2GSPA

Ribonuclease t1/2',3'-cgps and 3'-gmp, 2 days
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Hydrolysis of a slow cyclic thiophosphate substrate of RNase T1 analyzed by time-resolved crystallography.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endoribonuclease
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2gspA00
1B3SA 2BU4A 1I2FA 3AHWA 2F56A 5HOHA 1RGAA 3D5GA 1I0VA 1X1UA 1FYSA 1SARA 1BIRA 1FUTA 2F5MA 2RBIA 2RNTA 1B2ZA 1RNTA 1BRNL 1DE3A 3D5IA 1Q9EA 1FUSA 1GOYA 1IYYA 2HOHA 1RNBA 1BNEA 1BNSA 1LOWA 1B20A 1UCLA 1HYFA 1C54A 1RN4A 7GSPA 1T2HA 1YVSA 2KF6A 3HOHA 3GSPA 1FZUA 1G02A 3WHOA 1AQZA 4BU4A 1BRGA 1RGHA 1X1WA 1UCIA 1BGSA 1LOYA 4HOHA 7RNTA 1GOUA 1BVIA 1R4YA 3RNTA 4GSPA 1B2UA 1RGFA 1T2IA 2AAEA 1BRSA 1BSAA 3D4AA 1RCKA 4GHOA 1GMQA 5GSPA 1A2PA 1RN1A 1X1YA 3Q3FA 9RNTA 1X1XA 1RGLA 1I0XA 1GMPA 1RGGA 3DH2A 1I3IA 1PYLA 1BSBA 3BIRA 4J5KA 5BU4A 1BSEA 2KF5A 1BRHA 1BNFA 1GMRA 2GSPA 1FW7A 1BNIA 1RDSA 3AHSA 1BSDA 1BRJA 3KCHA 1RLSA 1RGCA 1JBSA 1RCLA 1YGWA 1BANA 1BNGA 1BSCA 1I3FA 1LOVA 1I70A 1UCKA 1MGRA 3DGYA 3BU4A 1RHLA 1RTUA 1RGEA 1MGWA 2KF4A 1BNRA 1B2MA 5BIRA 3WR2A 4BIRA 1JBRA 1B2SA 5RNTA 1LRAA 3SYUA 2BIRA 1BRKA 1AY7A 2C4BA 1CH0A 1JBTA 1PY3A 1I8VA 1YNVX 1RSNA 2F5WA 6GSPA 1TRPA 2F4YA 2AADA 1UCJA 2SARA 2ZA4A 3URPA 1LNIA 1BRIA 2KF3A 4RNTA 1BAOA 3A5EA 1B21A 3AGOA 1B2XA 1BU4A 1GSPA 1HZ1A 2KAAA 1B27A 1BOXA 1BNJA 1I2EA 1TRQA 1RMSA 1RGKA 1TTOA 1ZGXA 6RNTA 1GOVA 3AGNA 4HAAA 8RNTA 1I2GA 4J5GA 1DETA 1BUJA
chains in the Genus database with same CATH superfamily
3RGAA 1B3SA 1JZDA 1FGRA 1Q42A 5HOHA 2CKFB 3D5GA 1I0VA 1X1UA 4KFEA 1FUTA 2CX0A 3LYGA 2RNTA 4HKVB 3S67A 3KKGA 1VQO3 4EXRA 1Q40B 1SQWA 1UUVB 2OQEC 4AKYA 1DE3A 1Q9EA 3SX1A 2CW9A 1IV9A 8CHOA 1YJ93 4HM3B 3Q90A 1OHOA 5M1AA 1FUSA 4N6TA 3CCR3 4FMCA 1W2ZA 3IPTA 2FNQA 4JF8A 1BNSA 3MWZA 1B20A 3K9MC 1HYFA 1U8CB 2OOVC 4G1MB 5IG0A 3S5CA 3SXXA 4L8OA 3FF0A 2Q07A 5CF1A 1KC84 3MG1A 5JPUA 3DM8A 2R41A 4BU4A 1X1WA 2CWUA 1WTHA 1GY6A 5IEPA 3U97A 4MMYB 1VQL3 1UW1A 1UCIA 2C10A 3AMOA 2WO0A 5KP1A 5EQLA 1B2UA 5AEUB 2WOFA 5CK6A 1FA3A 3D4AA 4FMDA 1GMQA 1OCVA 2CH9A 1RN1A 3FH1A 3Q3FA 2QA43 2ZL8A 1V57A 3LTAA 4LSOA 4HBRA 5AYSC 4J5KA 4XBYA 2ML6A 5CXOA 5JPPA 1Q864 5BU4A 1VQ53 4MJDA 1FW7A 1RDSA 1BUQA 1EKMA 3X42A 1DMQA 2Z76A 1GY5A 5A0OB 1JBSA 2PNCA 4WP5A 1YGWA 3V99A 4EYCA 3CXC2 3B7CA 1I70A 4AEQA 1K9M4 3HIGA 3IJEB 1V58A 3FSDA 3CCU3 3EF8A 3ALAA 3NBRA 3OWUA 1RTUA 1RGEA 3LMLA 4IT7A 1BNRA 1C54A 1B2MA 1F8NA 2R4IA 3DGLA 3LTBA 4HM8B 3SLUA 5RNTA 1TFKA 4OVMA 5M19A 1M9GA 2W9QA 4O3VA 1U5OA 1Q7HA 1FGTA 3NX0A 4EV5A 1QALA 3S28A 2D42A 3G6E3 1NNVA 1WQLB 2INXA 1E97A 3HZPA 3GZRA 4X2OA 2C4BA 5ELUA 1S5AA 1PY3A 3EC9A 3DUKA 1IVXA 1O7PB 1RSNA 1WMOA 3G0KA 1M1K4 2OTL3 2BNGA 1DYUA 3BNBA 3PXMA 1UI7A 1W01A 1IK3A 1N8R4 4KFDA 