2GSPA

Ribonuclease t1/2',3'-cgps and 3'-gmp, 2 days
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Hydrolysis of a slow cyclic thiophosphate substrate of RNase T1 analyzed by time-resolved crystallography.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endoribonuclease
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2gspA00
2F5MA 2C4BA 3HOHA 1RN4A 1I3IA 2BU4A 1UCJA 6RNTA 1I2EA 1BRNL 1B2UA 1Q9EA 1RCLA 3DH2A 6GSPA 3WR2A 1GMQA 2RBIA 4HAAA 4J5KA 4J5GA 5BIRA 1RGLA 1GOVA 1T2IA 1HZ1A 1B27A 1GMPA 1BNRA 1I2FA 1LOWA 3KCHA 3A5EA 1I3FA 1RSNA 3DGYA 1UCLA 1YGWA 4RNTA 1YVSA 3AHSA 1C54A 1B2XA 1LRAA 1I0VA 1A2PA 1BRSA 2F5WA 1FZUA 1T2HA 1BSBA 1BRKA 1RHLA 2KF3A 1RGAA 3D4AA 1PY3A 3Q3FA 3D5IA 2RNTA 4GSPA 4BU4A 1B2MA 4BIRA 1G02A 2BIRA 1BSEA 1RTUA 1UCKA 1FYSA 2KF4A 1BANA 1YNVX 3AGOA 1BOXA 1I70A 1X1XA 1BNSA 1BRJA 1BUJA 1HYFA 1ZGXA 1LOYA 5BU4A 1TTOA 2F4YA 1RNBA 1BSDA 1IYYA 1BGSA 1I8VA 1BRIA 3SYUA 2F56A 1LNIA 1GMRA 3AHWA 1RGEA 1BNFA 2KAAA 1MGRA 1DETA 1BNJA 1RNTA 1TRQA 5RNTA 1BSAA 1B20A 1RLSA 2ZA4A 8RNTA 1X1UA 3RNTA 1B21A 3BIRA 3BU4A 1BVIA 1GSPA 3AGNA 1RGFA 9RNTA 2HOHA 1I0XA 1FUSA 1JBSA 1FUTA 2AADA 1RMSA 1BSCA 2AAEA 1AQZA 1RDSA 1RGCA 1GOYA 1UCIA 1B3SA 2SARA 2KF6A 1JBTA 1B2ZA 1MGWA 1X1WA 7RNTA 1RCKA 1BNEA 1BRGA 1TRPA 1BAOA 1RGKA 3GSPA 1X1YA 1BNIA 4GHOA 1BRHA 1BU4A 4HOHA 1B2SA 1JBRA 1RN1A 1CH0A 1DE3A 1RGHA 1R4YA 3URPA 1RGGA 3WHOA 1AY7A 2GSPA 1GOUA 1I2GA 1BNGA 5GSPA 1LOVA 3D5GA 1SARA 5HOHA 7GSPA 1BIRA 1PYLA 1FW7A 2KF5A
chains in the Genus database with same CATH superfamily
1FGQA 4BTWA 2ZHXB 1F8NA 5M1AA 4R9KA 3WOEB 1IK3A 1BRNL 6STDA 1SQWA 1DMMA 1O7NB 4IPBA 3WR2A 1GMQA 1N5PA 2RBIA 4HAAA 4J5GA 1W2B2 1JZOA 1HKXA 2OOVA 1US1A 1JJ22 1GMPA 1SJWA 2E2UA 3FCSB 5STDA 4AEQA 1BNRA 4KFDA 2O3OA 3UJMA 3CCR3 3V99A 2XGNA 3NQYA 1GS3A 1N8QA 3AHSA 1C54A 4FMCA 1NDOB 4WFOA 1FZUA 1UGIA 1WMOA 4HJLB 3CC43 1PY3A 3KN4A 2C10A 3S29A 3LMLA 3D5IA 4H61A 2HMNB 3LH4A 1VQM3 4GSPA 4JF8A 1B2MA 3UNLA 5HGRA 3FLJA 3NM7A 2QA43 4U13A 5TGNA 4WWUC 1FGOA 5KP3A 4R9LA 3CC73 2KF4A 1OACA 4XBXA 1V58A 1YNVX 1BNSA 1M1K4 2Z77A 4H3UA 1HYFA 2CW9A 1RRHA 3X3XA 2FGTA 2ZL8A 3LYGA 3NXJA 3OV4A 3QRDA 5BVBA 1YJW3 1RNBA 2INXA 1BGSA 1OGZA 2LQVA 3CCV3 1YIJ3 1YVBI 4EW5A 3SYUA 2F56A 1LNIA 3NV0B 4RBNA 1PU4A 1GMRA 4FCZA 1YHQ3 1FW7A 4X2HA 5AYSC 3S5CA 2RFRA 3X3YA 3I563 3EX9A 1YJN3 2CWUA 5D83A 1OF5A 1BNJA 1TRQA 1B20A 1VQL3 1AVLA 3F40A 2ZA4A 1OH0A 4CJNA 1JV2B 3SVAA 2OTJ3 3LT8A 2CFGA 2KXGA 3RNTA 1VQK3 4KFFA 5LC6A 1BVIA 1G96A 3F8HA 1E3VA 1RGFA 1RRLA 1LNHA 1O7MB 2BMOB 4OVMA 1JN5A 2PNCA 3OW22 1KQS2 1ROAA 3HI7A 3B7CA 3F9SA 4LMIA 2J8XB 3DGOA 2CC3A 3BNDA 2E2TA 2UUGC 3D3LA 3CCE3 4ORLA 4HM7B 1B3SA 1VQ53 3S28A 3JUMA 3BNEA 2GEXA 3UL6A 2HMMB 2V1LA 4WYKA 4O3VA 1Q40B 1X1WA 5EVHA 1BNEA 1TRPA 3EHCA 1MWUA 3DGMA 1W6GA 