2GSTA

Structure of the xenobiotic substrate binding site of a glutathione s-transferase as revealed by x-ray crystallographic analysis of product complexes with the diastereomers of 9-(s-glutathionyl)-10-hydroxy-9, 10-dihydrophenanthrene
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
217
Chain Sequence
PMILGYWNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Structure and function of the xenobiotic substrate binding site of a glutathione S-transferase as revealed by X-ray crystallographic analysis of product complexes with the diastereomers of 9-(S-glutathionyl)-10-hydroxy-9,10-dihydrophenanthrene.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Glutathione transferase
total genus 77
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1993-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2gstA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2gstA01
5ECOB 5INYA 5B8AA 5G31A 1K3YA 2DJ3A 1ST9A 3EU4A 1V9WA 3C8EA 2PVQA 5JCWA 2H76A 5CRHA 1M99A 2HSYA 4X43A 1T00A 2OA7A 4TR3A 4BWSA 3KTBA 4HU7A 4ECIA 3APSA 5DJMA 2DMMA 5EPFA 2IFQB 4L5LA 3QCPA 1GLPA 2AUVA 4GCIA 1VGLA 3LXZA 3ZLPA 3FR6A 3MWHA 1N2AA 3IXRA 2I4AA 3ZIVA 4TKYA 2FWGA 1UN2A 2YNXA 3RPPA 2QKEA 4MA9A 3DEXA 1K0MA 4RI6A 1SYRA 3KZQA 4TXVA 5DAKB 2C0DA 2QC7A 3GSTA 1AQVA 2JU5A 3GFKA 5ECNB 3LYKA 2WRTA 5A4VA 3TDGA 4ZL7A 1G0TA 1Z9HA 2VLUA 3UBKA 2LNSA 1ILOA 2R4VA 4FYBA 2GTUA 3D4TA 5DVBA 1V2AA 3APOA 2E2GA 4MLYA 1SK1A 4YH2A 2PPTA 4G0LA 3KM6A 5CRDA 1XIYA 1SJZA 2C3TA 4N0VA 1YKAA 6GSWA 4F0CA 1XWGA 1UVZA 1S3AA 2R6KA 2DIYA 2HZEA 4ZB6A 1GSYA 5J9CA 1TU8A 1TTZA 1GSEA 4F0BA 5JWRB 1GL8A 3GX8A 2ZUPA 2DJ2A 5B8BA 3BCKA 5IO0A 2HRKA 5DBQA 4YAPA 4JU5A 5KN3A 5IPHA 5A5KA 4KSMA 2JSYA 1USBA 1WRYA 1PL2A 1TDIA 2VL2C 5KN0A 1JZRA 1WIKA 1T4ZA 1O8XA 4XIHA 4K2DA 3QFAC 4PUFC 1Z7PA 1H4OA 4ZXGA 4IJIA 2LQQA 1R4WA 2VIMA 5H5SA 2H0IA 4GRFA 2GQMA 4IGJA 2OE3A 4MJCA 3W8JA 2GSTA 3A5WA 5G2ZA 1U88A 5E4WA 1PKWA 5F07A 1W89A 4IN0A 2NTOA 1GSQA 1A23A 4PNGA 5FHIA 3PGTA 4KF9A 5ELAA 5ECLB 1KEBA 2EIQA 2VCTA 2K8SA 4QL9A 2MMZA 1XOAA 3VWVA 1PMTA 3W6GA 3N5OA 3GKMA 5GSSA 1GTIA 2FHEA 5HFIA 1T1VA 2H0GA 4J57E 1E6BA 1U6TA 2B5YA 3DD3A 3IC8A 3GRXA 2I1UA 5LD0A 4HQZA 1RK4A 4I8BA 1V57A 1ZZYA 3ZITA 3QD9A 1OC9A 3QOUA 4TR0A 1B9XC 1T4YA 2OE1A 4BL7A 4PQHA 3HVSA 3SBCA 6GSSA 1GP1A 2MYGA 1GNEA 3U6VA 2X99A 4JBBA 3QMXA 1SK0A 5G5EA 2L6CA 3FRCA 1IYHA 4I5QA 1ZOFA 2VCQA 4XRDA 1YJ6A 2OBIA 2VCZA 3IR4A 2XBIA 4O5RA 2EIRA 1SKRB 1EOHA 5D93A 5B6NA 2TRCP 16GSA 5DJLA 3IV4A 5A4UA 1X9SB 4LL4B 3ZZXA 3A3TA 1QMVA 3EU3A 4WXTA 2VOCA 4KNDA 1IYIA 1EP7A 4KGIA 5ECSA 1AC1A 1GWCA 1OYJA 4QQ7A 1PSQA 4FYUA 3D22A 2DMLA 1T7PB 2LJAA 3DIEA 4HZ2A 3E0UA 8GSSA 20GSA 4WF5A 2LQOA 1JHBA 5CRWA 2V1MA 1A24A 3MAKA 1R5PA 2JZTA 5CRGA 4GWRA 4WETA 2BJXA 1GH2A 4BVXB 3TJKA 4X1UA 2H8LA 3GL5A 1DE1A 4KB3A 1NW2A 2B7JA 2XPEA 3G7JA 4BWQA 2MZCA 3GUSA 1XOBA 1G6YA 4F82A 3N9JA 1MDJA 2FCHA 3WGXA 5DALA 4MF6A 1W4VA 2KP2A 1I9DA 1GNWA 1HNAA 2B7KA 1PGTA 1PX7A 2C8UA 2IPAA 4ULXA 3TJGA 1A2LA 1R7HA 1O81A 5GZZB 1AW9A 2YJ7A 4J56E 3EWLA 4PTSA 3TKSE 3TCOA 1J9BA 3GNJA 3HJMA 2QSIA 5HR3A 2N5FA 4EC0A 3TOTA 3QR6A 3FW2A 3BJ5A 1ZYEA 5F06A 2VD0A 5JWOB 2OE0A 3EE2A 4EKZA 4MH2A 1TK8B 1JZDA 5CAXA 5IQYA 4K0GA 1ZGNA 2PERA 3FZ4A 4OWYA 1B9YC 2R37A 4TXOA 1ERWA 2GLRA 1BJXA 3IRAA 3F0IA 3VPTA 2VLTA 3VWXA 2H0HA 3EMPA 1KNGA 3ZL5A 2NBSA 2YCDA 2VM2A 1YF0A 5AIVA 2J23A 1S3CA 3WD6A 4QL7A 5AIXA 3WYWA 3HY2A 2IMEA 2F9SA 4IVFA 2F3MA 2HSHA 3TKSA 2MMAA 3GA4A 1O7UA 3ZFBA 2HSMB 4XHMA 2O7KA 4KSOA 1M2DA 5E59A 3IHQA 2V6KA 2VL3A 3GH9A 2L4QA 2JACA 1QUWA 3UARA 4LMWA 2E0QA 2FA8A 2LJKA 4AF2A 2YZHA 2H75A 4ZL8A 1FB6A 3IBHA 1LBKA 1TP9A 2GS3A 4AJ8A 1OE8A 1SL0B 1OE7A 1ON4A 1QFNA 1OVNA 2IIYA 3EC3A 1Z6MA 1VF1A 1VF3A 2DJJA 4TR1A 2ES7A 4MPGA 2H74A 2PBJA 1F37A 3W8SA 5AISA 1GUHA 4CW9A 5B7CA 1TJDA 2IFQA 1K0NA 1M2AA 3LSZA 2IMFA 1PA3A 1Z3EA 3KP8A 3GX0A 12GSA 2GSSA 4NHWA 2G2QA 2GGTA 3R3EA 3BOAA 3H1NA 3US3A 1BG5A 3RHBA 5ECQB 2FGXA 4RQXA 5KN2A 2FNOA 5JCGA 1SL2B 1O85A 5DAKA 4KAEA 3LFLA 1TU7A 1M9BA 2YWOA 3CSIA 3G9BA 3P8WA 1BX9A 2AYTA 2FA4A 4WR4A 4KE3A 2IL3A 1WP0A 3ISOA 2R5GA 2HI7A 1GTBA 4IJ3A 1MDKA 4POBA 4WR5A 2F8FA 6GSUA 4POLA 4NHZA 2LJRA 2BTOT 2V41A 2C0GA 3TB2A 9GSSA 2IMDA 1TOFA 5LNKe 2XPDA 1GSUA 3TGZA 1M9AA 5H5RA 3D6IA 1EV9A 1SYXA 3I69A 3BBYA 3KIJA 4GSTA 2HFDA 2KUCA 2YJHA 4K8MA 3HZ8A 4MF5A 3DVXA 2WULA 2DBCA 5HR2A 3HDCA 1XVWA 4MMMA 4TVEA 1GLQA 3MNGA 4JR6A 2DSAA 2TRXA 2MMOA 1X5EA 1R26A 1TW9A 3I43A 4XS4B 1FG4A 5ID2A 1X9MB 2GT5A 1JFUA 5IMDA 3QFBC 5L71A 4ML1A 4HQSA 2NPBA 3MSZA 4N11A 1E2YA 1WPIA 3F4RA 3CTFA 10GSA 3VI5A 3KP9A 4ECCA 1GSSA 5HR0A 1C72A 2H19A 1PQNA 2K8VA 3H79A 4Q5RA 1PN9A 4F03A 3LORA 5CO3A 2VCXA 2ON5A 2XBQA 1K0DA 1G7OA 2O8VB 2OADA 1XVQA 2CAIA 2WJUA 2QGVA 4JR4A 3EURA 4TR4A 4HI7A 2HT9A 2CVKA 3PPUA 2XHFA 2VCWA 2H1GA 1V58A 4N30A 2H01A 5J5NA 4D73B 2K6VA 1VF2A 1RW1A 5D9XA 3KXOA 1AAZA 2HSNB 4GF0A 2RM6A 1Z5YE 3KD0A 4EVMA 2L5LA 3ERFA 3SWLA 3GL3A 1ZCPA 1MEKA 3E3EA 4HU9A 4OD7A 2MBTA 1TK5B 2P0GA 3WT1A 3J7Yb 2AAWA 4ZILA 4G19A 19GSA 4IHUA 1Z6NA 4DSSA 4FIWA 4TW5A 4IP6A 3Q74A 5EVOA 1XXUA 1YEPA 3IK7A 3KEBA 3GTUA 1U87A 3RBTA 1SKSB 4HJMA 3TKSC 1FAAA 1MD4A 4YQVA 5A4WA 4HUAA 4G9HA 1BAYA 2JSZA 1TXXA 3BCIA 3A2XA 2XC2A 4KA0A 3UVHA 1B8XA 5F05A 4KDXA 4K6XA 3HZ4A 2HZEB 4ISDA 3ZRDA 4PQIA 1FVJA 3UVTA 1O8WA 2IMKA 5J3RA 2HRKB 2YWIA 3O3TA 1A0FA 1ZMAA 5EL8A 4V2MA 4Z7XA 5D9WA 1A2JA 4L0UA 2M80A 4IELA 2VCVA 2EIOA 1S3DA 4KDUA 2FWEA 1VRSD 4HDEA 2I81A 3TKQA 1YEXA 3FEUA 5HR1A 2VL9A 2N5AA 4EUYA 1MTCA 5IMZA 3P2AA 4K7OA 1J0FA 4NWYA 4PURA 3F6FA 4WBJA 1O6JA 1QGVA 3IC4A 2AV4A 3VWWA 1K3OA 4JE1A 3WT2A 4LMVA 4H86A 2K9FA 1K0BA 3L78A 3KGKA 2P31A 1JZWA 5ABRA 1GSDA 1FOVA 1UC7A 4PXOA 1GUMA 2VLVA 1EZKA 3L4NA 3TJBA 4E8HA 1XWBA 3FZ9A 2PWJA 1M7TA 5B6MA 4EO3A 1X5CA 3I9V2 5DCHA 1EP8A 3KMOA 3C73A 1YQ1A 4NV5A 1U3IA 4L5OA 2KHPA 4XRAA 1ACVA 3DVWA 1ZL9A 2M46A 4BA7A 1EGOA 3CRTA 3QAGA 2VUPA 1PL1A 3GH6A 4MF7A 4HS1A 5ECHB 3FZ5A 3GV1A 