2STDA 4BTXA 3CCV3 2K3DA 4HYZA 3GAXA 4OUQA 4KFFA 2CFWA 1OUNA 3CC43 3GWRA 3CCL3 3OW22 3GZYB 4LZIA 3AGOA 4FCMA 2KAAA 3D9RA 4EC6A 3B8LA 1IVUA 2CIUA 1TRQA 2W03A 1TU5A 3CPW2 3D79A 2C11A 3FLJA 1EA2A 4HZ9B 4WYKA 2JQ5A 3VSYA 4ZM8A 8RNTA 5G2GA 2V1LA 5AI1A 2J8XB 3I0YA 3KN4A 1DETA 3UNLA 2XH9A 3JUNA 2BMOB 4XDVA 1I2FA 3LOYA 2H0IA 2F56A 2O9UX 1KWIA 4HM6B 4PEJA 2F5MA 4LGQA 3WDGB 3N54B 4KT3B 1N9EA 2CFKA 3QRDA 1RNTA 2YFLB 3LXUX 1W6GA 3T0UA 3H51A 1RKYA 3PCSA 5BXQA 2BO9B 1Q7Y4 5IENA 4ILFA 2H0GA 3CD63 2HMJB 2HOHA 2Z77A 1BNEA 4R80A 1KSIA 1LOWA 1UCLA 1MWUA 1RN4A 4IPBA 1YVSA 3NV0B 2XFSA 4N6LA 4RNZA 2XFTA 4HM4B 1AQZA 5D83A 1BRGA 1RJOA 3N8BA 1L5GB 1T5YA 1JB5A 3JUMA 3O8YA 4HM0B 1C7HA 3STDA 1YIT3 2GU3A 3CU3A 4FMAA 4HOHA 1LXEA 5LC6A 3RDEA 1OGZA 1CQSA 4N6UA 1CYVA 1RGFA 1T2IA 3BNCA 3JUOA 2AAEA 2CFLA 2GEYA 1BSAA 1OGXA 2RCDA 3DXOA 1MWRA 2XSOB 4J9AA 1UUGB 4R1KA 1A2PA 1NO3A 1X1YA 1GYBA 4O02B 1MOLA 4TX4A 1RGLA 1I0XA 2W56B 1VQ73 3NM7A 1ROAA 1VQ63 3DH2A 1I3IA 1PYLA 3BIRA 4H3UA 3UL5A 3VF1A 3DGNA 2KF5A 4NPBA 3G4S3 1BRHA 1BNFA 1N5PA 1QJGA 2KXGA 2MF7A 4QWTA 1A67A 1JJ22 3Q1CA 4GL6A 1JN5A 2IYJA 3I563 5AIHA 1GY7A 3LZAA 2FXTA 3F7XA 1O7NB 1BANA 2KCDA 2GXFA 2PZVA 5D82A 4FR9A 3B4OA 3NHXA 3CCM3 1ROVA 1WMPA 2HMLB 3NBBA 3PZWA 1IVWA 1OF5B 1YVBI 2B24B 1EQKA 3OXAA 4MEIA 1RN7A 3MG2A 4EW5A 2E2UA 2W0QA 1Z1SA 4XBXA 1RHLA 4STDA 3ZFZA 1MGWA 4BL2A 1UGHI 5BIRA 1ISKA 4MMZB 1Q824 1JBRA 1DVDA 1SJWA 1Q814 4FMBA 1K8A4 1Q40A 2XF3A 5LC7A 3SYUA 3CC23 1AY7A 1IT8A 4RNYA 4EV2A 2GBXB 5EVHA 3EBTA 1YNVX 2BMRB 6GSPA 4DKIA 1Y4KA 2YFIB 2P0XA 1YI23 2AADA 2CFGA 1V74A 3CNXA 1PFPA 3L0RA 2ZA4A 1N5HA 4HM2B 3CC73 3LT8A 3ZG0A 2E2VA 2OOVA 1EUIC 3V92A 3EB8A 4RNTA 5JBSA 1VQ83 1QVF2 1D6ZA 5BVBA 1B21A 7STDA 3EX9A 2WGOA 2CC3A 4WWUC 3HX8A 3UB1A 5G1KA 1BOXA 5IF6A 2UX0A 2XEPA 3GZXB 1CEWI 1HU9A 2P09A 3OX9A 1YHQ3 1ZGXA 1RGKA 2P0MA 3EJVA 3NXJA 4XM4A 4N3VA 3AGNA 1UUWB 4HAAA 4L7KA 5IG3A 1DMNA 3K5TA 1JNQA 4CPKA 2WGQA 3EHCA 4J5GA 2IY2A 1W7CA 1NWWA 4BTWA 5ELJA 4K1UA 5STDA 3SOYA 1BIRA 1VQM3 4HM1B 3FGYA 2RBIA 2RGQA 5AYRB 3ECFA 3JVCA 2A15A 3I553 1BRNL 1ZX2A 2OTJ3 1NB5I 1PU4A 1IT7A 1QAKA 3PYJA 3QK9A 2JDIH 3D3LA 1WNHA 3HI7A 1CYUA 1TIJA 1GOYA 1WMNA 1O7WB 3B4PA 1A2VA 2D1WA 2K54A 2CX1A 3DGOA 1JRQA 1US1A 2IA7A 3OV4A 1D6UA 4HM7B 4XB5A 3X3XA 3TDGA 1MWTA 1T2HA 3A76A 2P38A 4LEHA 7GSPA 3WOFB 2O3OA 3HOHA 3GSPA 1UI8A 3CCS3 1G02A 3WHOA 3HK4A 1W5ZA 3NBJA 1SIHA 1RGHA 2F99A 1D6YA 2ML5A 3PS8A 2BMQB 2F98A 2K0MA 3BLZA 3WOEB 7RNTA 1BGSA 4NHFA 1BVIA 3VGNA 1R4YA 3RNTA 5IW9A 4GSPA 1YJN3 4X2HA 4AKZA 4BL3A 2OCTA 1ZS7A 4BTYA 1NJI4 1RCKA 1W00A 4GHOA 5AEWB 4N6NB 2RFRA 4U13A 2CHCA 5IEOA 2MC8A 9RNTA 1N8QA 3CMA3 4H61A 3CNMA 1GMPA 1QVG2 1RGGA 3ER7A 1TJDA 1BSBA 2LYXA 4JRFA 1GMRA 1BNIA 2W9PA 3AHSA 4LMIA 2IUJA 1BSDA 1BRJA 1EEJA 1SPUA 1W4NA 1LQMB 3F8HA 