2H A;  2ML5 A;  1YVS A;  3FG1 A;  3OXA A;  2D42 A;  3CCR 3;  4L8O A;  3OWS A;  1GS3 A;  1FGM A;  1FYS A;  2GEX A;  4AEQ A;  1OH0 A;  3MWZ A;  2YX9 A;  2XGN A;  3EBY A;  3DGO A;  3BLZ A;  3EQQ B;  4HM1 B;  8CHO A;  1SIH A;  2ZDJ A;  4HM6 B;  2CFW A;  3DGM A;  1LRA A;  1GD4 A;  2XSO B;  4FMD A;  1G0T A;  1MGW A;  4STD A;  1YHQ 3;  3EBT A;  4N6L A;  1MGR A;  4EXR A;  1IT8 A;  4CCV A;  3PZW A;  3IJE B;  5G1K A;  3HOH A;  4ORL A;  3D3L A;  1OHO A;  3FKA A;  3JUO A;  1NNV A;  3NV0 A;  1KD1 4;  3AHW A;  3DGY A;  3FF0 A;  1B27 A;  2W04 A;  2XF3 A;  4RZM A;  2Y73 A;  3RDE A;  4OK0 A;  3V98 A;  2Z7A A;  1JZD A;  4LYL B;  1KC8 4;  3LOY A;  5AIG A;  2W2C A;  1QAL A;  4O2H A;  1W7C A;  2CC3 A;  3Q2P A;  1G02 A;  1M1X B;  1R4Y A;  4KFE A;  4R80 A;  5BIR A;  1M90 4;  1QAF A;  2IY2 A;  6STD A;  3KCH A;  1JN5 A;  4EV5 A;  3T8N A;  2KRT A;  3KN4 A;  4FCZ A;  3ECF A;  1GYB A;  1K8A 4;  2HMK B;  2OTJ 3;  1RN4 A;  1J2B A;  1IV9 A;  3DH2 A;  1I70 A;  1YIJ 3;  2CWV A;  1BRS A;  1V74 A;  2K0M A;  3FH1 A;  3X40 A;  3OX9 A;  3HII A;  3PCS A;  4HOH A;  1YIT 3;  4N3V A;  1EKM A;  2Z76 A;  3HK4 A;  1VQ5 3;  2CFG A;  1TFO A;  4NHF A;  2GU1 A;  1S5A A;  2OWP A;  4HBR A;  1GY5 A;  1FW7 A;  3EB8 A;  5RNT A;  1Q42 A;  3DGL A;  3I56 3;  1WMO A;  2CFK A;  2CX1 A;  2I9W A;  1RN1 A;  4AKY A;  1OF5 B;  1W2Z A;  2W0Q A;  1BAN A;  1GY7 A;  1MWS A;  1OHP A;  1ZX2 A;  4HYZ A;  6RNT A;  2MC8 A;  1RHL A;  1W6G A;  1RGC A;  4J8T A;  3NBB A;  1EUI C;  1CH0 A;  1NB5 I;  1BUQ A;  5AI1 A;  1LNI A;  5AEU B;  5IG3 A;  1TTO A;  3FGY A;  4N6N B;  1OGZ A;  4HZB B;  1FUT A;  4BL2 A;  2C10 A;  2BO9 B;  1Q82 4;  2PNC A;  2F5M A;  3BNE A;  1B20 A;  1IVW A;  1E3R A;  3CPO A;  4XBY A;  3BIR A;  2H0G A;  1RSN A;  3WOF B;  1YJW 3;  1STD A;  3U1W A;  2B1X B;  4MJD A;  3CXC 2;  1OUN A;  4XDV A;  1UCL A;  1I2G A;  1UCI A;  3ER7 A;  4HM8 B;  5CLK A;  5DRV A;  3SX1 A;  5M18 A;  1BRN L;  1I3F A;  1QMA A;  2SBL A;  3ZFZ A;  1GOU A;  2AAD A;  3CC2 3;  4I4K A;  3MKI A;  1DET A;  1LNH A;  1BSC A;  2F5W A;  1AY7 A;  1HYF A;  2UGI A;  4WP5 A;  3F7S A;  4X2H A;  2OCT A;  3AMO A;  2WGQ A;  4NPB A;  2CWT A;  3G16 A;  1UCJ A;  