3CNXA 1RGKA 3M8CA 1IU7A 1TFKA 3WDGB 5CF2A 1BNIA 4OUQA 2XGLA 1VQP3 3PXMA 3HK4A 3KE7A 4O8SA 3ECFA 3BNBA 1YIT3 2B24B 4XDVA 1ROVA 1QVF2 1JBRA 1N9EA 3EN8A 3STDA 2OCTA 3CCL3 4R80A 4GL6A 1RGHA 3RGRA 4HM0B 3URPA 1RGGA 1UGHI 2OTL3 2W0QA 2YFLB 4LYLB 4RNYA 2W6JH 3LTDA 3WHOA 3MWZA 5BXQA 2CH9A 5GSPA 3D5GA 4CDLA 3H51A 2XR8B 3DXOA 5HOHA 4TX4A 1A2VA 3LZAA 1L5GB 3HX8A 5FGOA 1T5YA 3OWUA 4HYZA 1DVDA 5M19A 1M904 3EBYA 3PGBA 1NB5I 5ELJA 5G1KA 1UCJA 2WOHA 1I2EA 2BMRB 2W56B 3V92A 6RNTA 1MNLA 4MMZB 1WTHA 4XB5A 6GSPA 2HMOB 2W2CA 4J5KA 5BIRA 1IV7A 1T2IA 2XSHB 1HZ1A 4LGQA 4EC6A 2HMJB 2I9WA 1S5AA 1Q42A 4EV5A 3EB8A 1LOWA 3KCHA 3MG2A 5A0OB 1ISKA 1N9JA 3FZWA 3DGYA 3PZWA 2XRXB 3SOAA 1N8R4 4RNTA 5I97A 5CK6A 2W9PA 5IW9A 1B2XA 3KSED 2D1WA 1I0VA 1A2PA 1O7PB 3S67A 1LXEA 1T2HA 3NV0A 3LT9A 1IQ8A 1BSBA 1A67A 3ER7A 4HM4B 3D4AA 3FF2A 2GU1A 3Q3FA 1TIJA 4N6MA 2RNTA 3VSYA 1N5HA 2OOVC 4BU4A 2SBLA 1AVKA 4BIRA 2BIRA 2Z6BA 3NQZA 1BSEA 1LQGC 1GY7A 1RTUA 3NBBA 3I0YA 4L8OA 2YFJB 4HM8B 4RNZA 4BL2A 3CCQ3 4HVNA 1BANA 1OHPA 3AGOA 2ZDJA 1QMAA 1BUJA 1UDII 4QWTA 3GZYB 1Q864 3CCJ3 1LOYA 2XEPA 3GZXB 2F4YA 2D42A 4PEJA 2XF3A 1IYYA 1NWWA 1STDA 4GB5A 2BHMA 4O02B 1RGEA 3VGNA 1OUNA 1A2KA 3HIGA 3UB1A 1K8A4 5RNTA 1RNTA 2CX1A 3FG4A 1K9M4 2A15A 3JUPA 3DUKA 4HM1B 3GZRA 4XM4A 3BIRA 4N6NB 3MSOA 2GBWB 4N6TA 3T0UA 3MYTA 1GSPA 3AGNA 2QEX3 3K9MC 5CXOA 2HOHA 8CHOA 1IVUA 1FUTA 3HZPA 1BSCA 4FCMA 4FR9A 3I553 3DM8A 1AR0A 3IJEB 3NX0A 1AQZA 4HM3B 1RDSA 3K0ZA 2CG1A 3WOFB 2IUKA 5DREA 1SIIA 1MOLA 1TFOA 1UCIA 3RDEA 2R41A 2P09A 2BT3A 1K41A 3FG1A 2WGOA 2H0IA 3GZBA 1UUWB 3EJVA 1RCKA 4L8PA 2IA7A 1QJGA 4BL3A 4KVHA 3SXXA 1BAOA 2GBXB 1GY6A 1ASKA 1JB5A 3GSPA 3OWYA 1D6ZA 5AEWB 2F99A 1J2BA 3T8UA 4HM5B 1BU4A 1VQ63 4CCVA 3WA3A 3A76A 1W4NA 2IYJA 1W7CA 1BUQA 1NO3A 4N6LA 1B2SA 1CYVA 3D79A 3CMA3 1RN1A 1OHSA 3Q1CA 2WGQA 2E2VA 3JUQA 1W6YA 2RSXA 1DE3A 3PCRA 4K61A 3K63A 4STDA 2BNGA 2F98A 1QALA 4LEHA 3V98A 2XSOB 3EC9A 1RJOA 4BTYA 1U8CB 1K28A 1DMQA 2GSPA 3TDGA 2LYXA 2OQEC 1BNGA 3EE1A 1IVXA 1LOVA 3NBJA 1SARA 4DKIA 5IG5A 5IF6A 4K90B 3AMOB 2CWVA 3G16A 7GSPA 1IVWA 1CYUA 2L4VA 1BIRA 3FG3A 2OQEA 2K0MA 5BU4A 3X42A 1O7GB 4N3VA 2CWTA 2C4BA 1RN4A 1I3IA 1NU3A 2IY2A 2P38A 3MPHA 1K734 1Q7Y4 1Q9EA 1RCLA 2CHCA 3SLUA 3FH1A 1Z1SA 3NBRA 2IUJA 3X40A 5AIIA 3CCM3 1PFPA 3KZTA 1STFI 3F7SA 3K7CA 1VQ73 3H3HA 3KKGA 3OWSA 1U5OA 1AV4A 4AKYA 3PYJA 1I2FA 1I3FA 3D9RA 3KIIA 1QAFA 1UCLA 1YGWA 3EF8A 4ZM8A 2P0MA 1ULJB 1KWIA 3MG1A 5LC7A 5JBSA 1VQN3 2F5WA 1EQKA 1IV9A 3K5TA 1GYBA 2KF3A 4X2OA 3BLZA 1RGAA 1WNHA 1OCVA 3B4PA 4MMXB 3DGNA 1O7HB 4MJDA 2OWPA 3DY5A 4KZ1A 1FGMA 4HKVB 3MG3A 2CFKA 1IDPA 3WA2X 5G2GA 1KD14 1ZX2A 1VQ43 1FUWA 1BOXA 3MKIA 1O7WB 2RCDA 1BRJA 4WP5A 1ZGXA 1TTOA 3U1WA 4HM6B 1I8VA 3N54B 1BRIA 1OF5B 5IEPA 3RGAA 1CQSA 1W00A 3CME3 2CK3H 3AHWA 5ELUA 