2CG1A 3SVAA 1RGCA 2IUKA 4CCVA 1JV2B 1RCLA 1I3FA 1BSCA 1LOXA 3LTDA 3MG3A 2P05A 2SBLA 1YJW3 1UCKA 1MGRA 5M18A 1O7MB 5HGRA 2GU1A 1YIJ3 2RSXA 1O7GB 2ZDJA 3NUVA 2W2CA 3F8XA 4LYLB 3G713 2KF4A 1NDOB 1LQGC 3F9SA 5AIGA 3EE1A 4BIRA 4HJLB 1QAFA 2WOHA 2ZHXB 1G96A 3NQZA 1KD14 1JN5B 3PCRA 3BNDA 3RGRA 3WA3A 1GD4A 2CFDA 3X40A 4NREA 1IU7A 1OACA 1JKGA 1CH0A 1MWSA 3NQYA 1JBTA 1I8VA 3IMAB 3KSPA 2F5WA 2HMOB 3AMOB 5TGNA 3FG3A 1M904 1DMMA 2F4YA 3BNEA 4CDLA 3NV0A 1VQK3 3KIIA 3ROBA 5DRVA 1UCJA 2SARA 3N9HA 2H0HA 2OWPA 1FGMA 2UUGC 3J7Yd 3CCJ3 3PGBA 4OK0A 1J2BA 2Z6BA 1BAOA 1IQXA 1IV7A 1STFI 3H3HA 1AVLA 4MMXB 4R4KA 3X3ZA 1B2XA 6STDA 1BU4A 1HZ1A 3WA2X 1JZOA 2HMKB 2Y73A 3JUQA 1BNJA 2XRXB 3CME3 1M1XB 3T8UA 3K7CA 1TTOA 1QMAA 3LT9A 3KSED 3MHEA 1N9JA 4O2HA 2M7OA 3GRDA 3KE7A 5I97A 2W56A 4CJNA 2IMJA 1IQYA 5DREA 1I2GA 1RRLA 1VQN3 2UGIA 1IQ8A 1K41A 1O7HB 3K63A 1FGOA 4FCJA 2OQEA 2BU4A 3V98A 3AHWA 2L1SA 1RGAA 1FYSA 1SARA 2E2TA 4WFOA 1ULJB 1DVCA 1A90A 3LH4A 1OF5A 1ULIB 2QGUA 1B2ZA 3S27A 3F7SA 4HM5B 3JUPA 4K90B 2HMMB 3D5IA 1E3VA 3X3YA 4XBTA 1TFOA 3NM2A 3GZBA 5KP4A 4WHAA 1IYYA 4HVNA 2YFJB 1JB2A 3G8ZA 1RNBA 1A2KA 1KQS2 2F86B 3F14A 5CLKA 5KP3A 4ORLA 2KF6A 1W2B2 1OH0A 1FZUA 1SIIA 4HZBB 2Z7AA 3M8CA 3ZG5A 1HKXA 1R4CA 1S723 1AV4A 2QIYA 3G16A 1VQP3 1LOYA 2L4VA 1GOUA 4R9KA 4RZMA 2W6JH 1VQ93 1W02A 2FGTA 1BRSA 2W04A 5GSPA 1K28A 4XDWA 1RRHA 1X1XA 3EN1B 4WYKB 3F40A 3K0ZA 1K734 3WMDA 2CG0A 1BSEA 3U1WA 2GSPA 5AIIA 2HMNB 3FF2A 3CCQ3 2BT3A 4N6MA 1LVNA 3KCHA 5FGOA 1RLSA 5D81A 4IIAA 3DZLA 4GB5A 1BNGA 1LOVA 3EBYA 4L8PA 2QEX3 1G0TA 1GS3A 3DGMA 5IG4A 3DGYA 4N6V0 1AR0A 1TUHA 3BU4A 3FZWA 5CF2A 3UL6A 3KZTA 5IG5A 4J8TA 2B1XB 2XGNA 5EEOA 1T3BA 1NU3A 1E3RA 3WR2A 2XGLA 1B2SA 4KZ1A 1VQQA 2YX9A 1LRAA 1UGIA 1JB4A 3UJMA 1ASKA 3FG4A 2XSHB 1AVKA 1BRKA 2BIRA 3DMCA 3MYTA 3FCSB 3CPOA 3WODG 1W6YA 2KRTA 4FCZA 3HIIA 3BB9A 4K61A 1FGQA 2I9WA 4KVHA 4Q53A 3X41A 2GBWB 1EG9B 3Q2PA 4EBGA 1IVVA 4O8SA 1TRPA 3T8NA 3LTCA 1UDII 2BHMA 3FKAA 1VQ43 3DY5A 3CCE3 3URPA 1MNLA 4RBNA 1LNIA 1BRIA 2KF3A 3MPHA 1ZO2A 3EQQB 3SEDA 2CWVA 2Y74A 5G1LA 1FUWA 1YGEA 1GD3A 3A5EA 2XR8B 1VZZA 1JKGB 2GEXA 3EN8A 1GSPA 3OWYA 5FW5A 1B27A 5IERA 3SOAA 1I2EA 1TP6A 1LNHA 1STDA 4R9LA 3OWSA 1OHSA 1RMSA 3KFQC 1NB3I 3MKIA 4I5QA 1IDPA 1GOVA 1W6CA 5AIFA 6RNTA 2CK3H 3E99A 3FG1A 3MSOA 4I4KA 1OPYA 2CWTA 4K1VA 2LQVA 4N6OB 1OHPA 3S29A 1BUJA
chains in the Genus database with same CATH topology