1YVB I;  1BSB A;  2BIR A;  1WNH A;  1BRJ A;  1YI2 3;  1BUJ A;  1DMM A;  2Y74 A;  3GZX B;  1RNT A;  1B2Z A;  2H0H A;  4EW5 A;  5BU4 A;  3SOY A;  4MEI A;  3D5G A;  1X1W A;  4WHA A;  1AR0 A;  4IT7 A;  3FG4 A;  3A76 A;  4FMC A;  3FG3 A;  3WA2 X;  2W03 A;  3JVC A;  1O7P B;  1IK3 A;  2QA4 3;  1TFK A;  4CPK A;  1W4N A;  3O8Y A;  1VQ7 3;  1GOV A;  2CK3 H;  3D4A A;  1UI8 A;  7RNT A;  3K9M C;  1KSI A;  2F56 A;  1O7N B;  4FCJ A;  1A2V A;  1T2I A;  2IYJ A;  1RN7 A;  4H61 A;  1US1 A;  2XR8 B;  3GSP A;  1KQS 2;  2CHC A;  1X1X A;  1SQW A;  1YJN 3;  3S27 A;  1ROA A;  2FNQ A;  3X42 A;  3CMA 3;  4N6O B;  3OWY A;  1RRH A;  1V57 A;  1NU3 A;  4CJN A;  1BSA A;  2XH9 A;  3JUM A;  1IU7 A;  3CCM 3;  4GL6 A;  1R4C A;  1IYY A;  3EHC A;  2QGU A;  1JBR A;  2P0X A;  3CCU 3;  1NDO B;  5D83 A;  5KP1 A;  1RMS A;  4K1V A;  1BSD A;  1UI7 A;  3NM2 A;  1RGH A;  4XBT A;  5D82 A;  4KT3 B;  1LXE A;  2HMM B;  1IDP A;  4RNY A;  3CME 3;  5AII A;  1FA3 A;  1EA2 A;  2RSX A;  1C7H A;  1FGQ A;  2W9P A;  2LQV A;  3DZL A;  2L4V A;  1F8N A;  2BMO B;  2IA7 A;  1K41 A;  1BNR A;  3K7C A;  1I2F A;  4Q53 A;  4G1M B;  1SAR A;  5IEP A;  3GRD A;  3KSE D;  3UL5 A;  3KFQ C;  3HIG A;  4XB5 A;  2RGQ A;  3G8Z A;  3ZG5 A;  5AYS C;  1STF I;  1GMR A;  5AIH A;  5LC7 A;  4BTW A;  3MPH A;  3CCS 3;  3PS8 A;  1A90 A;  5AEW B;  3UJM A;  4HJL B;  3QRD A;  1BSE A;  1UUV B;  3F8X A;  2FGT A;  4EBG A;  1RGF A;  2K3D A;  1ZO2 A;  3GZY B;  2WO0 A;  1Q9E A;  7STD A;  1OPY A;  1I8V A;  1Y4K A;  3ROB A;  3G4S 3;  1I0V A;  2YFJ B;  2GBX B;  1LOW A;  3FSD A;  1YNV X;  2HOH A;  1VQ6 3;  3SYU A;  1BNJ A;  4KFD A;  1Q7H A;  2C11 A;  5FW5 A;  3X3X A;  4JF8 A;  1GOY A;  3OWU A;  1B2S A;  1BRK A;  1W2B 2;  1RJO A;  1RLS A;  3DGN A;  1IVU A;  3EE1 A;  3CCJ 3;  3SED A;  2LYX A;  4R4K A;  3D79 A;  2QIY A;  2BU4 A;  2O9U X;  3BB9 A;  3SLU A;  4ZM8 A;  1YJ9 3;  2SAR A;  1KWI A;  3S28 A;  3L0R A;  2M7O A;  3CC4 3;  3B4O A;  3CCL 3;  4NRE A;  1RCK A;  1WQL B;  1MNL A;  3A5E A;  3EX9 A;  3B8L A;  1WTH A;  2P09 A;  2OQE C;  1ULI B;  1ROV A;  2HMJ B;  3VSY A;  5BVB A;  1PY3 A;  2STD A;  2HMN B;  2CWU A;  3AGO A;  1UUG B;  4L7K A;  1TJD A;  2P38 A;  