5JPUA 1V74A 1C7HA 1BNFA 2KAAA 5AIHA 1MGRA 1WQLB 1DETA 4BTXA 2W03A 1JRQA 3ALAA 1BSAA 1RLSA 3SX1A 8RNTA 4IIAA 1X1UA 1B21A 1EKMA 1YJ93 3NHXA 5AYRB 1LOXA 3O8YA 3PCSA 3G6E3 4CPKA 1S723 9RNTA 3CD63 1JBSA 1FGTA 2R4IA 4MEIA 2ML5A 1WMPA 4KFEA 4FMAA 4WYKB 3X3ZA 4XBYA 2STDA 3DGLA 3Q90A 4N6V0 1IQXA 1MWTA 2SARA 1B2ZA 2QIYA 3JUNA 4MMYB 1G0TA 4RZMA 7RNTA 3IPTA 1HU9A 1W5ZA 2XFSA 1DMNA 1BRGA 3LTBA 4KT3B 3NM2A 1M9GA 2MC8A 1IT8A 3AMOA 1MWRA 3FGYA 3OXAA 2WOFA 2W9QA 1TJDA 1Q40A 3F7XA 1Y4KA 4J8TA 3SOYA 3S27A 1FA3A 3IMAB 5IG3A 1D6UA 3N9HA 4XDWA 1CEWI 4EBGA 3FKAA 4JRFA 4NHFA 3T8NA 1DYUA 4EXRA 1W6CA 2CFDA 1SPUA 3JUOA 4L7KA 5EQLA 2GXFA 5JPPA 3F8XA 5AI1A 4EV2A 3EBTA 1T3BA 2XFTA 4HZBB 1Q824 1GOUA 1GD4A 1I2GA 2BMQB 2CFWA 5CLKA 5M18A 1KSIA 2Y73A 1X1XA 2C11A 1PYLA 3CXC2 5AIFA 2CFLA 2F5MA 4G1MB 2GU3A 3CCS3 3HOHA 2M7OA 4IT7A 2HMKB 4N6OB 1VZZA 1E97A 2BU4A 2UX0A 2JQ5A 1DVCA 3PS8A 3J7Yd 1B2UA 4EYCA 3DH2A 1UUGB 4J9AA 1JZDA 1JB4A 5IENA 1UUVB 1RGLA 1GOVA 2CG0A 3G8ZA 2W56A 2K3DA 1B27A 5FW5A 5D81A 4HM2B 4K1VA 1W01A 3A5EA 3CNMA 1RSNA 2W04A 5IEOA 2Z7AA 1RKYA 1JKGB 1TUHA 1YVSA 3CU3A 3LOYA 5IG4A 4XBTA 1LRAA 1JB2A 4R1KA 2IMJA 1NB3I 2YX9A 1BRSA 1NNVA 3E99A 1IT7A 3GAXA 4NREA 2P05A 3X41A 1VQO3 3NUVA 1BRKA 1RHLA 3GRDA 1VQ83 1GD3A 1W2ZA 1V57A 2XH9A 2H0GA 3G0KA 3JVCA 1UI8A 2KRTA 5DRVA 7STDA 4K1UA 3CPOA 3B8LA 1G02A 2JDIH 1W02A 2KCDA 2RGQA 3LTAA 3BB9A 3WODG 4FMBA 1UCKA 1FYSA 1D6YA 5KP4A 1Q814 3OX9A 1I70A 2CX0A 2ML6A 2P0XA 2WO0A 4WHAA 1IQYA 4FCJA 4R4KA 4OK0A 1BSDA 4I5QA 5AIGA 1JNQA 4LZIA 1FGRA 1YI23 2O9UX 1UW1A 3MHEA 4Q53A 4HZ9B 2H0HA 2FXTA 1VQQA 2YFIB 3KSPA 1ZO2A 4I4KA 2QGUA 5KP1A 4FMDA 2GEYA 3BU4A 4ILFA 3FF0A 5IG0A 5AEUB 2PZVA 3N8BA 1I0XA 2CIUA 1FUSA 1ULIB 5G1LA 3VF1A 3SEDA 1OPYA 3ZG0A 2AADA 1RMSA 1LQMB 1Q7HA 2F86B 3GWRA 3KFQC 3QK9A 1QAKA 1TU5A 1KC84 1NJI4 2AAEA 1GY5A 2HMLB 1EG9B 1RGCA 4LSOA 1MWSA 4N6UA 1GOYA 3ZFZA 2KF6A 1JBTA 1R4CA 2L1SA 3UL5A 1YGEA 1MGWA 3LXUX 1IVVA 2MF7A 4NPBA 2K54A 2FNQA 4O2HA 3CC23 1OHOA 2CKFB 3WMDA 1VQ93 1OGXA 1TP6A 1ZS7A 1EUIC 1X1YA 2Y74A 3FSDA 1UI7A 4GHOA 1JN5B 5D82A 5CF1A 1BRHA 3BNCA 3LTCA 3F14A 3ROBA 3CCU3 1WMNA 1RN7A 1SIHA 1LVNA 4HOHA 3B4OA 3L0RA 3G713 3ZG5A 3Q2PA 4HBRA 3HIIA 3U97A 3CPW2 1CH0A 3EQQB 1QVG2 1R4YA 3DMCA 1M1XB 1EEJA 3EN1B 1A90A 1E3RA 1EA2A 2Z76A 1AY7A 2BO9B 5EEOA 2B1XB 3DZLA 5IERA 3G4S3 4AKZA 2Q07A 1JKGA 2UGIA 2KF5A
chains in the Genus database with same CATH topology