1B3SA 2BU4A 1I2FA 3AHWA 2F56A 5HOHA 1RGAA 3D5GA 1I0VA 1X1UA 1FYSA 1SARA 1BIRA 1FUTA 2F5MA 2RBIA 2RNTA 1B2ZA 1RNTA 1BRNL 1DE3A 3D5IA 1Q9EA 1FUSA 1GOYA 1IYYA 2HOHA 1RNBA 1BNEA 1BNSA 1LOWA 1B20A 1UCLA 1HYFA 1C54A 1RN4A 7GSPA 1T2HA 1YVSA 2KF6A 3HOHA 3GSPA 1FZUA 1G02A 3WHOA 1AQZA 4BU4A 1BRGA 1RGHA 1X1WA 1UCIA 1BGSA 1LOYA 4HOHA 7RNTA 1GOUA 1BVIA 1R4YA 3RNTA 4GSPA 1B2UA 1RGFA 1T2IA 2AAEA 1BRSA 1BSAA 3D4AA 1RCKA 4GHOA 1GMQA 5GSPA 1A2PA 1RN1A 1X1YA 3Q3FA 9RNTA 1X1XA 1RGLA 1I0XA 1GMPA 1RGGA 3DH2A 1I3IA 1PYLA 1BSBA 3BIRA 4J5KA 5BU4A 1BSEA 2KF5A 1BRHA 1BNFA 1GMRA 2GSPA 1FW7A 1BNIA 1RDSA 3AHSA 1BSDA 1BRJA 3KCHA 1RLSA 1RGCA 1JBSA 1RCLA 1YGWA 1BANA 1BNGA 1BSCA 1I3FA 1LOVA 1I70A 1UCKA 1MGRA 3DGYA 3BU4A 1RHLA 1RTUA 1RGEA 1MGWA 2KF4A 1BNRA 1B2MA 5BIRA 3WR2A 4BIRA 1JBRA 1B2SA 5RNTA 1LRAA 3SYUA 2BIRA 1BRKA 1AY7A 2C4BA 1CH0A 1JBTA 1PY3A 1I8VA 1YNVX 1RSNA 2F5WA 6GSPA 1TRPA 2F4YA 2AADA 1UCJA 2SARA 2ZA4A 3URPA 1LNIA 1BRIA 2KF3A 4RNTA 1BAOA 3A5EA 1B21A 3AGOA 1B2XA 1BU4A 1GSPA 1HZ1A 2KAAA 1B27A 1BOXA 1BNJA 1I2EA 1TRQA 1RMSA 1RGKA 1TTOA 1ZGXA 6RNTA 1GOVA 3AGNA 4HAAA 8RNTA 1I2GA 4J5GA 1DETA 1BUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3S A;  2BU4 A;  1I2F A;  3AHW A;  2F56 A;  5HOH A;  1RGA A;  3D5G A;  1I0V A;  1X1U A;  1FYS A;  1SAR A;  1BIR A;  1FUT A;  2F5M A;  2RBI A;  2RNT A;  1B2Z A;  1RNT A;  1BRN L;  1DE3 A;  3D5I A;  1Q9E A;  1FUS A;  1GOY A;  1IYY A;  2HOH A;  1RNB A;  1BNE A;  1BNS A;  1LOW A;  1B20 A;  1UCL A;  1HYF A;  1C54 A;  1RN4 A;  7GSP A;  1T2H A;  1YVS A;  2KF6 A;  3HOH A;  3GSP A;  1FZU A;  1G02 A;  3WHO A;  1AQZ A;  4BU4 A;  1BRG A;  1RGH A;  1X1W A;  1UCI A;  1BGS A;  1LOY A;  4HOH A;  7RNT A;  1GOU A;  1BVI A;  1R4Y A;  3RNT A;  4GSP A;  1B2U A;  1RGF A;  1T2I A;  2AAE A;  1BRS A;  1BSA A;  3D4A A;  1RCK A;  4GHO A;  1GMQ A;  5GSP A;  1A2P A;  1RN1 A;  1X1Y A;  3Q3F A;  9RNT A;  1X1X A;  1RGL A;  1I0X A;  1GMP A;  1RGG A;  3DH2 A;  1I3I A;  1PYL A;  1BSB A;  3BIR A;  4J5K A;  5BU4 A;  1BSE A;  2KF5 A;  1BRH A;  1BNF A;  1GMR A;  2GSP A;  1FW7 A;  1BNI A;  1RDS A;  3AHS A;  1BSD A;  1BRJ A;  3KCH A;  1RLS A;  1RGC A;  1JBS A;  1RCL A;  1YGW A;  1BAN A;  1BNG A;  1BSC A;  1I3F A;  1LOV A;  1I70 A;  1UCK A;  1MGR A;  3DGY A;  3BU4 A;  1RHL A;  1RTU A;  1RGE A;  1MGW A;  2KF4 A;  1BNR A;  1B2M A;  5BIR A;  3WR2 A;  4BIR A;  1JBR A;  1B2S A;  5RNT A;  1LRA A;  3SYU A;  2BIR A;  1BRK A;  1AY7 A;  2C4B A;  1CH0 A;  1JBT A;  1PY3 A;  1I8V A;  1YNV X;  1RSN A;  2F5W A;  6GSP A;  1TRP A;  2F4Y A;  2AAD A;  1UCJ A;  2SAR A;  2ZA4 A;  3URP A;  1LNI A;  1BRI A;  2KF3 A;  4RNT A;  1BAO A;  3A5E A;  1B21 A;  3AGO A;  1B2X A;  1BU4 A;  1GSP A;  1HZ1 A;  2KAA A;  1B27 A;  1BOX A;  1BNJ A;  1I2E A;  1TRQ A;  1RMS A;  1RGK A;  1TTO A;  1ZGX A;  6RNT A;  1GOV A;  3AGN A;  4HAA A;  8RNT A;  1I2G A;  4J5G A;  1DET A;  1BUJ A; 
#chains in the Genus database with same CATH topology