1OC9B 3TOUA 4I2TA 2YPMA 2A2RA 5DQSA 4BL7B 4K1FA 2H6YA 1R5AA 3O76A 4F2IA 1PKZA 3S9FA 1TI1A 2GVPA 2PVOC 1V98A 2LS5A 3KH7A 3FK8A 1HD2A 3IK9A 1YDKA 3CRUA 5J9BA 3VLNA 3EVIA 1O73A 1GUKA 1WOUA 2X8CA 1SL1B 2HSMA 4NAXA 1JZOA 2LTKA 4MZWA 1PD21 3VI7A 1QXHA 1I5GA 3IOSA 3KCMA 2C0FA 3FY7A 1N8JA 4WF4A 3D0ZA 1TI3A 3TRXA 4V1Ap 3M1GA 2WDUA 1DE2A 2D2ZA 2YWMA 3LG6A 3K8NA 2HLSA 1XWKA 3QPMA 2M72A 4LLRA 2YOIA 4MJAA 5AGYA 2OJLA 4IQAA 4V2LA 5F0GA 1A2MA 1G7EA 11GSA 4YQUA 2I9HA 3F4SA 2E7PA 5BMUA 2Z9SA 3NZNA 1EV4A 4IKHA 1EGRA 2RM5A 2VL2A 1PRXA 2ON7A 4Q5NA 2DIZA 3LJRA 4FO5A 1KBNA 3UEMA 1TK0B 3ZVJD 1B4QA 5KN1A 2PU9C 4TOPA 2PN8A 5DALB 5IOXA 1ABAA 1TRVA 3HCZA 2NDOA 2CAQA 3C1SA 3LGCA 3RAZA 1XW9A 4BPYA 4BVYA 2PMTA 2GQLA 1J08A 5ENUA 3R2QA 2O89A 3LWAA 3UIWA 3L0HA 3ERWA 2FY6A 2IN3A 3ZIJA 4KH7A 3M3MA 1H75A 1WE0A 2LV3A 2L6DA 5IO2A 4KCAA 4ZIJA 2FWFA 1K0CA 2VD1A 3HKRA 3NIVA 5C04A 4OO4A 4MCUA 4OCEA 2N5BA 2DLXA 2WS2A 2H72A 4EF0A 22GSA 2JL4A 3EYTA 1XCCA 3IA1A 4PGTA 2MBSA 4ECBA 4GQCA 2VO4A 3QAVA 4O7HA 1TRSA 4KDYA 4MJEA 1B48A 2C80A 3I6AA 4MH3A 1UA5A 3H8QA 4TXOB 1GSFA 1FO5A 2X8HA 3F63A 5J4UA 3ME7A 3FR9A 3CBUA 4ZB8A 4MZCA 1URMA 5IMFA 4MP4A 3GIXA 5HFKA 4XTSA 2RUEA 5DDLA 1JLWA 3FR3A 4NPBA 3CSHA 3PINA 1HNBA 4HJ2A 2E2MA 1GTUA 3ED3A 3GURA 1THXA 4GLTA 4ACSA 5ECRB 3HYPA 5G5FA 2L4CA 3JCML 3VURA 17GSA 2CZ2A 4ZBDA 3VFIA 4MJBA 13GSA 4IBPA 3KH9A 1X9WB 2A2SA 2O85A 3HJPA 4CDOA 1NHOA 3C71A 1Z7RA 3D5JA 1WWJA 2B6MA 2GZZA 4GSNA 3FHKA 3Q18A 2H1BA 4TN8A 2HNLA 1NSWA 4IW9A 1AQWA 3ZREA 4V2NA 2P5QA 2RIIA 3P7XA 2KP1A 2MMNA 1SENA 6GSXA 2HYXA 3BD2A 5ECIB 2LSTA 3HJOA 2AJQB 4K7IA 2LRNA 4TR1B 3LEFA 2P5RA 2F51A 2CX4A 3IPZA 3RPNA 3U5RE 5DCGA 2FWHA 1ERVA 4MZBA 5HQPA 1XW6A 1A8LA 4E8EA 4OO5A 1F2EA 5JCUA 1CQGA 1X0RA 3GMFA 5IM9A 4Q5FA 4ZL9A 3A2VA 2EC4A 3DKSA 2F8AA 1XBSA 4D73A 2H6XA 4ML6A 3H93A 3P90A 2GZPA 3Q19A 1XWAA 3V1WA 4RUVA 2H71A 4YQMA 4EL1A 4JRRA 2IJYA 4EDYA 3KTLA 4V1Ag 2A4VA 3QAWA 4HOJA 5DQYA 1FHEA 1U3AA 18GSA 4GQFA 1OC8A 2LNTA 4F9ZA 4G10A 5AN1A 3F4TA 4LA1A 1FW1A 4EDZA 1SD9A 1TRWA 3UJ1A 2WFCA 1K3LA 4I2UA 3ZVJA 2REMA 4L0WA 2YV7A 1GULA 4CHSA 3TRQA 1B4PA 1QK8A 1Q4JA 2DJ1A 2X8GA 3GN3A 1VF4A 5GSTA 1GTAA 4G2EA 1OKTA 3FYGA 3HXSA 2HRAA 2WZ9A 4OCFA 3PR8A 1SD8A 4ILFA 4YAVA 3Q6OA 3WGEA 4G0KA 3G7YA 1HYUA 3DYRA 2V2GA 4X0XA 3M8NA 2PUKC 3CSJA 3OR5A 4N0ZA 4IP1A 3ZTLA 5ECKB 3UOMA 5F8BA 1SK2A 2CZ3A 4TRXA 4XS1A 4GSSA 5G30A 1OAZA 3TUEA 1A8YA 2L5OA 1YF1A 1YY7A 2LRCA 4J2FA 4GTUA 3UMAA 4L8EA 1EOGA 4WKWA 1MD3A 5ID2B 1HQOA 3D21A 2H6ZA 3WGDA 1XW5A 2V6OA 2HQTA 2VM1A 3ME8A 4PQ1A 3MDKA 5HFGA 1F9MA 1AQXA 1ERTA 5IIZA 3APQA 1KTEA 3AY8A 3M9KA 3F8UA 1DBYA 3CTGA 4AGSA 5ECPB 2CA8A 3DXBA 2AB6A 2GDRA 2LEGA 1EWXA 3UBLA 2C3QA 2CT6A 2CX3A 2H1DA 4DSQA 2IMIA 1M2BA 2YANA 4AJ6A 4POMA 1K0AA 4IQ1A 1XPVA 4OFTA 5CP1A 3HA9A 5IMVA 4WBRD 2DC5A 3A2WA 4RI7A 3GYKA 3QDNA 5CNWA 4MABA 1TKDB 2YN1A 1CQHA 3RHCA 5G1LA 1XFLA 4BVXA 4OFMA 2I3YA 3C1RA 4I97A 1JLVA 4FQUA 1BQ7A 3L9UA 3DWVA 4OMVA 1XWCA 1BEDA 5D9TA 4ZBAA 3HVXA 2G0FA 1DUGA 2C4JA 3GHAA 1WMJA 2B5EA 2FUG2 4RQRA 3E9JB 2ZCTA 3IAM2 1T3BA 1FB0A 2KLXA 4MK3A 4NMUA 6GSTA 2GQKA 4DSSB 2WGRA 4ZB9A 1ERUA 7GSSA 1AXDA 3H4KA 1NHYA 2LUSA 5LCZA 3GKKA 3UAPA 3GTUB 2FD3A 1LU4A 3HD5A 5FWGA 2H70A 3PH9A 1ZYQB 1SKWB 2OBKA 5GAND 3LYPA 2IWTA 3O6TA 4LL1B 2CV4A 3F6DA 2YP6A 4DEJA 1OC3A 4GXZA 6GSYA 1AIUA 1AUCA 1SJ6A 5H5QA 3ERGA 2OACA 5JWQB 1G6WA 4O32A 3TKRA 2RLIA 2OKAA 2JZRA 2YV9A 1F6MC 4MPFA 3CMIA 5IMAA 4PNFA 1WJKA 5CREA 4WEYA 2H73A 2B1KA 3ZMLA 6GSVA 2YZUA 2B5XA 2FLSA 4ID0A 1THOA 2YWNA 1K0OA 2GZYA 14GSA 4I6XA 4P3YB 1YZXA 3TJJA 3LQ7A 3G7IA 2HXKA 2CQ9A 1PX6A 4KUNA 3NOFA 1GRXA 3VPQA 2GSRA 2NVLA 2B1LA 5C00A 4EXJA 3VWUA 4AJ7A 2JADA 1X5DA 2L59A 4O92A 2LRTA 2X64A 4IS0A 3GKXA 4HEA2 2DJ0A 1YKCA 1TRUA 2H30A 1DSBA 4USSA 2WCIA 1ML6A 3FKFA 2UZ8A 2B3SA 1A0RP 2ALBA 1HNCA 5G1KA 4KW6A 2ZNMA 3J7Yk 3VK9A 2TIRA 4OFNA 1Y25A 5IMCA 5D73A 5EY6A 4FH8A 5D8IA 2PGTA 2BMXA 3M0FA 4EE0A 3F9UA 3IDVA 3TRPA 4DSRA 2C3NA 4POKA 1V40A 2HZFA 1QQ2A 1FVKA 3GKNA 2CVBA 3CYNA 2GT6A 1RQMA 3L9SA 2AHEA 2R2JA 3ZYWA 1BYEA 4NXIA 1MDIA 4HZ4A 3F3QA 1M0UA 4KCEA 4G0IA 2K18A 2H66A 4K7NA 5IOWA 3IE3A 3CXGA 4K9ZA 2RUFA 4Q5QA 3KMNA 2C0EA 4MDCA 1T8EB 2R3XA 2C1YA 5ECMB 2WB9A 4XCSA 3M9JA 4PX1A 3DRNA 3C7MA 5CYYA 2H1AA 3UL3A 2HRFA 1NM3A 2GSQA 3DMLA 4JZQA 3FZAA 5KEJA 2HRNA 1F3BA 3ZMKA 4K0NA 4XS6A 4ECJA 3HVVA 4ZBBA 1LJRA 4KX4A 2DJKA 3IAS2 4FYCA 3EINA 4PUAA 4NV2A 1EEMA 1F3AA 3D4MA 1Q98A 1XZOA 5J41A 2V32A 4N10A 3RDWA 3GSSA 1Y6EA 5GAPD 5FT3A 4DVCA 5IPGA 2J9HA 2VAFA 3TKPA 2KOKA 3ZFLA 4BVYB 2O87A 2JZSA 5D96A 1EEJA 2LKUA 3KJYA 4XS4A 3TJFA 1OKDA 1SU9A 5D9VA 3LXTA 3F3RA 3L9VA 2HE3A 5ELGA 2L57A 4JEDA 5COHA 2CVDA 3HHVA 3EMXA 1SJIA 3DGQA
chains in the Genus database with same CATH superfamily
5ECOB 5INYA 5B8AA 5G31A 1K3YA 2DJ3A 1ST9A 3EU4A 1V9WA 3C8EA 2PVQA 5JCWA 2H76A 5CRHA 1M99A 2HSYA 4X43A 1T00A 2OA7A 4TR3A 4BWSA 3KTBA 4HU7A 4ECIA 3APSA 5DJMA 2DMMA 5EPFA 2IFQB 4L5LA 3QCPA 1GLPA 2AUVA 4GCIA 1VGLA 3LXZA 3ZLPA 3FR6A 3MWHA 1N2AA 3IXRA 2I4AA 3ZIVA 2HSNA 1M3IA 4TKYA 2FWGA 1UN2A 2YNXA 3RPPA 2QKEA 4MA9A 1S4BP 3DEXA 1K0MA 4RI6A 1SYRA 3KZQA 4TXVA 5DAKB 2C0DA 2QC7A 3GSTA 1AQVA 4ZB7A 2JU5A 3GFKA 5ECNB 5J47A 3LYKA 2WRTA 5A4VA 3TDGA 4ZL7A 1G0TA 1Z9HA 2VLUA 5J40A 3UBKA 2LNSA 1ILOA 2R4VA 4FYBA 2GTUA 3D4TA 5DVBA 1V2AA 3APOA 2E2GA 4MLYA 1SK1A 4YH2A 2PPTA 4G0LA 3KM6A 5CRDA 1XIYA 1SJZA 4ICYA 2C3TA 4N0VA 4BIKA 1YKAA 6GSWA 4F0CA 1XWGA 1UVZA 1S3AA 2R6KA 2DIYA 2HZEA 4ZB6A 1GSYA 5J9CA 1TU8A 1TTZA 1GSEA 4F0BA 5JWRB 1GL8A 3GX8A 2ZUPA 2DJ2A 5B8BA 3BCKA 5IO0A 2HRKA 5DBQA 4YAPA 4JU5A 5KN3A 5IPHA 4K2XA 5A5KA 4KSMA 2JSYA 1USBA 1WRYA 1PL2A 1TDIA 2VL2C 5KN0A 1JZRA 1WIKA 1T4ZA 4YKFA 1O8XA 4XIHA 4K2DA 3QFAC 4PUFC 1Z7PA 1H4OA 4ZXGA 4IJIA 2LQQA 3MIXA 1R4WA 2VIMA 5H5SA 2H0IA 4GRFA 2GQMA 4IGJA 2OE3A 4MJCA 3W8JA 2GSTA 3A5WA 5G2ZA 1U88A 5E4WA 1PKWA 5F07A 1W89A 4IN0A 2NTOA 1GSQA 1A23A 4PNGA 5FHIA 3PGTA 4KF9A 5ELAA 5ECLB 1KEBA 2EIQA 2VCTA 2K8SA 4QL9A 2MMZA 