1JKG B;  2KF6 A;  4MMX B;  1BAO A;  5JBS A;  1EQK A;  4WWU C;  1V58 A;  2W56 B;  2GEY A;  3ZG0 A;  1IQX A;  3LTA A;  4K1U A;  1VQL 3;  1WMN A;  4HKV B;  1I2E A;  3K0Z A;  4I5Q A;  3GZR A;  1SPU A;  3BNB A;  3MG1 A;  1NB3 I;  3MG2 A;  2UX0 A;  3BNC A;  2P05 A;  1OHS A;  1W00 A;  3Q3F A;  4X2O A;  1Q7Y 4;  1U5O A;  1TUH A;  1VQ9 3;  2XFT A;  1BRH A; 
#chains in the Genus database with same CATH homology
 3BU4 A;  1B2U A;  1RGA A;  1BNE A;  1B3S A;  1RGE A;  1JBS A;  1GOV A;  3D4A A;  7RNT A;  2F56 A;  1LRA A;  1T2I A;  1I0X A;  1MGW A;  3GSP A;  1MGR A;  4HAA A;  1GMP A;  1X1X A;  3HOH A;  2KF4 A;  2RBI A;  3AHW A;  3DGY A;  4RNT A;  1B27 A;  1BRI A;  2KF5 A;  2RNT A;  3RNT A;  1BSA A;  9RNT A;  4GSP A;  3WHO A;  1IYY A;  1BNS A;  5GSP A;  1JBR A;  1A2P A;  1G02 A;  1BOX A;  1R4Y A;  5BIR A;  5HOH A;  1RMS A;  2ZA4 A;  1BSD A;  3KCH A;  1RGH A;  4BU4 A;  1RN4 A;  1X1Y A;  3DH2 A;  1BNG A;  1I70 A;  1BNR A;  3D5I A;  1I2F A;  1BRS A;  1B2X A;  1UCK A;  4HOH A;  1SAR A;  1BNI A;  1B2M A;  1YGW A;  2C4B A;  1GMR A;  2KAA A;  1LOY A;  1ZGX A;  1FW7 A;  1BRG A;  1RDS A;  5RNT A;  2AAE A;  1BU4 A;  1AQZ A;  2KF3 A;  1TRP A;  1BSE A;  3AGN A;  1RN1 A;  4J5K A;  7GSP A;  1RGF A;  3URP A;  1BGS A;  1Q9E A;  1BAN A;  6RNT A;  1I8V A;  1I0V A;  1RHL A;  1C54 A;  1LOW A;  3AHS A;  1RGC A;  8RNT A;  1RCL A;  1CH0 A;  1YNV X;  3WR2 A;  2HOH A;  1LNI A;  1GMQ A;  1BNJ A;  1RGK A;  3SYU A;  1TTO A;  1X1U A;  1FUT A;  1GOY A;  1B2S A;  1BRK A;  1RGL A;  1RLS A;  2F5M A;  1B21 A;  1FUS A;  1B20 A;  2BU4 A;  3BIR A;  1RSN A;  1LOV A;  2SAR A;  4GHO A;  1GSP A;  1BNF A;  1HZ1 A;  1I2G A;  1UCL A;  1UCI A;  1BRN L;  1RCK A;  3A5E A;  1I3F A;  4J5G A;  1GOU A;  2AAD A;  1BVI A;  1BIR A;  1DET A;  1PY3 A;  4BIR A;  3AGO A;  1RGG A;  2KF6 A;  1JBT A;  1BSC A;  1RTU A;  1I3I A;  2F5W A;  1AY7 A;  1BAO A;  1HYF A;  1PYL A;  2F4Y A;  2GSP A;  1FZU A;  1UCJ A;  1BSB A;  1I2E A;  2BIR A;  1BRJ A;  1BUJ A;  1RNT A;  1B2Z A;  6GSP A;  1RNB A;  5BU4 A;  3Q3F A;  1T2H A;  1TRQ A;  3D5G A;  1YVS A;  1DE3 A;  1X1W A;  1FYS A;  1BRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...