 3RGA A;  1B3S A;  1JZD A;  1FGR A;  1Q42 A;  5HOH A;  2CKF B;  3D5G A;  1I0V A;  1X1U A;  4KFE A;  1FUT A;  2CX0 A;  3LYG A;  2RNT A;  4HKV B;  3S67 A;  3KKG A;  1VQO 3;  4EXR A;  1Q40 B;  1SQW A;  1UUV B;  2OQE C;  4AKY A;  1DE3 A;  1Q9E A;  3SX1 A;  2CW9 A;  1IV9 A;  8CHO A;  1YJ9 3;  4HM3 B;  3Q90 A;  1OHO A;  5M1A A;  1FUS A;  4N6T A;  3CCR 3;  4FMC A;  1W2Z A;  3IPT A;  2FNQ A;  4JF8 A;  1BNS A;  3MWZ A;  1B20 A;  3K9M C;  1HYF A;  1U8C B;  2OOV C;  4G1M B;  5IG0 A;  3S5C A;  3SXX A;  4L8O A;  3FF0 A;  2Q07 A;  5CF1 A;  1KC8 4;  3MG1 A;  5JPU A;  3DM8 A;  2R41 A;  4BU4 A;  1X1W A;  2CWU A;  1WTH A;  1GY6 A;  5IEP A;  3U97 A;  4MMY B;  1VQL 3;  1UW1 A;  1UCI A;  2C10 A;  3AMO A;  2WO0 A;  5KP1 A;  5EQL A;  1B2U A;  5AEU B;  2WOF A;  5CK6 A;  1FA3 A;  3D4A A;  4FMD A;  1GMQ A;  1OCV A;  2CH9 A;  1RN1 A;  3FH1 A;  3Q3F A;  2QA4 3;  2ZL8 A;  1V57 A;  3LTA A;  4LSO A;  4HBR A;  5AYS C;  4J5K A;  4XBY A;  2ML6 A;  5CXO A;  5JPP A;  1Q86 4;  5BU4 A;  1VQ5 3;  4MJD A;  1FW7 A;  1RDS A;  1BUQ A;  1EKM A;  3X42 A;  1DMQ A;  2Z76 A;  1GY5 A;  5A0O B;  1JBS A;  2PNC A;  4WP5 A;  1YGW A;  3V99 A;  4EYC A;  3CXC 2;  3B7C A;  1I70 A;  4AEQ A;  1K9M 4;  3HIG A;  3IJE B;  1V58 A;  3FSD A;  3CCU 3;  3EF8 A;  3ALA A;  3NBR A;  3OWU A;  1RTU A;  1RGE A;  3LML A;  4IT7 A;  1BNR A;  1C54 A;  1B2M A;  1F8N A;  2R4I A;  3DGL A;  3LTB A;  4HM8 B;  3SLU A;  5RNT A;  1TFK A;  4OVM A;  5M19 A;  1M9G A;  2W9Q A;  4O3V A;  1U5O A;  1Q7H A;  1FGT A;  3NX0 A;  4EV5 A;  1QAL A;  3S28 A;  2D42 A;  3G6E 3;  1NNV A;  1WQL B;  2INX A;  1E97 A;  3HZP A;  3GZR A;  4X2O A;  2C4B A;  5ELU A;  1S5A A;  1PY3 A;  3EC9 A;  3DUK A;  1IVX A;  1O7P B;  1RSN A;  1WMO A;  3G0K A;  1M1K 4;  2OTL 3;  2BNG A;  1DYU A;  3BNB A;  3PXM A;  1UI7 A;  1W01 A;  1IK3 A;  1N8R 4;  4KFD A;  2STD A;  4BTX A;  3CCV 3;  2K3D A;  4HYZ A;  3GAX A;  4OUQ A;  4KFF A;  2CFW A;  1OUN A;  3CC4 3;  3GWR A;  3CCL 3;  3OW2 2;  3GZY B;  4LZI A;  3AGO A;  4FCM A;  2KAA A;  3D9R A;  4EC6 A;  3B8L A;  1IVU A;  2CIU A;  1TRQ A;  2W03 A;  1TU5 A;  3CPW 2;  3D79 A;  2C11 A;  3FLJ A;  1EA2 A;  4HZ9 B;  4WYK A;  2JQ5 A;  3VSY A;  4ZM8 A;  8RNT A;  5G2G A;  2V1L A;  5AI1 A;  2J8X B;  3I0Y A;  3KN4 A;  1DET A;  3UNL A;  2XH9 A;  3JUN A;  2BMO B;  4XDV A;  1I2F A;  3LOY A;  2H0I A;  2F56 A;  2O9U X;  1KWI A;  4HM6 B;  4PEJ A;  2F5M A;  4LGQ A;  3WDG B;  3N54 B;  4KT3 B;  1N9E A;  2CFK A;  3QRD A;  1RNT A;  2YFL B;  3LXU X;  1W6G A;  3T0U A;  3H51 A;  1RKY A;  3PCS A;  5BXQ A;  2BO9 B;  1Q7Y 4;  5IEN A;  4ILF A;  2H0G A;  3CD6 3;  2HMJ B;  2HOH A;  2Z77 A;  1BNE A;  4R80 A;  1KSI A;  1LOW A;  1UCL A;  1MWU A;  1RN4 A;  4IPB A;  1YVS A;  3NV0 B;  2XFS A;  4N6L A;  4RNZ A;  2XFT A;  4HM4 B;  1AQZ A;  5D83 A;  1BRG A;  1RJO A;  3N8B A;  1L5G B;  1T5Y A;  1JB5 A;  3JUM A;  3O8Y A;  4HM0 B;  1C7H A;  3STD A;  1YIT 3;  2GU3 A;  3CU3 A;  4FMA A;  4HOH A;  1LXE A;  5LC6 A;  3RDE A;  1OGZ A;  1CQS A;  4N6U A;  