1XOAA 1SVLA 3VWVA 1PMTA 3W6GA 3N5OA 3GKMA 5GSSA 1TXUA 1GTIA 2FHEA 5HFIA 1T1VA 2H0GA 4J57E 1E6BA 1U6TA 2B5YA 4K5SA 3DD3A 3IC8A 3GRXA 2I1UA 5LD0A 4HQZA 1RK4A 4I8BA 4FXYP 1V57A 1ZZYA 3ZITA 3QD9A 1OC9A 3QOUA 4TR0A 1B9XC 1T4YA 2OE1A 4BL7A 4PQHA 4AKIA 3HVSA 3SBCA 6GSSA 1GP1A 2MYGA 1GNEA 3U6VA 2X99A 4JBBA 3QMXA 1SK0A 5G5EA 2L6CA 3CQFA 3FRCA 4QMKA 2R0CA 1IYHA 4I5QA 1ZOFA 2VCQA 4XRDA 1YJ6A 2OBIA 2VCZA 3IR4A 2XBIA 4O5RA 2EIRA 1SKRB 1EOHA 5D93A 5B6NA 2TRCP 16GSA 5DJLA 3IV4A 4Z2TA 5A4UA 1X9SB 4LL4B 3ZZXA 3A3TA 1QMVA 3EU3A 4WXTA 2VOCA 4KNDA 1IYIA 1EP7A 4KGIA 5ECSA 1AC1A 1GWCA 1OYJA 4QQ7A 1PSQA 4FYUA 3D22A 2DMLA 1T7PB 2LJAA 3DIEA 4HZ2A 3E0UA 8GSSA 20GSA 4WF5A 2LQOA 1JHBA 5CRWA 2V1MA 1A24A 3MAKA 1R5PA 2JZTA 5CRGA 4GWRA 4WETA 2BJXA 1GH2A 4BVXB 3TJKA 4X1UA 2H8LA 3GL5A 1DE1A 4KB3A 1NW2A 2B7JA 2XPEA 3G7JA 4BWQA 2MZCA 3GUSA 3CHXC 1XOBA 1G6YA 4F82A 3N9JA 1MDJA 2FCHA 3WGXA 5DALA 4MF6A 2R0PA 1W4VA 2KP2A 1I9DA 2DKIA 1GNWA 1HNAA 2B7KA 1PGTA 1PX7A 2C8UA 2EFCA 2IPAA 4ULXA 3TJGA 4CY6A 1A2LA 1R7HA 1O81A 5GZZB 1AW9A 2YJ7A 4J56E 3EWLA 4PTSA 3TKSE 3TCOA 4HSCX 1J9BA 3GNJA 1XG8A 3HJMA 4AI6A 2QSIA 5HR3A 2N5FA 4EC0A 3TOTA 3QR6A 3FW2A 3BJ5A 1ZYEA 5F06A 4AKGA 5A34B 2EFDA 2VD0A 5JWOB 2OE0A 3EE2A 4EKZA 4MH2A 1FOHA 1TK8B 2EFEA 1JZDA 5CAXA 2X49A 5IQYA 4K0GA 1ZGNA 2PERA 3FZ4A 4OWYA 1B9YC 2R37A 4TXOA 1ERWA 2GLRA 1BJXA 3IRAA 3F0IA 3VPTA 2VLTA 3VWXA 2H0HA 3EMPA 1KNGA 3ZL5A 2NBSA 2YCDA 2VM2A 3MYDA 1YF0A 5AIVA 2J23A 1S3CA 3WD6A 4QL7A 5AIXA 3WYWA 3HY2A 2IMEA 2F9SA 4IVFA 2F3MA 2HSHA 3TKSA 2MMAA 3GA4A 1O7UA 3ZFBA 2HSMB 4XHMA 2O7KA 4KSOA 1M2DA 5E59A 3IHQA 2V6KA 2VL3A 3GH9A 2L4QA 2JACA 2WVXA 1QUWA 3UARA 4LMWA 2E0QA 2FA8A 2LJKA 4AF2A 2YZHA 2H75A 4ZL8A 1FB6A 3IBHA 1LBKA 1TP9A 2GS3A 2EFHA 4AJ8A 1OE8A 1SL0B 1OE7A 5BMUB 1ON4A 1QFNA 1OVNA 2IIYA 3EC3A 1Z6MA 1VF1A 1VF3A 2DJJA 4TR1A 3IHGA 2ES7A 4MPGA 2H74A 2PBJA 1F37A 5A5HB 3W8SA 5AISA 1GUHA 4CW9A 5B7CA 1TJDA 2IFQA 1BF5A 1K0NA 1M2AA 3LSZA 2DKHA 2IMFA 1PA3A 1Z3EA 3KP8A 2R0GA 3GX0A 12GSA 2GSSA 4NHWA 2G2QA 2GGTA 3R3EA 3BOAA 3H1NA 3US3A 1BG5A 3RHBA 5ECQB 2FGXA 4RQXA 5KN2A 2FNOA 5JCGA 1SL2B 1O85A 5DAKA 4KAEA 3LFLA 4E68A 1TU7A 1M9BA 2YWOA 3CSIA 3G9BA 3P8WA 5A1NB 1BX9A 2O5VA 2AYTA 2FA4A 4WR4A 4KE3A 2IL3A 1WP0A 3ISOA 2R5GA 2HI7A 1GTBA 4IJ3A 1MDKA 4POBA 4WR5A 2F8FA 6GSUA 4POLA 4NHZA 2LJRA 2BTOT 1ZYNA 2V41A 2C0GA 3TB2A 9GSSA 2IMDA 1TOFA 5LNKe 2XPDA 1GSUA 3TGZA 1M9AA 5H5RA 3D6IA 1EV9A 1SYXA 3I69A 3BBYA 3KIJA 4GSTA 2HFDA 2KUCA 2YJHA 4K8MA 3HZ8A 4MF5A 3DVXA 2WULA 2DBCA 5HR2A 3HDCA 1XVWA 4MMMA 4TVEA 1GLQA 3MNGA 4JR6A 2DSAA 2TRXA 2MMOA 5KOXA 1X5EA 1R26A 1TW9A 3I43A 4XS4B 1FG4A 5ID2A 1X9MB 2GT5A 1JFUA 1PFOA 5IMDA 3QFBC 5L71A 4ML1A 4HQSA 2NPBA 3MSZA 4N11A 2WW3A 1E2YA 1WPIA 3F4RA 3CTFA 10GSA 3VI5A 3KP9A 4ECCA 1GSSA 5HR0A 1C72A 2H19A 1PQNA 4AKHA 2K8VA 4GDFA 3H79A 4Q5RA 1PN9A 4F03A 3LORA 5CO3A 2VCXA 2ON5A 2XBQA 1K0DA 1G7OA 2O8VB 2OADA 1XVQA 2CAIA 2WJUA 2QGVA 4JR4A 3EURA 4TR4A 1N25A 4HI7A 2HT9A 2CVKA 4EIQA 3PPUA 2XHFA 2VCWA 2H1GA 1V58A 4N30A 2H01A 5J5NA 4D73B 2K6VA 1VF2A 1RW1A 5D9XA 2A2PA 4Z2RA 3KXOA 1AAZA 2HSNB 4GF0A 2RM6A 1Z5YE 3KD0A 4EVMA 2L5LA 3ERFA 3SWLA 3GL3A 2VKZG 1ZCPA 1MEKA 1PN0A 3E3EA 4HU9A 4OD7A 2MBTA 1TK5B 2P0GA 3WT1A 3J7Yb 2AAWA 4ZILA 4G19A 19GSA 4IHUA 1Z6NA 4DSSA 4FIWA 4TW5A 4IP6A 3Q74A 5EVOA 1XXUA 1YEPA 3IK7A 3KEBA 3GTUA 1U87A 3RBTA 1SKSB 4HJMA 3TKSC 1FAAA 1MD4A 4YQVA 5A4WA 4HUAA 4G9HA 1BAYA 2JSZA 1TXXA 4CY8A 3BCIA 3A2XA 2XC2A 4KA0A 3UVHA 1B8XA 5F05A 4KDXA 4K6XA 3HZ4A 2H1LA 2HZEB 4ISDA 3ZRDA 4PQIA 1FVJA 3UVTA 1O8WA 2IMKA 5J3RA 2HRKB 2YWIA 3O3TA 1YEWC 1A0FA 1ZMAA 5EL8A 4V2MA 4Z7XA 5D9WA 1A2JA 4L0UA 2WVYA 2M80A 4IELA 2VCVA 2EIOA 1S3DA 4KDUA 2FWEA 1VRSD 4HDEA 2I81A 3TKQA 1YEXA 3FEUA 5HR1A 2VL9A 2N5AA 4EUYA 1MTCA 5IMZA 4PI0C 3P2AA 4K7OA 1J0FA 4NWYA 4PURA 3F6FA 4WBJA 1O6JA 1QGVA 3IC4A 1SVOA 2AV4A 3VWWA 1K3OA 4JE1A 3WT2A 4LMVA 4H86A 2K9FA 1K0BA 3L78A 3KGKA 2P31A 1JZWA 3HMJG 5ABRA 3CWGA 1GSDA 1FOVA 4MNNA 1UC7A 4PXOA 1GUMA 2VLVA 1EZKA 3L4NA 3TJBA 4E8HA 1XWBA 3FZ9A 2PWJA 1M7TA 5B6MA 4EO3A 1X5CA 3I9V2 5DCHA 1EP8A 3KMOA 3C73A 1YQ1A 4NV5A 1U3IA 4L5OA 2KHPA 4XRAA 1ACVA 3DVWA 1ZL9A 2M46A 4BA7A 1EGOA 3CRTA 3QAGA 2VUPA 1PL1A 3GH6A 4MF7A 4HS1A 5ECHB 3FZ5A 3GV1A 1OC9B 3TOUA 4I2TA 2YPMA 2A2RA 1S3RA 5DQSA 4BL7B 4K1FA 2H6YA 1R5AA 3O76A 4F2IA 1PKZA 3S9FA 1TI1A 2GVPA 2PVOC 1V98A 2LS5A 3FK8A 3KH7A 1HD2A 3IK9A 1YDKA 3CRUA 5J9BA 3VLNA 3EVIA 1SVMA 1O73A 1GUKA 1WOUA 2WW1A 2X8CA 1SL1B 2HSMA 4NAXA 1JZOA 2LTKA 4MZWA 1PD21 3VI7A 1QXHA 1I5GA 3IOSA 3KCMA 2C0FA 3FY7A 1N8JA 4WF4A 3D0ZA 1TI3A 3TRXA 4V1Ap 3M1GA 2WDUA 1DE2A 2D2ZA 2YWMA 3LG6A 3K8NA 2HLSA 1XWKA 3QPMA 2M72A 4LLRA 2YOIA 4MJAA 5AGYA 2OJLA 4IQAA 4V2LA 5F0GA 1A2MA 1G7EA 11GSA 4YQUA 2I9HA 3F4SA 2E7PA 5BMUA 2Z9SA 3NZNA 1EV4A 4IKHA 1EGRA 2RM5A 2VL2A 1PRXA 2ON7A 4Q5NA 2DIZA 3HVNA 3LJRA 4FO5A 1KBNA 3UEMA 1TK0B 3ZVJD 1B4QA 5KN1A 2PU9C 4TOPA 2PN8A 5DALB 5IOXA 1ABAA 1TRVA 2QA1A 3HCZA 2NDOA 2CAQA 3C1SA 3LGCA 3RAZA 1XW9A 4BPYA 4BVYA 5J4VA 2PMTA 2GQLA 1J08A 5ENUA 3R2QA 2O89A 3LWAA 3UIWA 3L0HA 3ERWA 2FY6A 2IN3A 3ZIJA 4KH7A 3M3MA 1H75A 1WE0A 2LV3A 2L6DA 5IO2A 4KCAA 4ZIJA 2FWFA 1K0CA 2VD1A 3HKRA 3NIVA 5C04A 4OO4A 3TU3B 4MCUA 4OCEA 2N5BA 2DLXA 1I1IP 2WS2A 2H72A 4EF0A 22GSA 2JL4A 3EYTA 1XCCA 3IA1A 4PGTA 2MBSA 4ECBA 4GQCA 2VO4A 3QAVA 4O7HA 1TRSA 4KDYA 4MJEA 2WW2A 1B48A 2WZSA 2C80A 3I6AA 4MH3A 1UA5A 3H8QA 4TXOB 1GSFA 1FO5A 2X8HA 3F63A 5J4UA 3ME7A 3FR9A 4Z2UA 3CBUA 4ZB8A 4MZCA 1URMA 5IMFA 4MP4A 3GIXA 5HFKA 4XTSA 2RUEA 5DDLA 1JLWA 3FR3A 4NPBA 3CSHA 3PINA 1HNBA 4HJ2A 2E2MA 1GTUA 3ED3A 3GURA 1THXA 4GLTA 4ACSA 5ECRB 3HYPA 5G5FA 2L4CA 3JCML 4EIPA 3VURA 17GSA 2CZ2A 4ZBDA 3VFIA 4MJBA 13GSA 3FMWA 4IBPA 3KH9A 1X9WB 2A2SA 2O85A 3HJPA 4CDOA 4O5QA 1NHOA 3C71A 1Z7RA 3D5JA 4A5PA 2WVZA 1WWJA 2B6MA 2GZZA 4GSNA 3FHKA 3RFRC 3Q18A 2H1BA 4TN8A 2HNLA 1NSWA 4IW9A 1AQWA 3ZREA 4V2NA 2P5QA 2RIIA 3P7XA 2KP1A 2MMNA 1SENA 6GSXA 2HYXA 3BD2A 2OT3A 5ECIB 2LSTA 3HJOA 2AJQB 