2F5MA 2C4BA 3HOHA 1RN4A 1I3IA 2BU4A 1UCJA 6RNTA 1I2EA 1BRNL 1B2UA 1Q9EA 1RCLA 3DH2A 6GSPA 3WR2A 1GMQA 2RBIA 4HAAA 4J5KA 4J5GA 5BIRA 1RGLA 1GOVA 1T2IA 1HZ1A 1B27A 1GMPA 1BNRA 1I2FA 1LOWA 3KCHA 3A5EA 1I3FA 1RSNA 3DGYA 1UCLA 1YGWA 4RNTA 1YVSA 3AHSA 1C54A 1B2XA 1LRAA 1I0VA 1A2PA 1BRSA 2F5WA 1FZUA 1T2HA 1BSBA 1BRKA 1RHLA 2KF3A 1RGAA 3D4AA 1PY3A 3Q3FA 3D5IA 2RNTA 4GSPA 4BU4A 1B2MA 4BIRA 1G02A 2BIRA 1BSEA 1RTUA 1UCKA 1FYSA 2KF4A 1BANA 1YNVX 3AGOA 1BOXA 1I70A 1X1XA 1BNSA 1BRJA 1BUJA 1HYFA 1ZGXA 1LOYA 5BU4A 1TTOA 2F4YA 1RNBA 1BSDA 1IYYA 1BGSA 1I8VA 1BRIA 3SYUA 2F56A 1LNIA 1GMRA 3AHWA 1RGEA 1BNFA 2KAAA 1MGRA 1DETA 1BNJA 1RNTA 1TRQA 5RNTA 1BSAA 1B20A 1RLSA 2ZA4A 8RNTA 1X1UA 3RNTA 1B21A 3BIRA 3BU4A 1BVIA 1GSPA 3AGNA 1RGFA 9RNTA 2HOHA 1I0XA 1FUSA 1JBSA 1FUTA 2AADA 1RMSA 1BSCA 2AAEA 1AQZA 1RDSA 1RGCA 1GOYA 1UCIA 1B3SA 2SARA 2KF6A 1JBTA 1B2ZA 1MGWA 1X1WA 7RNTA 1RCKA 1BNEA 1BRGA 1TRPA 1BAOA 1RGKA 3GSPA 1X1YA 1BNIA 4GHOA 1BRHA 1BU4A 4HOHA 1B2SA 1JBRA 1RN1A 1CH0A 1DE3A 1RGHA 1R4YA 3URPA 1RGGA 3WHOA 1AY7A 2GSPA 1GOUA 1I2GA 1BNGA 5GSPA 1LOVA 3D5GA 1SARA 5HOHA 7GSPA 1BIRA 1PYLA 1FW7A 2KF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5M A;  2C4B A;  3HOH A;  1RN4 A;  1I3I A;  2BU4 A;  1UCJ A;  6RNT A;  1I2E A;  1BRN L;  1B2U A;  1Q9E A;  1RCL A;  3DH2 A;  6GSP A;  3WR2 A;  1GMQ A;  2RBI A;  4HAA A;  4J5K A;  4J5G A;  5BIR A;  1RGL A;  1GOV A;  1T2I A;  1HZ1 A;  1B27 A;  1GMP A;  1BNR A;  1I2F A;  1LOW A;  3KCH A;  3A5E A;  1I3F A;  1RSN A;  3DGY A;  1UCL A;  1YGW A;  4RNT A;  1YVS A;  3AHS A;  1C54 A;  1B2X A;  1LRA A;  1I0V A;  1A2P A;  1BRS A;  2F5W A;  1FZU A;  1T2H A;  1BSB A;  1BRK A;  1RHL A;  2KF3 A;  1RGA A;  3D4A A;  1PY3 A;  3Q3F A;  3D5I A;  2RNT A;  4GSP A;  4BU4 A;  1B2M A;  4BIR A;  1G02 A;  2BIR A;  1BSE A;  1RTU A;  1UCK A;  1FYS A;  2KF4 A;  1BAN A;  1YNV X;  3AGO A;  1BOX A;  1I70 A;  1X1X A;  1BNS A;  1BRJ A;  1BUJ A;  1HYF A;  1ZGX A;  1LOY A;  5BU4 A;  1TTO A;  2F4Y A;  1RNB A;  1BSD A;  1IYY A;  1BGS A;  1I8V A;  1BRI A;  3SYU A;  2F56 A;  1LNI A;  1GMR A;  3AHW A;  1RGE A;  1BNF A;  2KAA A;  1MGR A;  1DET A;  1BNJ A;  1RNT A;  1TRQ A;  5RNT A;  1BSA A;  1B20 A;  1RLS A;  2ZA4 A;  8RNT A;  1X1U A;  3RNT A;  1B21 A;  3BIR A;  3BU4 A;  1BVI A;  1GSP A;  3AGN A;  1RGF A;  9RNT A;  2HOH A;  1I0X A;  1FUS A;  1JBS A;  1FUT A;  2AAD A;  1RMS A;  1BSC A;  2AAE A;  1AQZ A;  1RDS A;  1RGC A;  1GOY A;  1UCI A;  1B3S A;  2SAR A;  2KF6 A;  1JBT A;  1B2Z A;  1MGW A;  1X1W A;  7RNT A;  1RCK A;  1BNE A;  1BRG A;  1TRP A;  1BAO A;  1RGK A;  3GSP A;  1X1Y A;  1BNI A;  4GHO A;  1BRH A;  1BU4 A;  4HOH A;  1B2S A;  1JBR A;  1RN1 A;  1CH0 A;  1DE3 A;  1RGH A;  1R4Y A;  3URP A;  1RGG A;  3WHO A;  1AY7 A;  2GSP A;  1GOU A;  1I2G A;  1BNG A;  5GSP A;  1LOV A;  3D5G A;  1SAR A;  5HOH A;  7GSP A;  1BIR A;  1PYL A;  1FW7 A;  2KF5 A; 
#chains in the Genus database with same CATH topology