1CYV A;  1RGF A;  1T2I A;  3BNC A;  3JUO A;  2AAE A;  2CFL A;  2GEY A;  1BSA A;  1OGX A;  2RCD A;  3DXO A;  1MWR A;  2XSO B;  4J9A A;  1UUG B;  4R1K A;  1A2P A;  1NO3 A;  1X1Y A;  1GYB A;  4O02 B;  1MOL A;  4TX4 A;  1RGL A;  1I0X A;  2W56 B;  1VQ7 3;  3NM7 A;  1ROA A;  1VQ6 3;  3DH2 A;  1I3I A;  1PYL A;  3BIR A;  4H3U A;  3UL5 A;  3VF1 A;  3DGN A;  2KF5 A;  4NPB A;  3G4S 3;  1BRH A;  1BNF A;  1N5P A;  1QJG A;  2KXG A;  2MF7 A;  4QWT A;  1A67 A;  1JJ2 2;  3Q1C A;  4GL6 A;  1JN5 A;  2IYJ A;  3I56 3;  5AIH A;  1GY7 A;  3LZA A;  2FXT A;  3F7X A;  1O7N B;  1BAN A;  2KCD A;  2GXF A;  2PZV A;  5D82 A;  4FR9 A;  3B4O A;  3NHX A;  3CCM 3;  1ROV A;  1WMP A;  2HML B;  3NBB A;  3PZW A;  1IVW A;  1OF5 B;  1YVB I;  2B24 B;  1EQK A;  3OXA A;  4MEI A;  1RN7 A;  3MG2 A;  4EW5 A;  2E2U A;  2W0Q A;  1Z1S A;  4XBX A;  1RHL A;  4STD A;  3ZFZ A;  1MGW A;  4BL2 A;  1UGH I;  5BIR A;  1ISK A;  4MMZ B;  1Q82 4;  1JBR A;  1DVD A;  1SJW A;  1Q81 4;  4FMB A;  1K8A 4;  1Q40 A;  2XF3 A;  5LC7 A;  3SYU A;  3CC2 3;  1AY7 A;  1IT8 A;  4RNY A;  4EV2 A;  2GBX B;  5EVH A;  3EBT A;  1YNV X;  2BMR B;  6GSP A;  4DKI A;  1Y4K A;  2YFI B;  2P0X A;  1YI2 3;  2AAD A;  2CFG A;  1V74 A;  3CNX A;  1PFP A;  3L0R A;  2ZA4 A;  1N5H A;  4HM2 B;  3CC7 3;  3LT8 A;  3ZG0 A;  2E2V A;  2OOV A;  1EUI C;  3V92 A;  3EB8 A;  4RNT A;  5JBS A;  1VQ8 3;  1QVF 2;  1D6Z A;  5BVB A;  1B21 A;  7STD A;  3EX9 A;  2WGO A;  2CC3 A;  4WWU C;  3HX8 A;  3UB1 A;  5G1K A;  1BOX A;  5IF6 A;  2UX0 A;  2XEP A;  3GZX B;  1CEW I;  1HU9 A;  2P09 A;  3OX9 A;  1YHQ 3;  1ZGX A;  1RGK A;  2P0M A;  3EJV A;  3NXJ A;  4XM4 A;  4N3V A;  3AGN A;  1UUW B;  4HAA A;  4L7K A;  5IG3 A;  1DMN A;  3K5T A;  1JNQ A;  4CPK A;  2WGQ A;  3EHC A;  4J5G A;  2IY2 A;  1W7C A;  1NWW A;  4BTW A;  5ELJ A;  4K1U A;  5STD A;  3SOY A;  1BIR A;  1VQM 3;  4HM1 B;  3FGY A;  2RBI A;  2RGQ A;  5AYR B;  3ECF A;  3JVC A;  2A15 A;  3I55 3;  1BRN L;  1ZX2 A;  2OTJ 3;  1NB5 I;  1PU4 A;  1IT7 A;  1QAK A;  3PYJ A;  3QK9 A;  2JDI H;  3D3L A;  1WNH A;  3HI7 A;  1CYU A;  1TIJ A;  1GOY A;  1WMN A;  1O7W B;  3B4P A;  1A2V A;  2D1W A;  2K54 A;  2CX1 A;  3DGO A;  1JRQ A;  1US1 A;  2IA7 A;  3OV4 A;  1D6U A;  4HM7 B;  4XB5 A;  3X3X A;  3TDG A;  1MWT A;  1T2H A;  3A76 A;  2P38 A;  4LEH A;  7GSP A;  3WOF B;  2O3O A;  3HOH A;  3GSP A;  1UI8 A;  3CCS 3;  1G02 A;  3WHO A;  3HK4 A;  1W5Z A;  3NBJ A;  1SIH A;  1RGH A;  2F99 A;  1D6Y A;  2ML5 A;  3PS8 A;  2BMQ B;  2F98 A;  2K0M A;  3BLZ A;  3WOE B;  7RNT A;  1BGS A;  4NHF A;  1BVI A;  3VGN A;  1R4Y A;  3RNT A;  5IW9 A;  4GSP A;  1YJN 3;  4X2H A;  4AKZ A;  4BL3 A;  2OCT A;  1ZS7 A;  4BTY A;  1NJI 4;  1RCK A;  1W00 A;  4GHO A;  5AEW B;  4N6N B;  2RFR A;  4U13 A;  2CHC A;  5IEO A;  2MC8 A;  9RNT A;  1N8Q