4K7IA 2LRNA 4TR1B 3LEFA 2P5RA 2F51A 2CX4A 3IPZA 3RPNA 3U5RE 5DCGA 2FWHA 4X4JA 1ERVA 4MZBA 5HQPA 3EPTA 1XW6A 1A8LA 4E8EA 4OO5A 1F2EA 5JCUA 1CQGA 1X0RA 3GMFA 5IM9A 4Q5FA 4ZL9A 3A2VA 2EC4A 3DKSA 2F8AA 1XBSA 4D73A 2H6XA 4ML6A 3H93A 3P90A 2GZPA 3Q19A 1XWAA 3V1WA 4RUVA 2H71A 4YQMA 4EL1A 4JRRA 2IJYA 4EDYA 3KTLA 4V1Ag 2A4VA 3QAWA 4HOJA 5DQYA 1FHEA 1U3AA 18GSA 4GQFA 1OC8A 2LNTA 4F9ZA 4G10A 5AN1A 3F4TA 4LA1A 1FW1A 4EDZA 1SD9A 1TRWA 3UJ1A 2WFCA 1K3LA 4I2UA 3ZVJA 2REMA 4L0WA 2YV7A 1GULA 4CHSA 3TRQA 1B4PA 1QK8A 1Q4JA 2DJ1A 2X8GA 3GN3A 1VF4A 5GSTA 1GTAA 4G2EA 1OKTA 3FYGA 3HXSA 2HRAA 2WZ9A 4OCFA 3PR8A 1SD8A 4PI2C 4ILFA 4YAVA 3Q6OA 3WGEA 4G0KA 3G7YA 1HYUA 3DYRA 2V2GA 4X0XA 3M8NA 2PUKC 3CSJA 3OR5A 4N0ZA 4N3ZA 4IP1A 5BRTA 2UV8G 3ZTLA 5ECKB 3UOMA 5F8BA 1SK2A 2CZ3A 4TRXA 4XS1A 4GSSA 5G30A 1OAZA 3TUEA 1A8YA 2L5OA 1YF1A 1YY7A 2LRCA 4J2FA 4GTUA 3UMAA 4L8EA 1EOGA 4WKWA 1MD3A 5ID2B 1HQOA 3D21A 2H6ZA 3WGDA 1XW5A 2V6OA 2HQTA 2VM1A 3ME8A 4PQ1A 3MDKA 5HFGA 1F9MA 1AQXA 1ERTA 5IIZA 3APQA 1KTEA 3AY8A 3M9KA 3F8UA 1DBYA 3CTGA 1M3JA 4AGSA 5ECPB 2CA8A 3DXBA 2AB6A 2GDRA 2LEGA 1EWXA 3UBLA 2C3QA 2CT6A 2CX3A 2H1DA 4DSQA 2IMIA 1M2BA 2YANA 4AJ6A 4POMA 1K0AA 4IQ1A 1XPVA 4OFTA 5CP1A 3HA9A 5IMVA 1YVLA 4WBRD 2DC5A 3A2WA 4RI7A 3GYKA 3QDNA 5CNWA 4MABA 1TKDB 5KOWA 2YN1A 1CQHA 3RHCA 5G1LA 1XFLA 4BVXA 4OFMA 2I3YA 3C1RA 4I97A 1JLVA 4FQUA 1BQ7A 3L9UA 3DWVA 4OMVA 1XWCA 1BEDA 5D9TA 4ZBAA 3HVXA 2G0FA 1DUGA 2C4JA 3RGBC 3GHAA 1WMJA 2B5EA 2FUG2 1BG1A 4RQRA 4YKGA 3E9JB 2ZCTA 3IAM2 1T3BA 1FB0A 2KLXA 4MK3A 4NMUA 6GSTA 2GQKA 4DSSB 2WGRA 4ZB9A 1ERUA 7GSSA 1AXDA 3H4KA 1NHYA 5J4YA 2LUSA 5LCZA 3GKKA 3UAPA 3GTUB 2FD3A 1LU4A 3HD5A 5FWGA 2H70A 3PH9A 1ZYQB 2X4AA 1SKWB 2OBKA 5GAND 3LYPA 2IWTA 3O6TA 4LL1B 2CV4A 5A34A 3F6DA 2YP6A 4DEJA 1OC3A 4GXZA 6GSYA 1AIUA 1AUCA 1SJ6A 5H5QA 3ERGA 2OACA 5JWQB 1G6WA 4O32A 3TKRA 2RLIA 2OKAA 2JZRA 2YV9A 1F6MC 4MPFA 3CMIA 4K5RA 5IMAA 4PNFA 1WJKA 5CREA 4WEYA 2H73A 2B1KA 3ZMLA 6GSVA 2YZUA 2B5XA 2FLSA 4ID0A 1THOA 2YWNA 1K0OA 2GZYA 14GSA 4I6XA 4P3YB 1YZXA 3TJJA 3LQ7A 3G7IA 2HXKA 2CQ9A 1PX6A 4KUNA 3NOFA 1GRXA 3VPQA 2GSRA 2NVLA 2B1LA 2A4HA 4G01A 5C00A 4EXJA 4W66A 3VWUA 4AJ7A 2JADA 1X5DA 2L59A 4O92A 2LRTA 2X64A 4IS0A 3GKXA 4HEA2 2DJ0A 1YKCA 1TRUA 2H30A 1DSBA 4USSA 2WCIA 1ML6A 3FKFA 2UZ8A 2B3SA 1A0RP 2ALBA 1HNCA 5G1KA 4KW6A 2ZNMA 3J7Yk 3VK9A 2TIRA 4OFNA 1Y25A 2O36A 5IMCA 5D73A 5EY6A 4FH8A 5D8IA 2PGTA 2BMXA 3M0FA 4EE0A 3F9UA 3IDVA 3TRPA 4DSRA 2C3NA 5A5HA 2WW0A 4POKA 1V40A 2HZFA 1QQ2A 1FVKA 3GKNA 2CVBA 3CYNA 2GT6A 1RQMA 3L9SA 2AHEA 2R2JA 3ZYWA 1BYEA 4NXIA 1MDIA 4HZ4A 3F3QA 1M0UA 4KCEA 4G0IA 2K18A 2H66A 4K7NA 5IOWA 3IE3A 3CXGA 4K9ZA 2RUFA 1ZYPA 4Q5QA 3KMNA 2C0EA 4MDCA 1T8EB 2R3XA 5A1NA 2C1YA 5ECMB 3LW9A 2WB9A 4XCSA 3M9JA 1Y1UA 4PX1A 3DRNA 2O3EA 3C7MA 5CYYA 2H1AA 3UL3A 2HRFA 1NM3A 2GSQA 3DMLA 4JZQA 3FZAA 4PHZC 4O5UA 5KEJA 2HRNA 1F3BA 3ZMKA 4K0NA 4XS6A 4ECJA 2QA2A 3HVVA 4ZBBA 1LJRA 4KX4A 2DJKA 3IAS2 4FYCA 3EINA 4PUAA 4NV2A 1EEMA 1F3AA 3D4MA 1Q98A 1XZOA 5J41A 2V32A 4N10A 3RDWA 3GSSA 1Y6EA 5GAPD 5FT3A 4DVCA 5IPGA 2J9HA 2VAFA 3TKPA 3A5IA 2KOKA 4AKXB 3ZFLA 4BVYB 2O87A 2JZSA 5D96A 1EEJA 2LKUA 3KJYA 4XS4A 3TJFA 1OKDA 1SU9A 2WVXB 5D9VA 3LXTA 3F3RA 3L9VA 2HE3A 5ELGA 2L57A 4JEDA 5COHA 2CVDA 3HHVA 3EMXA 1SJIA 3DGQA
chains in the Genus database with same CATH topology
5ECOB 5INYA 5B8AA 5G31A 1K3YA 2DJ3A 1ST9A 3EU4A 1V9WA 3C8EA 2PVQA 5JCWA 2H76A 5CRHA 1M99A 2HSYA 4X43A 1T00A 2OA7A 4TR3A 4BWSA 3KTBA 4HU7A 4ECIA 3APSA 5DJMA 2DMMA 5EPFA 2IFQB 4L5LA 3QCPA 1GLPA 2AUVA 4GCIA 1VGLA 3LXZA 3ZLPA 3FR6A 3MWHA 1N2AA 3IXRA 2I4AA 3ZIVA 2HSNA 4TKYA 2FWGA 1UN2A 2YNXA 3RPPA 2QKEA 4MA9A 3DEXA 1K0MA 4RI6A 1SYRA 3KZQA 4TXVA 5DAKB 2C0DA 2QC7A 3GSTA 1AQVA 4ZB7A 2JU5A 3GFKA 5ECNB 5J47A 3LYKA 2WRTA 5A4VA 3TDGA 4ZL7A 1G0TA 1Z9HA 2VLUA 5J40A 3UBKA 2LNSA 1ILOA 2R4VA 4FYBA 2GTUA 3D4TA 5DVBA 1V2AA 3APOA 2E2GA 4MLYA 1SK1A 4YH2A 2PPTA 4G0LA 3KM6A 5CRDA 1XIYA 1SJZA 4ICYA 2C3TA 4N0VA 1YKAA 6GSWA 4F0CA 1XWGA 1UVZA 1S3AA 2R6KA 2DIYA 2HZEA 4ZB6A 1GSYA 5J9CA 1TU8A 1TTZA 1GSEA 4F0BA 5JWRB 1GL8A 3GX8A 2ZUPA 2DJ2A 5B8BA 3BCKA 5IO0A 2HRKA 5DBQA 4YAPA 4JU5A 5KN3A 5IPHA 4K2XA 5A5KA 4KSMA 2JSYA 1USBA 1WRYA 1PL2A 1TDIA 2VL2C 5KN0A 1JZRA 1WIKA 1T4ZA 4YKFA 1O8XA 4XIHA 4K2DA 3QFAC 4PUFC 1Z7PA 1H4OA 4ZXGA 4IJIA 2LQQA 3MIXA 1R4WA 2VIMA 5H5SA 2H0IA 4GRFA 2GQMA 4IGJA 2OE3A 4MJCA 3W8JA 2GSTA 3A5WA 5G2ZA 1U88A 5E4WA 1PKWA 5F07A 1W89A 4IN0A 2NTOA 1GSQA 1A23A 4PNGA 5FHIA 3PGTA 4KF9A 5ELAA 5ECLB 1KEBA 2EIQA 2VCTA 2K8SA 4QL9A 2MMZA 1XOAA 1SVLA 3VWVA 1PMTA 3W6GA 3N5OA 3GKMA 5GSSA 1TXUA 1GTIA 2FHEA 5HFIA 1T1VA 2H0GA 4J57E 1E6BA 1U6TA 2B5YA 4K5SA 3DD3A 3IC8A 3GRXA 2I1UA 5LD0A 4HQZA 1RK4A 4I8BA 1V57A 1ZZYA 3ZITA 3QD9A 1OC9A 3QOUA 4TR0A 1B9XC 1T4YA 2OE1A 4BL7A 4PQHA 4AKIA 3HVSA 3SBCA 6GSSA 1GP1A 2MYGA 1GNEA 3U6VA 2X99A 4JBBA 3QMXA 1SK0A 5G5EA 2L6CA 3FRCA 4QMKA 2R0CA 1IYHA 4I5QA 1ZOFA 2VCQA 4XRDA 1YJ6A 2OBIA 2VCZA 3IR4A 2XBIA 4O5RA 2EIRA 1SKRB 1EOHA 5D93A 5B6NA 2TRCP 16GSA 5DJLA 3IV4A 4Z2TA 5A4UA 1X9SB 4LL4B 3ZZXA 3A3TA 1QMVA 3EU3A 4WXTA 2VOCA 4KNDA 1IYIA 1EP7A 4KGIA 5ECSA 1AC1A 1GWCA 1OYJA 4QQ7A 1PSQA 4FYUA 3D22A 2DMLA 1T7PB 2LJAA 3DIEA 4HZ2A 3E0UA 8GSSA 20GSA 4WF5A 2LQOA 1JHBA 5CRWA 2V1MA 1A24A 3MAKA 1R5PA 2JZTA 5CRGA 4GWRA 4WETA 2BJXA 1GH2A 4BVXB 3TJKA 4X1UA 2H8LA 3GL5A 1DE1A 4KB3A 1NW2A 2B7JA 2XPEA 3G7JA 4BWQA 2MZCA 3GUSA 1XOBA 1G6YA 4F82A 3N9JA 1MDJA 2FCHA 3WGXA 5DALA 4MF6A 2R0PA 1W4VA 2KP2A 1I9DA 2DKIA 1GNWA 1HNAA 2B7KA 1PGTA 1PX7A 2C8UA 2EFCA 2IPAA 4ULXA 3TJGA 4CY6A 1A2LA 1R7HA 1O81A 5GZZB 1AW9A 2YJ7A 4J56E 3EWLA 4PTSA 3TKSE 3TCOA 1J9BA 3GNJA 3HJMA 4AI6A 2QSIA 5HR3A 2N5FA 4EC0A 3TOTA 3QR6A 3FW2A 3BJ5A 1ZYEA 5F06A 4AKGA 5A34B 2EFDA 2VD0A 5JWOB 2OE0A 3EE2A 4EKZA 4MH2A 1FOHA 1TK8B 2EFEA 1JZDA 5CAXA 2X49A 5IQYA 4K0GA 1ZGNA 2PERA 3FZ4A 4OWYA 1B9YC 2R37A 4TXOA 1ERWA 2GLRA 1BJXA 3IRAA 3F0IA 3VPTA 2VLTA 3VWXA 2H0HA 3EMPA 1KNGA 3ZL5A 2NBSA 2YCDA 2VM2A 3MYDA 1YF0A 