 1FGQ A;  4BTW A;  2ZHX B;  1F8N A;  5M1A A;  4R9K A;  3WOE B;  1IK3 A;  1BRN L;  6STD A;  1SQW A;  1DMM A;  1O7N B;  4IPB A;  3WR2 A;  1GMQ A;  1N5P A;  2RBI A;  4HAA A;  4J5G A;  1W2B 2;  1JZO A;  1HKX A;  2OOV A;  1US1 A;  1JJ2 2;  1GMP A;  1SJW A;  2E2U A;  3FCS B;  5STD A;  4AEQ A;  1BNR A;  4KFD A;  2O3O A;  3UJM A;  3CCR 3;  3V99 A;  2XGN A;  3NQY A;  1GS3 A;  1N8Q A;  3AHS A;  1C54 A;  4FMC A;  1NDO B;  4WFO A;  1FZU A;  1UGI A;  1WMO A;  4HJL B;  3CC4 3;  1PY3 A;  3KN4 A;  2C10 A;  3S29 A;  3LML A;  3D5I A;  4H61 A;  2HMN B;  3LH4 A;  1VQM 3;  4GSP A;  4JF8 A;  1B2M A;  3UNL A;  5HGR A;  3FLJ A;  3NM7 A;  2QA4 3;  4U13 A;  5TGN A;  4WWU C;  1FGO A;  5KP3 A;  4R9L A;  3CC7 3;  2KF4 A;  1OAC A;  4XBX A;  1V58 A;  1YNV X;  1BNS A;  1M1K 4;  2Z77 A;  4H3U A;  1HYF A;  2CW9 A;  1RRH A;  3X3X A;  2FGT A;  2ZL8 A;  3LYG A;  3NXJ A;  3OV4 A;  3QRD A;  5BVB A;  1YJW 3;  1RNB A;  2INX A;  1BGS A;  1OGZ A;  2LQV A;  3CCV 3;  1YIJ 3;  1YVB I;  4EW5 A;  3SYU A;  2F56 A;  1LNI A;  3NV0 B;  4RBN A;  1PU4 A;  1GMR A;  4FCZ A;  1YHQ 3;  1FW7 A;  4X2H A;  5AYS C;  3S5C A;  2RFR A;  3X3Y A;  3I56 3;  3EX9 A;  1YJN 3;  2CWU A;  5D83 A;  1OF5 A;  1BNJ A;  1TRQ A;  1B20 A;  1VQL 3;  1AVL A;  3F40 A;  2ZA4 A;  1OH0 A;  4CJN A;  1JV2 B;  3SVA A;  2OTJ 3;  3LT8 A;  2CFG A;  2KXG A;  3RNT A;  1VQK 3;  4KFF A;  5LC6 A;  1BVI A;  1G96 A;  3F8H A;  1E3V A;  1RGF A;  1RRL A;  1LNH A;  1O7M B;  2BMO B;  4OVM A;  1JN5 A;  2PNC A;  3OW2 2;  1KQS 2;  1ROA A;  3HI7 A;  3B7C A;  3F9S A;  4LMI A;  2J8X B;  3DGO A;  2CC3 A;  3BND A;  2E2T A;  2UUG C;  3D3L A;  3CCE 3;  4ORL A;  4HM7 B;  1B3S A;  1VQ5 3;  3S28 A;  3JUM A;  3BNE A;  2GEX A;  3UL6 A;  2HMM B;  2V1L A;  4WYK A;  4O3V A;  1Q40 B;  1X1W A;  5EVH A;  1BNE A;  1TRP A;  3EHC A;  1MWU A;  3DGM A;  1W6G A;  3CNX A;  1RGK A;  3M8C A;  1IU7 A;  1TFK A;  3WDG B;  5CF2 A;  1BNI A;  4OUQ A;  2XGL A;  1VQP 3;  3PXM A;  3HK4 A;  3KE7 A;  4O8S A;  3ECF A;  3BNB A;  1YIT 3;  2B24 B;  4XDV A;  1ROV A;  1QVF 2;  1JBR A;  1N9E A;  3EN8 A;  3STD A;  2OCT A;  3CCL 3;  4R80 A;  4GL6 A;  1RGH A;  3RGR A;  4HM0 B;  3URP A;  1RGG A;  1UGH I;  2OTL 3;  2W0Q A;  2YFL B;  4LYL B;  4RNY A;  2W6J H;  3LTD A;  3WHO A;  3MWZ A;  5BXQ A;  2CH9 A;  5GSP A;  3D5G A;  4CDL A;  3H51 A;  2XR8 B;  3DXO A;  5HOH A;  4TX4 A;  1A2V A;  3LZA A;  1L5G B;  3HX8 A;  5FGO A;  1T5Y A;  3OWU A;  4HYZ A;  1DVD A;  5M19 A;  1M90 4;  3EBY A;  3PGB A;  1NB5 I;  5ELJ A;  5G1K A;  1UCJ A;  2WOH A;  1I2E A;  2BMR B;  2W56 B;  3V92 A;  6RNT A;  1MNL A;  4MMZ B;  1WTH A;  4XB5 A;  6GSP A;  2HMO B;  2W2C A;  4J5K A;  5BIR A;  1IV7 A;  1T2I A;  2XSH B;  1HZ1 A;  4LGQ A;  4EC6 A;  2HMJ B;  2I9W A;  1S5A A;  1Q42 A;  4EV5 A;  3EB8 A;  1LOW A;  3KCH A;  3MG2 A;  5A0O B;  1ISK A;  1N9J A;  3FZW A;  3DGY A;  3PZW A;  2XRX B;  3SOA A;  1N8R 4;  4RNT A;  5I97 A;  5CK6 A;  2W9P A;  5IW9 A;  1B2X A;  3KSE D;  2D1W A;  1I0V A;  1A2P A;  1O7P B;  3S67 A;  