A;  3CMA 3;  4H61 A;  3CNM A;  1GMP A;  1QVG 2;  1RGG A;  3ER7 A;  1TJD A;  1BSB A;  2LYX A;  4JRF A;  1GMR A;  1BNI A;  2W9P A;  3AHS A;  4LMI A;  2IUJ A;  1BSD A;  1BRJ A;  1EEJ A;  1SPU A;  1W4N A;  1LQM B;  3F8H A;  2CG1 A;  3SVA A;  1RGC A;  2IUK A;  4CCV A;  1JV2 B;  1RCL A;  1I3F A;  1BSC A;  1LOX A;  3LTD A;  3MG3 A;  2P05 A;  2SBL A;  1YJW 3;  1UCK A;  1MGR A;  5M18 A;  1O7M B;  5HGR A;  2GU1 A;  1YIJ 3;  2RSX A;  1O7G B;  2ZDJ A;  3NUV A;  2W2C A;  3F8X A;  4LYL B;  3G71 3;  2KF4 A;  1NDO B;  1LQG C;  3F9S A;  5AIG A;  3EE1 A;  4BIR A;  4HJL B;  1QAF A;  2WOH A;  2ZHX B;  1G96 A;  3NQZ A;  1KD1 4;  1JN5 B;  3PCR A;  3BND A;  3RGR A;  3WA3 A;  1GD4 A;  2CFD A;  3X40 A;  4NRE A;  1IU7 A;  1OAC A;  1JKG A;  1CH0 A;  1MWS A;  3NQY A;  1JBT A;  1I8V A;  3IMA B;  3KSP A;  2F5W A;  2HMO B;  3AMO B;  5TGN A;  3FG3 A;  1M90 4;  1DMM A;  2F4Y A;  3BNE A;  4CDL A;  3NV0 A;  1VQK 3;  3KII A;  3ROB A;  5DRV A;  1UCJ A;  2SAR A;  3N9H A;  2H0H A;  2OWP A;  1FGM A;  2UUG C;  3J7Y d;  3CCJ 3;  3PGB A;  4OK0 A;  1J2B A;  2Z6B A;  1BAO A;  1IQX A;  1IV7 A;  1STF I;  3H3H A;  1AVL A;  4MMX B;  4R4K A;  3X3Z A;  1B2X A;  6STD A;  1BU4 A;  1HZ1 A;  3WA2 X;  1JZO A;  2HMK B;  2Y73 A;  3JUQ A;  1BNJ A;  2XRX B;  3CME 3;  1M1X B;  3T8U A;  3K7C A;  1TTO A;  1QMA A;  3LT9 A;  3KSE D;  3MHE A;  1N9J A;  4O2H A;  2M7O A;  3GRD A;  3KE7 A;  5I97 A;  2W56 A;  4CJN A;  2IMJ A;  1IQY A;  5DRE A;  1I2G A;  1RRL A;  1VQN 3;  2UGI A;  1IQ8 A;  1K41 A;  1O7H B;  3K63 A;  1FGO A;  4FCJ A;  2OQE A;  2BU4 A;  3V98 A;  3AHW A;  2L1S A;  1RGA A;  1FYS A;  1SAR A;  2E2T A;  4WFO A;  1ULJ B;  1DVC A;  1A90 A;  3LH4 A;  1OF5 A;  1ULI B;  2QGU A;  1B2Z A;  3S27 A;  3F7S A;  4HM5 B;  3JUP A;  4K90 B;  2HMM B;  3D5I A;  1E3V A;  3X3Y A;  4XBT A;  1TFO A;  3NM2 A;  3GZB A;  5KP4 A;  4WHA A;  1IYY A;  4HVN A;  2YFJ B;  1JB2 A;  3G8Z A;  1RNB A;  1A2K A;  1KQS 2;  2F86 B;  3F14 A;  5CLK A;  5KP3 A;  4ORL A;  2KF6 A;  1W2B 2;  1OH0 A;  1FZU A;  1SII A;  4HZB B;  2Z7A A;  3M8C A;  3ZG5 A;  1HKX A;  1R4C A;  1S72 3;  1AV4 A;  2QIY A;  3G16 A;  1VQP 3;  1LOY A;  2L4V A;  1GOU A;  4R9K A;  4RZM A;  2W6J H;  1VQ9 3;  1W02 A;  2FGT A;  1BRS A;  2W04 A;  5GSP A;  1K28 A;  4XDW A;  1RRH A;  1X1X A;  3EN1 B;  4WYK B;  3F40 A;  3K0Z A;  1K73 4;  3WMD A;  2CG0 A;  1BSE A;  3U1W A;  2GSP A;  5AII A;  2HMN B;  3FF2 A;  3CCQ 3;  2BT3 A;  4N6M A;  1LVN A;  3KCH A;  5FGO A;  1RLS A;  5D81 A;  4IIA A;  3DZL A;  4GB5 A;  1BNG A;  1LOV A;  3EBY A;  4L8P A;  2QEX 3;  1G0T A;  1GS3 A;  3DGM A;  5IG4 A;  3DGY A;  4N6V 0;  1AR0 A;  1TUH A;  3BU4 A;  3FZW A;  5CF2 A;  3UL6 A;  3KZT A;  5IG5 A;  4J8T A;  2B1X B;  2XGN A;  5EEO A;  1T3B A;  1NU3 A;  1E3R A;  3WR2 A;  2XGL A;  