5AIVA 2J23A 1S3CA 3WD6A 4QL7A 5AIXA 3WYWA 3HY2A 2IMEA 2F9SA 4IVFA 2F3MA 2HSHA 3TKSA 2MMAA 3GA4A 1O7UA 3ZFBA 2HSMB 4XHMA 2O7KA 4KSOA 1M2DA 5E59A 3IHQA 2V6KA 2VL3A 3GH9A 2L4QA 2JACA 1QUWA 3UARA 4LMWA 2E0QA 2FA8A 2LJKA 4AF2A 2YZHA 2H75A 4ZL8A 1FB6A 3IBHA 1LBKA 1TP9A 2GS3A 2EFHA 4AJ8A 1OE8A 1SL0B 1OE7A 5BMUB 1ON4A 1QFNA 1OVNA 2IIYA 3EC3A 1Z6MA 1VF1A 1VF3A 2DJJA 4TR1A 3IHGA 2ES7A 4MPGA 2H74A 2PBJA 1F37A 5A5HB 3W8SA 5AISA 1GUHA 4CW9A 5B7CA 1TJDA 2IFQA 1BF5A 1K0NA 1M2AA 3LSZA 2DKHA 2IMFA 1PA3A 1Z3EA 3KP8A 2R0GA 3GX0A 12GSA 2GSSA 4NHWA 2G2QA 2GGTA 3R3EA 3BOAA 3H1NA 3US3A 1BG5A 3RHBA 5ECQB 2FGXA 4RQXA 5KN2A 2FNOA 5JCGA 1SL2B 1O85A 5DAKA 4KAEA 3LFLA 4E68A 1TU7A 1M9BA 2YWOA 3CSIA 3G9BA 3P8WA 5A1NB 1BX9A 2O5VA 2AYTA 2FA4A 4WR4A 4KE3A 2IL3A 1WP0A 3ISOA 2R5GA 2HI7A 1GTBA 4IJ3A 1MDKA 4POBA 4WR5A 2F8FA 6GSUA 4POLA 4NHZA 2LJRA 2BTOT 1ZYNA 2V41A 2C0GA 3TB2A 9GSSA 2IMDA 1TOFA 5LNKe 2XPDA 1GSUA 3TGZA 1M9AA 5H5RA 3D6IA 1EV9A 1SYXA 3I69A 3BBYA 3KIJA 4GSTA 2HFDA 2KUCA 2YJHA 4K8MA 3HZ8A 4MF5A 3DVXA 2WULA 2DBCA 5HR2A 3HDCA 1XVWA 4MMMA 4TVEA 1GLQA 3MNGA 4JR6A 2DSAA 2TRXA 2MMOA 5KOXA 1X5EA 1R26A 1TW9A 3I43A 4XS4B 1FG4A 5ID2A 1X9MB 2GT5A 1JFUA 5IMDA 3QFBC 5L71A 4ML1A 4HQSA 2NPBA 3MSZA 4N11A 1E2YA 1WPIA 3F4RA 3CTFA 10GSA 3VI5A 3KP9A 4ECCA 1GSSA 5HR0A 1C72A 2H19A 1PQNA 4AKHA 2K8VA 4GDFA 3H79A 4Q5RA 1PN9A 4F03A 3LORA 5CO3A 2VCXA 2ON5A 2XBQA 1K0DA 1G7OA 2O8VB 2OADA 1XVQA 2CAIA 2WJUA 2QGVA 4JR4A 3EURA 4TR4A 1N25A 4HI7A 2HT9A 2CVKA 4EIQA 3PPUA 2XHFA 2VCWA 2H1GA 1V58A 4N30A 2H01A 5J5NA 4D73B 2K6VA 1VF2A 1RW1A 5D9XA 2A2PA 4Z2RA 3KXOA 1AAZA 2HSNB 4GF0A 2RM6A 1Z5YE 3KD0A 4EVMA 2L5LA 3ERFA 3SWLA 3GL3A 2VKZG 1ZCPA 1MEKA 1PN0A 3E3EA 4HU9A 4OD7A 2MBTA 1TK5B 2P0GA 3WT1A 3J7Yb 2AAWA 4ZILA 4G19A 19GSA 4IHUA 1Z6NA 4DSSA 4FIWA 4TW5A 4IP6A 3Q74A 5EVOA 1XXUA 1YEPA 3IK7A 3KEBA 3GTUA 1U87A 3RBTA 1SKSB 4HJMA 3TKSC 1FAAA 1MD4A 4YQVA 5A4WA 4HUAA 4G9HA 1BAYA 2JSZA 1TXXA 4CY8A 3BCIA 3A2XA 2XC2A 4KA0A 3UVHA 1B8XA 5F05A 4KDXA 4K6XA 3HZ4A 2H1LA 2HZEB 4ISDA 3ZRDA 4PQIA 1FVJA 3UVTA 1O8WA 2IMKA 5J3RA 2HRKB 2YWIA 3O3TA 1A0FA 1ZMAA 5EL8A 4V2MA 4Z7XA 5D9WA 1A2JA 4L0UA 2M80A 4IELA 2VCVA 2EIOA 1S3DA 4KDUA 2FWEA 1VRSD 4HDEA 2I81A 3TKQA 1YEXA 3FEUA 5HR1A 2VL9A 2N5AA 4EUYA 1MTCA 5IMZA 3P2AA 4K7OA 1J0FA 4NWYA 4PURA 3F6FA 4WBJA 1O6JA 1QGVA 3IC4A 1SVOA 2AV4A 3VWWA 1K3OA 4JE1A 3WT2A 4LMVA 4H86A 2K9FA 1K0BA 3L78A 3KGKA 2P31A 1JZWA 3HMJG 5ABRA 3CWGA 1GSDA 1FOVA 4MNNA 1UC7A 4PXOA 1GUMA 2VLVA 1EZKA 3L4NA 3TJBA 4E8HA 1XWBA 3FZ9A 2PWJA 1M7TA 5B6MA 4EO3A 1X5CA 3I9V2 5DCHA 1EP8A 3KMOA 3C73A 1YQ1A 4NV5A 1U3IA 4L5OA 2KHPA 4XRAA 1ACVA 3DVWA 1ZL9A 2M46A 4BA7A 1EGOA 3CRTA 3QAGA 2VUPA 1PL1A 3GH6A 4MF7A 4HS1A 5ECHB 3FZ5A 3GV1A 1OC9B 3TOUA 4I2TA 2YPMA 2A2RA 5DQSA 4BL7B 4K1FA 2H6YA 1R5AA 3O76A 4F2IA 1PKZA 3S9FA 1TI1A 2GVPA 2PVOC 1V98A 2LS5A 3KH7A 3FK8A 1HD2A 3IK9A 1YDKA 3CRUA 5J9BA 3VLNA 3EVIA 1SVMA 1O73A 1GUKA 1WOUA 2X8CA 1SL1B 2HSMA 4NAXA 1JZOA 2LTKA 4MZWA 1PD21 3VI7A 1QXHA 1I5GA 3IOSA 3KCMA 2C0FA 3FY7A 1N8JA 4WF4A 3D0ZA 1TI3A 3TRXA 4V1Ap 3M1GA 2WDUA 1DE2A 2D2ZA 2YWMA 3LG6A 3K8NA 2HLSA 1XWKA 3QPMA 2M72A 4LLRA 2YOIA 4MJAA 5AGYA 2OJLA 4IQAA 4V2LA 5F0GA 1A2MA 1G7EA 11GSA 4YQUA 2I9HA 3F4SA 2E7PA 5BMUA 2Z9SA 3NZNA 1EV4A 4IKHA 1EGRA 2RM5A 2VL2A 1PRXA 2ON7A 4Q5NA 2DIZA 3LJRA 4FO5A 1KBNA 3UEMA 1TK0B 3ZVJD 1B4QA 5KN1A 2PU9C 4TOPA 2PN8A 5DALB 5IOXA 1ABAA 1TRVA 2QA1A 3HCZA 2NDOA 2CAQA 3C1SA 3LGCA 3RAZA 1XW9A 4BPYA 4BVYA 5J4VA 2PMTA 2GQLA 1J08A 5ENUA 3R2QA 2O89A 3LWAA 3UIWA 3L0HA 3ERWA 2FY6A 2IN3A 3ZIJA 4KH7A 3M3MA 1H75A 1WE0A 2LV3A 2L6DA 5IO2A 4KCAA 4ZIJA 2FWFA 1K0CA 2VD1A 3HKRA 3NIVA 5C04A 4OO4A 3TU3B 4MCUA 4OCEA 2N5BA 2DLXA 2WS2A 2H72A 4EF0A 22GSA 2JL4A 3EYTA 1XCCA 3IA1A 4PGTA 2MBSA 4ECBA 4GQCA 2VO4A 3QAVA 4O7HA 1TRSA 4KDYA 4MJEA 1B48A 2C80A 3I6AA 4MH3A 1UA5A 3H8QA 4TXOB 1GSFA 1FO5A 2X8HA 3F63A 5J4UA 3ME7A 3FR9A 4Z2UA 3CBUA 4ZB8A 4MZCA 1URMA 5IMFA 4MP4A 3GIXA 5HFKA 4XTSA 2RUEA 5DDLA 1JLWA 3FR3A 4NPBA 3CSHA 3PINA 1HNBA 4HJ2A 2E2MA 1GTUA 3ED3A 3GURA 1THXA 4GLTA 4ACSA 5ECRB 3HYPA 5G5FA 2L4CA 3JCML 4EIPA 3VURA 17GSA 2CZ2A 4ZBDA 3VFIA 4MJBA 13GSA 3FMWA 4IBPA 3KH9A 1X9WB 2A2SA 2O85A 3HJPA 4CDOA 4O5QA 1NHOA 3C71A 1Z7RA 3D5JA 4A5PA 1WWJA 2B6MA 2GZZA 4GSNA 3FHKA 3Q18A 2H1BA 4TN8A 2HNLA 1NSWA 4IW9A 1AQWA 3ZREA 4V2NA 2P5QA 2RIIA 3P7XA 2KP1A 2MMNA 1SENA 6GSXA 2HYXA 3BD2A 2OT3A 5ECIB 2LSTA 3HJOA 2AJQB 4K7IA 2LRNA 4TR1B 3LEFA 2P5RA 2F51A 2CX4A 3IPZA 3RPNA 3U5RE 5DCGA 2FWHA 4X4JA 1ERVA 4MZBA 5HQPA 3EPTA 1XW6A 1A8LA 4E8EA 4OO5A 1F2EA 5JCUA 1CQGA 1X0RA 3GMFA 5IM9A 4Q5FA 4ZL9A 3A2VA 2EC4A 3DKSA 2F8AA 1XBSA 4D73A 2H6XA 4ML6A 3H93A 3P90A 2GZPA 3Q19A 1XWAA 3V1WA 4RUVA 2H71A 4YQMA 4EL1A 4JRRA 2IJYA 4EDYA 3KTLA 4V1Ag 2A4VA 3QAWA 4HOJA 5DQYA 1FHEA 1U3AA 18GSA 4GQFA 1OC8A 2LNTA 4F9ZA 4G10A 5AN1A 3F4TA 4LA1A 1FW1A 4EDZA 1SD9A 1TRWA 3UJ1A 2WFCA 1K3LA 4I2UA 3ZVJA 2REMA 4L0WA 2YV7A 1GULA 4CHSA 3TRQA 1B4PA 1QK8A 1Q4JA 2DJ1A 2X8GA 3GN3A 1VF4A 5GSTA 1GTAA 4G2EA 1OKTA 3FYGA 3HXSA 2HRAA 2WZ9A 4OCFA 3PR8A 1SD8A 4ILFA 4YAVA 3Q6OA 3WGEA 4G0KA 3G7YA 1HYUA 3DYRA 2V2GA 4X0XA 3M8NA 2PUKC 3CSJA 3OR5A 4N0ZA 4N3ZA 4IP1A 5BRTA 2UV8G 3ZTLA 5ECKB 3UOMA 5F8BA 1SK2A 2CZ3A 4TRXA 4XS1A 4GSSA 5G30A 1OAZA 3TUEA 1A8YA 2L5OA 1YF1A 1YY7A 2LRCA 4J2FA 4GTUA 3UMAA 4L8EA 1EOGA 4WKWA 1MD3A 5ID2B 1HQOA 3D21A 2H6ZA 3WGDA 1XW5A 2V6OA 2HQTA 2VM1A 3ME8A 4PQ1A 3MDKA 5HFGA 1F9MA 1AQXA 1ERTA 5IIZA 3APQA 1KTEA 3AY8A 3M9KA 3F8UA 1DBYA 3CTGA 4AGSA 5ECPB 2CA8A 3DXBA 2AB6A 2GDRA 2LEGA 1EWXA 3UBLA 2C3QA 2CT6A 2CX3A 2H1DA 4DSQA 2IMIA 1M2BA 2YANA 4AJ6A 4POMA 1K0AA 4IQ1A 1XPVA 4OFTA 5CP1A 3HA9A 5IMVA 1YVLA 4WBRD 2DC5A 3A2WA 4RI7A 3GYKA 3QDNA 5CNWA 4MABA 1TKDB 5KOWA 2YN1A 1CQHA 3RHCA 5G1LA 1XFLA 4BVXA 4OFMA 2I3YA 3C1RA 4I97A 1JLVA 4FQUA 1BQ7A 3L9UA 3DWVA 4OMVA 1XWCA 1BEDA 5D9TA 4ZBAA 3HVXA 2G0FA 1DUGA 2C4JA 3GHAA 1WMJA 2B5EA 2FUG2 1BG1A 4RQRA 4YKGA 3E9JB 2ZCTA 3IAM2 1T3BA 1FB0A 2KLXA 4MK3A 4NMUA 6GSTA 