1LXE A;  1T2H A;  3NV0 A;  3LT9 A;  1IQ8 A;  1BSB A;  1A67 A;  3ER7 A;  4HM4 B;  3D4A A;  3FF2 A;  2GU1 A;  3Q3F A;  1TIJ A;  4N6M A;  2RNT A;  3VSY A;  1N5H A;  2OOV C;  4BU4 A;  2SBL A;  1AVK A;  4BIR A;  2BIR A;  2Z6B A;  3NQZ A;  1BSE A;  1LQG C;  1GY7 A;  1RTU A;  3NBB A;  3I0Y A;  4L8O A;  2YFJ B;  4HM8 B;  4RNZ A;  4BL2 A;  3CCQ 3;  4HVN A;  1BAN A;  1OHP A;  3AGO A;  2ZDJ A;  1QMA A;  1BUJ A;  1UDI I;  4QWT A;  3GZY B;  1Q86 4;  3CCJ 3;  1LOY A;  2XEP A;  3GZX B;  2F4Y A;  2D42 A;  4PEJ A;  2XF3 A;  1IYY A;  1NWW A;  1STD A;  4GB5 A;  2BHM A;  4O02 B;  1RGE A;  3VGN A;  1OUN A;  1A2K A;  3HIG A;  3UB1 A;  1K8A 4;  5RNT A;  1RNT A;  2CX1 A;  3FG4 A;  1K9M 4;  2A15 A;  3JUP A;  3DUK A;  4HM1 B;  3GZR A;  4XM4 A;  3BIR A;  4N6N B;  3MSO A;  2GBW B;  4N6T A;  3T0U A;  3MYT A;  1GSP A;  3AGN A;  2QEX 3;  3K9M C;  5CXO A;  2HOH A;  8CHO A;  1IVU A;  1FUT A;  3HZP A;  1BSC A;  4FCM A;  4FR9 A;  3I55 3;  3DM8 A;  1AR0 A;  3IJE B;  3NX0 A;  1AQZ A;  4HM3 B;  1RDS A;  3K0Z A;  2CG1 A;  3WOF B;  2IUK A;  5DRE A;  1SII A;  1MOL A;  1TFO A;  1UCI A;  3RDE A;  2R41 A;  2P09 A;  2BT3 A;  1K41 A;  3FG1 A;  2WGO A;  2H0I A;  3GZB A;  1UUW B;  3EJV A;  1RCK A;  4L8P A;  2IA7 A;  1QJG A;  4BL3 A;  4KVH A;  3SXX A;  1BAO A;  2GBX B;  1GY6 A;  1ASK A;  1JB5 A;  3GSP A;  3OWY A;  1D6Z A;  5AEW B;  2F99 A;  1J2B A;  3T8U A;  4HM5 B;  1BU4 A;  1VQ6 3;  4CCV A;  3WA3 A;  3A76 A;  1W4N A;  2IYJ A;  1W7C A;  1BUQ A;  1NO3 A;  4N6L A;  1B2S A;  1CYV A;  3D79 A;  3CMA 3;  1RN1 A;  1OHS A;  3Q1C A;  2WGQ A;  2E2V A;  3JUQ A;  1W6Y A;  2RSX A;  1DE3 A;  3PCR A;  4K61 A;  3K63 A;  4STD A;  2BNG A;  2F98 A;  1QAL A;  4LEH A;  3V98 A;  2XSO B;  3EC9 A;  1RJO A;  4BTY A;  1U8C B;  1K28 A;  1DMQ A;  2GSP A;  3TDG A;  2LYX A;  2OQE C;  1BNG A;  3EE1 A;  1IVX A;  1LOV A;  3NBJ A;  1SAR A;  4DKI A;  5IG5 A;  5IF6 A;  4K90 B;  3AMO B;  2CWV A;  3G16 A;  7GSP A;  1IVW A;  1CYU A;  2L4V A;  1BIR A;  3FG3 A;  2OQE A;  2K0M A;  5BU4 A;  3X42 A;  1O7G B;  4N3V A;  2CWT A;  2C4B A;  1RN4 A;  1I3I A;  1NU3 A;  2IY2 A;  2P38 A;  3MPH A;  1K73 4;  1Q7Y 4;  1Q9E A;  1RCL A;  2CHC A;  3SLU A;  3FH1 A;  1Z1S A;  3NBR A;  2IUJ A;  3X40 A;  5AII A;  3CCM 3;  1PFP A;  3KZT A;  1STF I;  3F7S A;  3K7C A;  1VQ7 3;  3H3H A;  3KKG A;  3OWS A;  1U5O A;  1AV4 A;  4AKY A;  3PYJ A;  1I2F A;  1I3F A;  3D9R A;  3KII A;  1QAF A;  1UCL A;  1YGW A;  3EF8 A;  4ZM8 A;  2P0M A;  1ULJ B;  1KWI A;  3MG1 A;  5LC7 A;  5JBS A;  1VQN 3;  2F5W A;  1EQK A;  1IV9 A;  3K5T A;  1GYB A;  2KF3 A;  4X2O A;  3BLZ A;  1RGA A;  1WNH A;  1OCV A;  3B4P A;  4MMX B;  3DGN A;  1O7H B;  4MJD A;  2OWP A;  3DY5 A;  4KZ1 A;  1FGM A;  4HKV B;  3MG3 A;  2CFK A;  1IDP A;  3WA2 X;  5G2G A;  1KD1 4;  1ZX2 