1B2S A;  4KZ1 A;  1VQQ A;  2YX9 A;  1LRA A;  1UGI A;  1JB4 A;  3UJM A;  1ASK A;  3FG4 A;  2XSH B;  1AVK A;  1BRK A;  2BIR A;  3DMC A;  3MYT A;  3FCS B;  3CPO A;  3WOD G;  1W6Y A;  2KRT A;  4FCZ A;  3HII A;  3BB9 A;  4K61 A;  1FGQ A;  2I9W A;  4KVH A;  4Q53 A;  3X41 A;  2GBW B;  1EG9 B;  3Q2P A;  4EBG A;  1IVV A;  4O8S A;  1TRP A;  3T8N A;  3LTC A;  1UDI I;  2BHM A;  3FKA A;  1VQ4 3;  3DY5 A;  3CCE 3;  3URP A;  1MNL A;  4RBN A;  1LNI A;  1BRI A;  2KF3 A;  3MPH A;  1ZO2 A;  3EQQ B;  3SED A;  2CWV A;  2Y74 A;  5G1L A;  1FUW A;  1YGE A;  1GD3 A;  3A5E A;  2XR8 B;  1VZZ A;  1JKG B;  2GEX A;  3EN8 A;  1GSP A;  3OWY A;  5FW5 A;  1B27 A;  5IER A;  3SOA A;  1I2E A;  1TP6 A;  1LNH A;  1STD A;  4R9L A;  3OWS A;  1OHS A;  1RMS A;  3KFQ C;  1NB3 I;  3MKI A;  4I5Q A;  1IDP A;  1GOV A;  1W6C A;  5AIF A;  6RNT A;  2CK3 H;  3E99 A;  3FG1 A;  3MSO A;  4I4K A;  1OPY A;  2CWT A;  4K1V A;  2LQV A;  4N6O B;  1OHP A;  3S29 A;  1BUJ A; 
#chains in the Genus database with same CATH homology
 1B3S A;  2BU4 A;  1I2F A;  3AHW A;  2F56 A;  5HOH A;  1RGA A;  3D5G A;  1I0V A;  1X1U A;  1FYS A;  1SAR A;  1BIR A;  1FUT A;  2F5M A;  2RBI A;  2RNT A;  1B2Z A;  1RNT A;  1BRN L;  1DE3 A;  3D5I A;  1Q9E A;  1FUS A;  1GOY A;  1IYY A;  2HOH A;  1RNB A;  1BNE A;  1BNS A;  1LOW A;  1B20 A;  1UCL A;  1HYF A;  1C54 A;  1RN4 A;  7GSP A;  1T2H A;  1YVS A;  2KF6 A;  3HOH A;  3GSP A;  1FZU A;  1G02 A;  3WHO A;  1AQZ A;  4BU4 A;  1BRG A;  1RGH A;  1X1W A;  1UCI A;  1BGS A;  1LOY A;  4HOH A;  7RNT A;  1GOU A;  1BVI A;  1R4Y A;  3RNT A;  4GSP A;  1B2U A;  1RGF A;  1T2I A;  2AAE A;  1BRS A;  1BSA A;  3D4A A;  1RCK A;  4GHO A;  1GMQ A;  5GSP A;  1A2P A;  1RN1 A;  1X1Y A;  3Q3F A;  9RNT A;  1X1X A;  1RGL A;  1I0X A;  1GMP A;  1RGG A;  3DH2 A;  1I3I A;  1PYL A;  1BSB A;  3BIR A;  4J5K A;  5BU4 A;  1BSE A;  2KF5 A;  1BRH A;  1BNF A;  1GMR A;  2GSP A;  1FW7 A;  1BNI A;  1RDS A;  3AHS A;  1BSD A;  1BRJ A;  3KCH A;  1RLS A;  1RGC A;  1JBS A;  1RCL A;  1YGW A;  1BAN A;  1BNG A;  1BSC A;  1I3F A;  1LOV A;  1I70 A;  1UCK A;  1MGR A;  3DGY A;  3BU4 A;  1RHL A;  1RTU A;  1RGE A;  1MGW A;  2KF4 A;  1BNR A;  1B2M A;  5BIR A;  3WR2 A;  4BIR A;  1JBR A;  1B2S A;  5RNT A;  1LRA A;  3SYU A;  2BIR A;  1BRK A;  1AY7 A;  2C4B A;  1CH0 A;  1JBT A;  1PY3 A;  1I8V A;  1YNV X;  1RSN A;  2F5W A;  6GSP A;  1TRP A;  2F4Y A;  2AAD A;  1UCJ A;  2SAR A;  2ZA4 A;  3URP A;  1LNI A;  1BRI A;  2KF3 A;  4RNT A;  1BAO A;  3A5E A;  1B21 A;  3AGO A;  1B2X A;  1BU4 A;  1GSP A;  1HZ1 A;  2KAA A;  1B27 A;  1BOX A;  1BNJ A;  1I2E A;  1TRQ A;  1RMS A;  1RGK A;  1TTO A;  1ZGX A;  6RNT A;  1GOV A;  3AGN A;  4HAA A;  8RNT A;  1I2G A;  4J5G A;  1DET A;  1BUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...