2GQKA 4DSSB 2WGRA 4ZB9A 1ERUA 7GSSA 1AXDA 3H4KA 1NHYA 5J4YA 2LUSA 5LCZA 3GKKA 3UAPA 3GTUB 2FD3A 1LU4A 3HD5A 5FWGA 2H70A 3PH9A 1ZYQB 2X4AA 1SKWB 2OBKA 5GAND 3LYPA 2IWTA 3O6TA 4LL1B 2CV4A 5A34A 3F6DA 2YP6A 4DEJA 1OC3A 4GXZA 6GSYA 1AIUA 1AUCA 1SJ6A 5H5QA 3ERGA 2OACA 5JWQB 1G6WA 4O32A 3TKRA 2RLIA 2OKAA 2JZRA 2YV9A 1F6MC 4MPFA 3CMIA 4K5RA 5IMAA 4PNFA 1WJKA 5CREA 4WEYA 2H73A 2B1KA 3ZMLA 6GSVA 2YZUA 2B5XA 2FLSA 4ID0A 1THOA 2YWNA 1K0OA 2GZYA 14GSA 4I6XA 4P3YB 1YZXA 3TJJA 3LQ7A 3G7IA 2HXKA 2CQ9A 1PX6A 4KUNA 3NOFA 1GRXA 3VPQA 2GSRA 2NVLA 2B1LA 2A4HA 4G01A 5C00A 4EXJA 4W66A 3VWUA 4AJ7A 2JADA 1X5DA 2L59A 4O92A 2LRTA 2X64A 4IS0A 3GKXA 4HEA2 2DJ0A 1YKCA 1TRUA 2H30A 1DSBA 4USSA 2WCIA 1ML6A 3FKFA 2UZ8A 2B3SA 1A0RP 2ALBA 1HNCA 5G1KA 4KW6A 2ZNMA 3J7Yk 3VK9A 2TIRA 4OFNA 1Y25A 5IMCA 5D73A 5EY6A 4FH8A 5D8IA 2PGTA 2BMXA 3M0FA 4EE0A 3F9UA 3IDVA 3TRPA 4DSRA 2C3NA 5A5HA 4POKA 1V40A 2HZFA 1QQ2A 1FVKA 3GKNA 2CVBA 3CYNA 2GT6A 1RQMA 3L9SA 2AHEA 2R2JA 3ZYWA 1BYEA 4NXIA 1MDIA 4HZ4A 3F3QA 1M0UA 4KCEA 4G0IA 2K18A 2H66A 4K7NA 5IOWA 3IE3A 3CXGA 4K9ZA 2RUFA 1ZYPA 4Q5QA 3KMNA 2C0EA 4MDCA 1T8EB 2R3XA 5A1NA 2C1YA 5ECMB 3LW9A 2WB9A 4XCSA 3M9JA 1Y1UA 4PX1A 3DRNA 3C7MA 5CYYA 2H1AA 3UL3A 2HRFA 1NM3A 2GSQA 3DMLA 4JZQA 3FZAA 4O5UA 5KEJA 2HRNA 1F3BA 3ZMKA 4K0NA 4XS6A 4ECJA 2QA2A 3HVVA 4ZBBA 1LJRA 4KX4A 2DJKA 3IAS2 4FYCA 3EINA 4PUAA 4NV2A 1EEMA 1F3AA 3D4MA 1Q98A 1XZOA 5J41A 2V32A 4N10A 3RDWA 3GSSA 1Y6EA 5GAPD 5FT3A 4DVCA 5IPGA 2J9HA 2VAFA 3TKPA 3A5IA 2KOKA 4AKXB 3ZFLA 4BVYB 2O87A 2JZSA 5D96A 1EEJA 2LKUA 3KJYA 4XS4A 3TJFA 1OKDA 1SU9A 5D9VA 3LXTA 3F3RA 3L9VA 2HE3A 5ELGA 2L57A 4JEDA 5COHA 2CVDA 3HHVA 3EMXA 1SJIA 3DGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECO B;  5INY A;  5B8A A;  5G31 A;  1K3Y A;  2DJ3 A;  1ST9 A;  3EU4 A;  1V9W A;  3C8E A;  2PVQ A;  5JCW A;  2H76 A;  5CRH A;  1M99 A;  2HSY A;  4X43 A;  1T00 A;  2OA7 A;  4TR3 A;  4BWS A;  3KTB A;  4HU7 A;  4ECI A;  3APS A;  5DJM A;  2DMM A;  5EPF A;  2IFQ B;  4L5L A;  3QCP A;  1GLP A;  2AUV A;  4GCI A;  1VGL A;  3LXZ A;  3ZLP A;  3FR6 A;  3MWH A;  1N2A A;  3IXR A;  2I4A A;  3ZIV A;  4TKY A;  2FWG A;  1UN2 A;  2YNX A;  3RPP A;  2QKE A;  4MA9 A;  3DEX A;  1K0M A;  4RI6 A;  1SYR A;  3KZQ A;  4TXV A;  5DAK B;  2C0D A;  2QC7 A;  3GST A;  1AQV A;  2JU5 A;  3GFK A;  5ECN B;  3LYK A;  2WRT A;  5A4V A;  3TDG A;  4ZL7 A;  1G0T A;  1Z9H A;  2VLU A;  3UBK A;  2LNS A;  1ILO A;  2R4V A;  4FYB A;  2GTU A;  3D4T A;  5DVB A;  1V2A A;  3APO A;  2E2G A;  4MLY A;  1SK1 A;  4YH2 A;  2PPT A;  4G0L A;  3KM6 A;  5CRD A;  1XIY A;  1SJZ A;  2C3T A;  4N0V A;  1YKA A;  6GSW A;  4F0C A;  1XWG A;  1UVZ A;  1S3A A;  2R6K A;  2DIY A;  2HZE A;  4ZB6 A;  1GSY A;  5J9C A;  1TU8 A;  1TTZ A;  1GSE A;  4F0B A;  5JWR B;  1GL8 A;  3GX8 A;  2ZUP A;  2DJ2 A;  5B8B A;  3BCK A;  5IO0 A;  2HRK A;  5DBQ A;  4YAP A;  4JU5 A;  5KN3 A;  5IPH A;  5A5K A;  4KSM A;  2JSY A;  1USB A;  1WRY A;  1PL2 A;  1TDI A;  2VL2 C;  5KN0 A;  1JZR A;  1WIK A;  1T4Z A;  1O8X A;  4XIH A;  4K2D A;  3QFA C;  4PUF C;  1Z7P A;  1H4O A;  4ZXG A;  4IJI A;  2LQQ A;  1R4W A;  2VIM A;  5H5S A;  2H0I A;  4GRF A;  2GQM A;  4IGJ A;  2OE3 A;  4MJC A;  3W8J A;  2GST A;  3A5W A;  5G2Z A;  1U88 A;  5E4W A;  1PKW A;  5F07 A;  1W89 A;  4IN0 A;  2NTO A;  1GSQ A;  1A23 A;  4PNG A;  5FHI A;  3PGT A;  4KF9 A;  5ELA A;  5ECL B;  1KEB A;  2EIQ A;  2VCT A;  2K8S A;  4QL9 A;  2MMZ A;  1XOA A;  3VWV A;  1PMT A;  3W6G A;  3N5O A;  3GKM A;  5GSS A;  1GTI A;  2FHE A;  5HFI A;  1T1V A;  2H0G A;  4J57 E;  1E6B A;  1U6T A;  2B5Y A;  3DD3 A;  3IC8 A;  3GRX A;  2I1U A;  5LD0 A;  4HQZ A;  1RK4 A;  4I8B A;  1V57 A;  1ZZY A;  3ZIT A;  3QD9 A;  1OC9 A;  3QOU A;  4TR0 A;  1B9X C;  1T4Y A;  2OE1 A;  4BL7 A;  4PQH A;  3HVS A;  3SBC A;  6GSS A;  1GP1 A;  2MYG A;  1GNE A;  3U6V A;  2X99 A;  4JBB A;  3QMX A;  1SK0 A;  5G5E A;  2L6C A;  3FRC A;  1IYH A;  4I5Q A;  1ZOF A;  2VCQ A;  4XRD A;  1YJ6 A;  2OBI A;  2VCZ A;  3IR4 A;  2XBI A;  4O5R A;  2EIR A;  1SKR B;  1EOH A;  5D93 A;  5B6N A;  2TRC P;  16GS A;  5DJL A;  3IV4 A;  5A4U A;  1X9S B;  4LL4 B;  3ZZX A;  3A3T A;  1QMV A;  3EU3 A;  4WXT A;  2VOC A;  4KND A;  1IYI A;  1EP7 A;  4KGI A;  5ECS A;  1AC1 A;  1GWC A;  1OYJ A;  4QQ7 A;  1PSQ A;  4FYU A;  3D22 A;  2DML A;  1T7P B;  2LJA A;  3DIE A;  4HZ2 A;  3E0U A;  8GSS A;  20GS A;  4WF5 A;  2LQO A;  1JHB A;  5CRW A;  2V1M A;  1A24 A;  3MAK A;  1R5P A;  2JZT A;  5CRG A;  4GWR A;  4WET A;  2BJX A;  1GH2 A;  4BVX B;  3TJK A;  4X1U A;  2H8L A;  3GL5 A;  1DE1 A;  4KB3 A;  1NW2 A;  2B7J A;  2XPE A;  3G7J A;  4BWQ A;  2MZC A;  3GUS A;  1XOB A;  1G6Y A;  4F82 A;  3N9J A;  1MDJ A;  2FCH A;  3WGX A;  5DAL A;  4MF6 A;  1W4V A;  2KP2 A;  1I9D A;  1GNW A;  1HNA A;  2B7K A;  1PGT A;  1PX7 A;  2C8U A;  2IPA A;  4ULX A;  3TJG A;  1A2L A;  1R7H A;  1O81 A;  5GZZ B;  1AW9 A;  2YJ7 A;  4J56 E;  3EWL A;  4PTS A;  3TKS E;  3TCO A;  1J9B A;  3GNJ A;  3HJM A;  2QSI A;  5HR3 A;  2N5F A;  4EC0 A;  3TOT A;  3QR6 A;  3FW2 A;  3BJ5 A;  1ZYE A;  5F06 A;  2VD0 A;  5JWO B;  2OE0 A;  3EE2 A;  4EKZ A;  4MH2 A;  1TK8 B;  1JZD A;  5CAX A;  5IQY A;  4K0G A;  1ZGN A;  2PER A;  3FZ4 A;  4OWY A;  1B9Y C;  2R37 A;  4TXO A;  1ERW A;  2GLR A;  1BJX A;  3IRA A;  3F0I A;  3VPT A;  2VLT A;  3VWX A;  2H0H A;  3EMP A;  1KNG A;  3ZL5 A;  2NBS A;  2YCD A;  2VM2 A;  1YF0 A;  5AIV A;  2J23 A;  1S3C A;  3WD6 A;  4QL7 A;  5AIX A;  3WYW A;  3HY2 A;  2IME A;  2F9S A;  4IVF A;  2F3M A;  2HSH A;  3TKS A;  2MMA A;  3GA4 A;  1O7U A;  3ZFB A;  2HSM B;  4XHM A;  2O7K A;  4KSO A;  1M2D A;  5E59 A;  3IHQ A;  2V6K A;  2VL3 A;  3GH9 A;  2L4Q A;  2JAC A;  1QUW A;  3UAR A;  4LMW A;  2E0Q A;  2FA8 A;  2LJK A;  4AF2 A;  2YZH A;  2H75 A;  4ZL8 A;  1FB6 A;  3IBH A;  1LBK A;  1TP9 A;  2GS3 A;  4AJ8 A;  1OE8 A;  1SL0 B;  1OE7 A;  1ON4 A;  1QFN A;  1OVN A;  2IIY A;  3EC3 A;  1Z6M A;  1VF1 A;  1VF3 A;  