A;  1VQ4 3;  1FUW A;  1BOX A;  3MKI A;  1O7W B;  2RCD A;  1BRJ A;  4WP5 A;  1ZGX A;  1TTO A;  3U1W A;  4HM6 B;  1I8V A;  3N54 B;  1BRI A;  1OF5 B;  5IEP A;  3RGA A;  1CQS A;  1W00 A;  3CME 3;  2CK3 H;  3AHW A;  5ELU A;  5JPU A;  1V74 A;  1C7H A;  1BNF A;  2KAA A;  5AIH A;  1MGR A;  1WQL B;  1DET A;  4BTX A;  2W03 A;  1JRQ A;  3ALA A;  1BSA A;  1RLS A;  3SX1 A;  8RNT A;  4IIA A;  1X1U A;  1B21 A;  1EKM A;  1YJ9 3;  3NHX A;  5AYR B;  1LOX A;  3O8Y A;  3PCS A;  3G6E 3;  4CPK A;  1S72 3;  9RNT A;  3CD6 3;  1JBS A;  1FGT A;  2R4I A;  4MEI A;  2ML5 A;  1WMP A;  4KFE A;  4FMA A;  4WYK B;  3X3Z A;  4XBY A;  2STD A;  3DGL A;  3Q90 A;  4N6V 0;  1IQX A;  1MWT A;  2SAR A;  1B2Z A;  2QIY A;  3JUN A;  4MMY B;  1G0T A;  4RZM A;  7RNT A;  3IPT A;  1HU9 A;  1W5Z A;  2XFS A;  1DMN A;  1BRG A;  3LTB A;  4KT3 B;  3NM2 A;  1M9G A;  2MC8 A;  1IT8 A;  3AMO A;  1MWR A;  3FGY A;  3OXA A;  2WOF A;  2W9Q A;  1TJD A;  1Q40 A;  3F7X A;  1Y4K A;  4J8T A;  3SOY A;  3S27 A;  1FA3 A;  3IMA B;  5IG3 A;  1D6U A;  3N9H A;  4XDW A;  1CEW I;  4EBG A;  3FKA A;  4JRF A;  4NHF A;  3T8N A;  1DYU A;  4EXR A;  1W6C A;  2CFD A;  1SPU A;  3JUO A;  4L7K A;  5EQL A;  2GXF A;  5JPP A;  3F8X A;  5AI1 A;  4EV2 A;  3EBT A;  1T3B A;  2XFT A;  4HZB B;  1Q82 4;  1GOU A;  1GD4 A;  1I2G A;  2BMQ B;  2CFW A;  5CLK A;  5M18 A;  1KSI A;  2Y73 A;  1X1X A;  2C11 A;  1PYL A;  3CXC 2;  5AIF A;  2CFL A;  2F5M A;  4G1M B;  2GU3 A;  3CCS 3;  3HOH A;  2M7O A;  4IT7 A;  2HMK B;  4N6O B;  1VZZ A;  1E97 A;  2BU4 A;  2UX0 A;  2JQ5 A;  1DVC A;  3PS8 A;  3J7Y d;  1B2U A;  4EYC A;  3DH2 A;  1UUG B;  4J9A A;  1JZD A;  1JB4 A;  5IEN A;  1UUV B;  1RGL A;  1GOV A;  2CG0 A;  3G8Z A;  2W56 A;  2K3D A;  1B27 A;  5FW5 A;  5D81 A;  4HM2 B;  4K1V A;  1W01 A;  3A5E A;  3CNM A;  1RSN A;  2W04 A;  5IEO A;  2Z7A A;  1RKY A;  1JKG B;  1TUH A;  1YVS A;  3CU3 A;  3LOY A;  5IG4 A;  4XBT A;  1LRA A;  1JB2 A;  4R1K A;  2IMJ A;  1NB3 I;  2YX9 A;  1BRS A;  1NNV A;  3E99 A;  1IT7 A;  3GAX A;  4NRE A;  2P05 A;  3X41 A;  1VQO 3;  3NUV A;  1BRK A;  1RHL A;  3GRD A;  1VQ8 3;  1GD3 A;  1W2Z A;  1V57 A;  2XH9 A;  2H0G A;  3G0K A;  3JVC A;  1UI8 A;  2KRT A;  5DRV A;  7STD A;  4K1U A;  3CPO A;  3B8L A;  1G02 A;  2JDI H;  1W02 A;  2KCD A;  2RGQ A;  3LTA A;  3BB9 A;  3WOD G;  4FMB A;  1UCK A;  1FYS A;  1D6Y A;  5KP4 A;  1Q81 4;  3OX9 A;  1I70 A;  2CX0 A;  2ML6 A;  2P0X A;  2WO0 A;  4WHA A;  1IQY A;  4FCJ A;  4R4K A;  4OK0 A;  1BSD A;  4I5Q A;  5AIG A;  1JNQ A;  4LZI A;  1FGR A;  1YI2 3;  2O9U X;  1UW1 A;  3MHE A;  4Q53 A;  4HZ9 B;  2H0H A;  2FXT A;  1VQQ A;  2YFI B;  3KSP A;  1ZO2 A;  4I4K A;  2QGU A;  5KP1 A;  4FMD A;  2GEY A;  3BU4 A;  4ILF A;  3FF0 A;  5IG0 A;  5AEU B;  2PZV A;  3N8B A;  1I0X A;  2CIU A;  1FUS A;  1ULI B;  5G1L A;  3VF1 A;  3SED A;  1OPY A;  3ZG0 A;  2AAD A;  1RMS A;  1LQM B;  1Q7H A;  2F86 B;  3GWR A;  3KFQ C;  3QK9 A;  1QAK A;  1TU5 A;  1KC8 4;  1NJI 4;  2AAE A;  1GY5 A;  2HML B;  1EG9 B;  1RGC A;  4LSO A;  1MWS A;  4N6U A;  1GOY A;  3ZFZ A;  2KF6 A;  1JBT A;  1R4C A;  2L1S A;  3UL5 A;  1YGE A;  1MGW A;  3LXU X;  1IVV A;  2MF7 A;  4NPB A;  2K54 A;  2FNQ A;  4O2H A;  3CC2 3;  1OHO A;  2CKF B;  3WMD A;  1VQ9 3;  1OGX A;  1TP6 A;  1ZS7 A;  1EUI C;  1X1Y A;  2Y74 A;  3FSD A;  1UI7 A;  4GHO A;  1JN5 B;  5D82 A;  5CF1 A;  1BRH A;  3BNC A;  3LTC A;  3F14 A;  3ROB A;  3CCU 3;  1WMN A;  1RN7 A;  1SIH A;  1LVN A;  4HOH A;  3B4O A;  3L0R A;  3G71 3;  3ZG5 A;  3Q2P A;  4HBR A;  3HII A;  3U97 A;  3CPW 2;  1CH0 A;  3EQQ B;  1QVG 2;  1R4Y A;  3DMC A;  1M1X B;  1EEJ A;  3EN1 B;  1A90 A;  1E3R A;  1EA2 A;  2Z76 A;  1AY7 A;  2BO9 B;  5EEO A;  2B1X B;  3DZL A;  5IER A;  3G4S 3;  4AKZ A;  2Q07 A;  1JKG A;  2UGI A;  2KF5 A; 
#chains in the Genus database with same CATH homology
 2F5M A;  2C4B A;  3HOH A;  1RN4 A;  1I3I A;  2BU4 A;  1UCJ A;  6RNT A;  1I2E A;  1BRN L;  1B2U A;  1Q9E A;  1RCL A;  3DH2 A;  6GSP A;  3WR2 A;  1GMQ A;  2RBI A;  4HAA A;  4J5K A;  4J5G A;  5BIR A;  1RGL A;  1GOV A;  1T2I A;  1HZ1 A;  1B27 A;  1GMP A;  1BNR A;  1I2F A;  1LOW A;  3KCH A;  3A5E A;  1I3F A;  1RSN A;  3DGY A;  1UCL A;  1YGW A;  4RNT A;  1YVS A;  3AHS A;  1C54 A;  1B2X A;  1LRA A;  1I0V A;  1A2P A;  1BRS A;  2F5W A;  1FZU A;  1T2H A;  1BSB A;  1BRK A;  1RHL A;  2KF3 A;  1RGA A;  3D4A A;  1PY3 A;  3Q3F A;  3D5I A;  2RNT A;  4GSP A;  4BU4 A;  1B2M A;  4BIR A;  1G02 A;  2BIR A;  1BSE A;  1RTU A;  1UCK A;  1FYS A;  2KF4 A;  1BAN A;  1YNV X;  3AGO A;  1BOX A;  1I70 A;  1X1X A;  1BNS A;  1BRJ A;  1BUJ A;  1HYF A;  1ZGX A;  1LOY A;  5BU4 A;  1TTO A;  2F4Y A;  1RNB A;  1BSD A;  1IYY A;  1BGS A;  1I8V A;  1BRI A;  3SYU A;  2F56 A;  1LNI A;  1GMR A;  3AHW A;  1RGE A;  1BNF A;  2KAA A;  1MGR A;  1DET A;  1BNJ A;  1RNT A;  1TRQ A;  5RNT A;  1BSA A;  1B20 A;  1RLS A;  2ZA4 A;  8RNT A;  1X1U A;  3RNT A;  1B21 A;  3BIR A;  3BU4 A;  1BVI A;  1GSP A;  3AGN A;  1RGF A;  9RNT A;  2HOH A;  1I0X A;  1FUS A;  1JBS A;  1FUT A;  2AAD A;  1RMS A;  1BSC A;  2AAE A;  1AQZ A;  1RDS A;  1RGC A;  1GOY A;  1UCI A;  1B3S A;  2SAR A;  2KF6 A;  1JBT A;  1B2Z A;  1MGW A;  1X1W A;  7RNT A;  1RCK A;  1BNE A;  1BRG A;  1TRP A;  1BAO A;  1RGK A;  3GSP A;  1X1Y A;  1BNI A;  4GHO A;  1BRH A;  1BU4 A;  4HOH A;  1B2S A;  1JBR A;  1RN1 A;  1CH0 A;  1DE3 A;  1RGH A;  1R4Y A;  3URP A;  1RGG A;  3WHO A;  1AY7 A;  2GSP A;  1GOU A;  1I2G A;  1BNG A;  5GSP A;  1LOV A;  3D5G A;  1SAR A;  5HOH A;  7GSP A;  1BIR A;  1PYL A;  1FW7 A;  2KF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...