2DJJ A;  4TR1 A;  2ES7 A;  4MPG A;  2H74 A;  2PBJ A;  1F37 A;  3W8S A;  5AIS A;  1GUH A;  4CW9 A;  5B7C A;  1TJD A;  2IFQ A;  1K0N A;  1M2A A;  3LSZ A;  2IMF A;  1PA3 A;  1Z3E A;  3KP8 A;  3GX0 A;  12GS A;  2GSS A;  4NHW A;  2G2Q A;  2GGT A;  3R3E A;  3BOA A;  3H1N A;  3US3 A;  1BG5 A;  3RHB A;  5ECQ B;  2FGX A;  4RQX A;  5KN2 A;  2FNO A;  5JCG A;  1SL2 B;  1O85 A;  5DAK A;  4KAE A;  3LFL A;  1TU7 A;  1M9B A;  2YWO A;  3CSI A;  3G9B A;  3P8W A;  1BX9 A;  2AYT A;  2FA4 A;  4WR4 A;  4KE3 A;  2IL3 A;  1WP0 A;  3ISO A;  2R5G A;  2HI7 A;  1GTB A;  4IJ3 A;  1MDK A;  4POB A;  4WR5 A;  2F8F A;  6GSU A;  4POL A;  4NHZ A;  2LJR A;  2BTO T;  2V41 A;  2C0G A;  3TB2 A;  9GSS A;  2IMD A;  1TOF A;  5LNK e;  2XPD A;  1GSU A;  3TGZ A;  1M9A A;  5H5R A;  3D6I A;  1EV9 A;  1SYX A;  3I69 A;  3BBY A;  3KIJ A;  4GST A;  2HFD A;  2KUC A;  2YJH A;  4K8M A;  3HZ8 A;  4MF5 A;  3DVX A;  2WUL A;  2DBC A;  5HR2 A;  3HDC A;  1XVW A;  4MMM A;  4TVE A;  1GLQ A;  3MNG A;  4JR6 A;  2DSA A;  2TRX A;  2MMO A;  1X5E A;  1R26 A;  1TW9 A;  3I43 A;  4XS4 B;  1FG4 A;  5ID2 A;  1X9M B;  2GT5 A;  1JFU A;  5IMD A;  3QFB C;  5L71 A;  4ML1 A;  4HQS A;  2NPB A;  3MSZ A;  4N11 A;  1E2Y A;  1WPI A;  3F4R A;  3CTF A;  10GS A;  3VI5 A;  3KP9 A;  4ECC A;  1GSS A;  5HR0 A;  1C72 A;  2H19 A;  1PQN A;  2K8V A;  3H79 A;  4Q5R A;  1PN9 A;  4F03 A;  3LOR A;  5CO3 A;  2VCX A;  2ON5 A;  2XBQ A;  1K0D A;  1G7O A;  2O8V B;  2OAD A;  1XVQ A;  2CAI A;  2WJU A;  2QGV A;  4JR4 A;  3EUR A;  4TR4 A;  4HI7 A;  2HT9 A;  2CVK A;  3PPU A;  2XHF A;  2VCW A;  2H1G A;  1V58 A;  4N30 A;  2H01 A;  5J5N A;  4D73 B;  2K6V A;  1VF2 A;  1RW1 A;  5D9X A;  3KXO A;  1AAZ A;  2HSN B;  4GF0 A;  2RM6 A;  1Z5Y E;  3KD0 A;  4EVM A;  2L5L A;  3ERF A;  3SWL A;  3GL3 A;  1ZCP A;  1MEK A;  3E3E A;  4HU9 A;  4OD7 A;  2MBT A;  1TK5 B;  2P0G A;  3WT1 A;  3J7Y b;  2AAW A;  4ZIL A;  4G19 A;  19GS A;  4IHU A;  1Z6N A;  4DSS A;  4FIW A;  4TW5 A;  4IP6 A;  3Q74 A;  5EVO A;  1XXU A;  1YEP A;  3IK7 A;  3KEB A;  3GTU A;  1U87 A;  3RBT A;  1SKS B;  4HJM A;  3TKS C;  1FAA A;  1MD4 A;  4YQV A;  5A4W A;  4HUA A;  4G9H A;  1BAY A;  2JSZ A;  1TXX A;  3BCI A;  3A2X A;  2XC2 A;  4KA0 A;  3UVH A;  1B8X A;  5F05 A;  4KDX A;  4K6X A;  3HZ4 A;  2HZE B;  4ISD A;  3ZRD A;  4PQI A;  1FVJ A;  3UVT A;  1O8W A;  2IMK A;  5J3R A;  2HRK B;  2YWI A;  3O3T A;  1A0F A;  1ZMA A;  5EL8 A;  4V2M A;  4Z7X A;  5D9W A;  1A2J A;  4L0U A;  2M80 A;  4IEL A;  2VCV A;  2EIO A;  1S3D A;  4KDU A;  2FWE A;  1VRS D;  4HDE A;  2I81 A;  3TKQ A;  1YEX A;  3FEU A;  5HR1 A;  2VL9 A;  2N5A A;  4EUY A;  1MTC A;  5IMZ A;  3P2A A;  4K7O A;  1J0F A;  4NWY A;  4PUR A;  3F6F A;  4WBJ A;  1O6J A;  1QGV A;  3IC4 A;  2AV4 A;  3VWW A;  1K3O A;  4JE1 A;  3WT2 A;  4LMV A;  4H86 A;  2K9F A;  1K0B A;  3L78 A;  3KGK A;  2P31 A;  1JZW A;  5ABR A;  1GSD A;  1FOV A;  1UC7 A;  4PXO A;  1GUM A;  2VLV A;  1EZK A;  3L4N A;  3TJB A;  4E8H A;  1XWB A;  3FZ9 A;  2PWJ A;  1M7T A;  5B6M A;  4EO3 A;  1X5C A;  3I9V 2;  5DCH A;  1EP8 A;  3KMO A;  3C73 A;  1YQ1 A;  4NV5 A;  1U3I A;  4L5O A;  2KHP A;  4XRA A;  1ACV A;  3DVW A;  1ZL9 A;  2M46 A;  4BA7 A;  1EGO A;  3CRT A;  3QAG A;  2VUP A;  1PL1 A;  3GH6 A;  4MF7 A;  4HS1 A;  5ECH B;  3FZ5 A;  3GV1 A;  1OC9 B;  3TOU A;  4I2T A;  2YPM A;  2A2R A;  5DQS A;  4BL7 B;  4K1F A;  2H6Y A;  1R5A A;  3O76 A;  4F2I A;  1PKZ A;  3S9F A;  1TI1 A;  2GVP A;  2PVO C;  1V98 A;  2LS5 A;  3KH7 A;  3FK8 A;  1HD2 A;  3IK9 A;  1YDK A;  3CRU A;  5J9B A;  3VLN A;  3EVI A;  1O73 A;  1GUK A;  1WOU A;  2X8C A;  1SL1 B;  2HSM A;  4NAX A;  1JZO A;  2LTK A;  4MZW A;  1PD2 1;  3VI7 A;  1QXH A;  1I5G A;  3IOS A;  3KCM A;  2C0F A;  3FY7 A;  1N8J A;  4WF4 A;  3D0Z A;  1TI3 A;  3TRX A;  4V1A p;  3M1G A;  2WDU A;  1DE2 A;  2D2Z A;  2YWM A;  3LG6 A;  3K8N A;  2HLS A;  1XWK A;  3QPM A;  2M72 A;  4LLR A;  2YOI A;  4MJA A;  5AGY A;  2OJL A;  4IQA A;  4V2L A;  5F0G A;  1A2M A;  1G7E A;  11GS A;  4YQU A;  2I9H A;  3F4S A;  2E7P A;  5BMU A;  2Z9S A;  3NZN A;  1EV4 A;  4IKH A;  1EGR A;  2RM5 A;  2VL2 A;  1PRX A;  2ON7 A;  4Q5N A;  2DIZ A;  3LJR A;  4FO5 A;  1KBN A;  3UEM A;  1TK0 B;  3ZVJ D;  1B4Q A;  5KN1 A;  2PU9 C;  4TOP A;  2PN8 A;  5DAL B;  5IOX A;  1ABA A;  1TRV A;  3HCZ A;  2NDO A;  2CAQ A;  3C1S A;  3LGC A;  3RAZ A;  1XW9 A;  4BPY A;  4BVY A;  2PMT A;  2GQL A;  1J08 A;  5ENU A;  3R2Q A;  2O89 A;  3LWA A;  3UIW A;  3L0H A;  3ERW A;  2FY6 A;  2IN3 A;  3ZIJ A;  4KH7 A;  3M3M A;  1H75 A;  1WE0 A;  2LV3 A;  2L6D A;  5IO2 A;  4KCA A;  4ZIJ A;  2FWF A;  1K0C A;  2VD1 A;  3HKR A;  3NIV A;  5C04 A;  4OO4 A;  4MCU A;  4OCE A;  2N5B A;  2DLX A;  2WS2 A;  2H72 A;  4EF0 A;  22GS A;  2JL4 A;  3EYT A;  1XCC A;  3IA1 A;  4PGT A;  2MBS A;  4ECB A;  4GQC A;  2VO4 A;  3QAV A;  4O7H A;  1TRS A;  4KDY A;  4MJE A;  1B48 A;  2C80 A;  3I6A A;  4MH3 A;  1UA5 A;  3H8Q A;  4TXO B;  1GSF A;  1FO5 A;  2X8H A;  3F63 A;  5J4U A;  3ME7 A;  3FR9 A;  3CBU A;  4ZB8 A;  4MZC A;  1URM A;  5IMF A;  4MP4 A;  3GIX A;  5HFK A;  4XTS A;  2RUE A;  5DDL A;  1JLW A;  3FR3 A;  4NPB A;  3CSH A;  3PIN A;  1HNB A;  4HJ2 A;  2E2M A;  1GTU A;  3ED3 A;  3GUR A;  1THX A;  4GLT A;  4ACS A;  5ECR B;  3HYP A;  5G5F A;  2L4C A;  3JCM L;  3VUR A;  17GS A;  2CZ2 A;  4ZBD A;  3VFI A;  4MJB A;  13GS A;  4IBP A;  3KH9 A;  1X9W B;  2A2S A;  2O85 A;  3HJP A;  4CDO A;  1NHO A;  3C71 A;  1Z7R A;  3D5J A;  1WWJ A;  2B6M A;  2GZZ A;  4GSN A;  3FHK A;  3Q18 A;  2H1B A;  4TN8 A;  2HNL A;  1NSW A;  4IW9 A;  1AQW A;  3ZRE A;  4V2N A;  2P5Q A;  2RII A;  3P7X A;  2KP1 A;  2MMN A;  1SEN A;  6GSX A;  2HYX A;  3BD2 A;  5ECI B;  2LST A;  3HJO A;  2AJQ B;  4K7I A;  2LRN A;  4TR1 B;  3LEF A;  2P5R A;  2F51 A;  2CX4 A;  3IPZ A;  3RPN A;  3U5R E;  5DCG A;  2FWH A;  1ERV A;  4MZB A;  5HQP A;  1XW6 A;  1A8L A;  4E8E A;  4OO5 A;  1F2E A;  5JCU A;  1CQG A;  1X0R A;  3GMF A;  5IM9 A;  4Q5F A;  4ZL9 A;  3A2V A;  2EC4 A;  3DKS A;  2F8A A;  1XBS A;  4D73 A;  2H6X A;  4ML6 A;  3H93 A;  3P90 A;  2GZP A;  3Q19 A;  1XWA A;  3V1W A;  4RUV A;  2H71 A;  4YQM A;  4EL1 A;  4JRR A;  2IJY A;  4EDY A;  3KTL A;  4V1A g;  2A4V A;  3QAW A;  4HOJ A;  5DQY A;  1FHE A;  1U3A A;  18GS A;  4GQF A;  1OC8 A;  2LNT A;  4F9Z A;  4G10 A;  5AN1 A;  3F4T A;  4LA1 A;  1FW1 A;  4EDZ A;  1SD9 A;  1TRW A;  3UJ1 A;  2WFC A;  1K3L A;  4I2U A;  3ZVJ A;  2REM A;  4L0W A;  2YV7 A;  1GUL A;  4CHS A;  3TRQ A;  1B4P A;  1QK8 A;  1Q4J A;  2DJ1 A;  2X8G A;  3GN3 A;  1VF4 A;  5GST A;  1GTA A;  4G2E A;  1OKT A;  3FYG A;  3HXS A;  2HRA A;  2WZ9 A;  4OCF A;  3PR8 A;  1SD8 A;  4ILF A;  4YAV A;  3Q6O A;  3WGE A;  4G0K A;  3G7Y A;  1HYU A;  3DYR A;  2V2G A;  4X0X A;  3M8N A;  2PUK C;  3CSJ A;  3OR5 A;  4N0Z A;  4IP1 A;  3ZTL A;  5ECK B;  3UOM A;  5F8B A;  1SK2 A;  2CZ3 A;  4TRX A;  4XS1 A;  4GSS A;  5G30 A;  1OAZ A;  3TUE A;  1A8Y A;  2L5O A;  1YF1 A;  1YY7 A;  2LRC A;  4J2F A;  4GTU A;  3UMA A;  4L8E A;  1EOG A;  4WKW A;  1MD3 A;  5ID2 B;  1HQO A;  3D21 A;  2H6Z A;  3WGD A;  1XW5 A;  2V6O A;  2HQT A;  2VM1 A;  3ME8 A;  4PQ1 A;  3MDK A;  5HFG A;  1F9M A;  1AQX A;  1ERT A;  5IIZ A;  3APQ A;  1KTE A;  3AY8 A;  3M9K A;  3F8U A;  1DBY A;  3CTG A;  4AGS A;  5ECP B;  2CA8 A;  3DXB A;  2AB6 A;  2GDR A;  2LEG A;  1EWX A;  3UBL A;  2C3Q A;  2CT6 A;  2CX3 A;  2H1D A;  4DSQ A;  2IMI A;  1M2B A;  2YAN A;  4AJ6 A;  4POM A;  1K0A A;  4IQ1 A;  1XPV A;  4OFT A;  5CP1 A;  3HA9 A;  5IMV A;  4WBR D;  2DC5 A;  3A2W A;  4RI7 A;  3GYK A;  3QDN A;  5CNW A;  4MAB A;  1TKD B;  2YN1 A;  1CQH A;  3RHC A;  5G1L A;  1XFL A;  4BVX A;  4OFM A;  2I3Y A;  3C1R A;  4I97 A;  1JLV A;  4FQU A;  1BQ7 A;  3L9U A;  3DWV A;  4OMV A;  1XWC A;  1BED A;  5D9T A;  4ZBA A;  3HVX A;  2G0F A;  1DUG A;  2C4J A;  3GHA A;  1WMJ A;  2B5E A;  2FUG 2;  4RQR A;  3E9J B;  2ZCT A;  3IAM 2;  1T3B A;  1FB0 A;  2KLX A;  4MK3 A;  4NMU A;  6GST A;  2GQK A;  4DSS B;  2WGR A;  4ZB9 A;  1ERU A;  7GSS A;  1AXD A;  3H4K A;  1NHY A;  2LUS A;  5LCZ A;  3GKK A;  3UAP A;  3GTU B;  2FD3 A;  1LU4 A;  3HD5 A;  5FWG A;  2H70 A;  3PH9 A;  1ZYQ B;  1SKW B;  2OBK A;  5GAN D;  3LYP A;  2IWT A;  3O6T A;  4LL1 B;  2CV4 A;  3F6D A;  2YP6 A;  4DEJ A;  1OC3 A;  4GXZ A;  6GSY A;  1AIU A;  1AUC A;  1SJ6 A;  5H5Q A;  3ERG A;  2OAC A;  5JWQ B;  1G6W A;  4O32 A;  3TKR A;  2RLI A;  2OKA A;  2JZR A;  2YV9 A;  1F6M C;  4MPF A;  3CMI A;  5IMA A;  4PNF A;  1WJK A;  5CRE A;  4WEY A;  2H73 A;  2B1K A;  3ZML A;  6GSV A;  2YZU A;  2B5X A;  2FLS A;  4ID0 A;  1THO A;  2YWN A;  1K0O A;  2GZY A;  14GS A;  4I6X A;  4P3Y B;  1YZX A;  3TJJ A;  3LQ7 A;  3G7I A;  2HXK A;  2CQ9 A;  1PX6 A;  4KUN A;  3NOF A;  1GRX A;  3VPQ A;  2GSR A;  2NVL A;  2B1L A;  5C00 A;  4EXJ A;  3VWU A;  4AJ7 A;  2JAD A;  1X5D A;  2L59 A;  4O92 A;  2LRT A;  2X64 A;  4IS0 A;  3GKX A;  4HEA 2;  2DJ0 A;  1YKC A;  1TRU A;  2H30 A;  1DSB A;  4USS A;  2WCI A;  1ML6 A;  3FKF A;  2UZ8 A;  2B3S A;  1A0R P;  2ALB A;  1HNC A;  5G1K A;  4KW6 A;  2ZNM A;  3J7Y k;  3VK9 A;  2TIR A;  4OFN A;  1Y25 A;  5IMC A;  5D73 A;  5EY6 A;  4FH8 A;  5D8I A;  2PGT A;  2BMX A;  3M0F A;  4EE0 A;  3F9U A;  3IDV A;  3TRP A;  4DSR A;  2C3N A;  4POK A;  1V40 A;  2HZF A;  1QQ2 A;  1FVK A;  3GKN A;  2CVB A;  3CYN A;  2GT6 A;  1RQM A;  3L9S A;  2AHE A;  2R2J A;  3ZYW A;  1BYE A;  4NXI A;  1MDI A;  4HZ4 A;  3F3Q A;  1M0U A;  4KCE A;  4G0I A;  2K18 A;  2H66 A;  4K7N A;  5IOW A;  3IE3 A;  3CXG A;  4K9Z A;  2RUF A;  4Q5Q A;  3KMN A;  2C0E A;  4MDC A;  1T8E B;  2R3X A;  2C1Y A;  5ECM B;  2WB9 A;  4XCS A;  3M9J A;  4PX1 A;  3DRN A;  3C7M A;  5CYY A;  2H1A A;  3UL3 A;  2HRF A;  1NM3 A;  2GSQ A;  3DML A;  4JZQ A;  3FZA A;  5KEJ A;  2HRN A;  1F3B A;  3ZMK A;  4K0N A;  4XS6 A;  4ECJ A;  3HVV A;  4ZBB A;  1LJR A;  4KX4 A;  2DJK A;  3IAS 2;  4FYC A;  3EIN A;  4PUA A;  4NV2 A;  1EEM A;  1F3A A;  3D4M A;  1Q98 A;  1XZO A;  5J41 A;  2V32 A;  4N10 A;  3RDW A;  3GSS A;  1Y6E A;  5GAP D;  5FT3 A;  4DVC A;  5IPG A;  2J9H A;  2VAF A;  3TKP A;  2KOK A;  3ZFL A;  4BVY B;  2O87 A;  2JZS A;  5D96 A;  1EEJ A;  2LKU A;  3KJY A;  4XS4 A;  3TJF A;  1OKD A;  1SU9 A;  5D9V A;  3LXT A;  3F3R A;  3L9V A;  2HE3 A;  5ELG A;  2L57 A;  4JED A;  5COH A;  2CVD A;  3HHV A;  3EMX A;  1SJI A;  3DGQ A; 
#chains in the Genus database with same CATH topology
 5ECO B;  5INY A;  5B8A A;  5G31 A;  1K3Y A;  2DJ3 A;  1ST9 A;  3EU4 A;  1V9W A;  3C8E A;  2PVQ A;  5JCW A;  2H76 A;  5CRH A;  1M99 A;  2HSY A;  4X43 A;  1T00 A;  2OA7 A;  4TR3 A;  4BWS A;  3KTB A;  4HU7 A;  4ECI A;  3APS A;  5DJM A;  2DMM A;  5EPF A;  2IFQ B;  4L5L A;  3QCP A;  1GLP A;  2AUV A;  4GCI A;  1VGL A;  3LXZ A;  3ZLP A;  3FR6 A;  3MWH A;  1N2A A;  3IXR A;  2I4A A;  3ZIV A;  2HSN A;  1M3I A;  4TKY A;  2FWG A;  1UN2 A;  2YNX A;  3RPP A;  2QKE A;  4MA9 A;  1S4B P;  3DEX A;  1K0M A;  4RI6 A;  1SYR A;  3KZQ A;  4TXV A;  5DAK B;  2C0D A;  2QC7 A;  3GST A;  1AQV A;  4ZB7 A;  2JU5 A;  3GFK A;  5ECN B;  5J47 A;  3LYK A;  2WRT A;  5A4V A;  3TDG A;  4ZL7 A;  1G0T A;  1Z9H A;  2VLU A;  5J40 A;  3UBK A;  2LNS A;  1ILO A;  2R4V A;  4FYB A;  2GTU A;  3D4T A;  5DVB A;  1V2A A;  3APO A;  2E2G A;  4MLY A;  1SK1 A;  4YH2 A;  2PPT A;  4G0L A;  3KM6 A;  5CRD A;  1XIY A;  1SJZ A;  4ICY A;  2C3T A;  4N0V A;  4BIK A;  1YKA A;  6GSW A;  4F0C A;  1XWG A;  1UVZ A;  1S3A A;  2R6K A;  2DIY A;  2HZE A;  4ZB6 A;  1GSY A;  5J9C A;  1TU8 A;  1TTZ A;  1GSE A;  4F0B A;  5JWR B;  1GL8 A;  3GX8 A;  2ZUP A;  2DJ2 A;  5B8B A;  3BCK A;  5IO0 A;  2HRK A;  5DBQ A;  4YAP A;  4JU5 A;  5KN3 A;  5IPH A;  4K2X A;  5A5K A;  4KSM A;  2JSY A;  1USB A;  1WRY A;  1PL2 A;  1TDI A;  2VL2 C;  5KN0 A;  1JZR A;  1WIK A;  1T4Z A;  4YKF A;  1O8X A;  4XIH A;  4K2D A;  3QFA C;  4PUF C;  1Z7P A;  1H4O A;  4ZXG A;  4IJI A;  2LQQ A;  3MIX A;  1R4W A;  2VIM A;  5H5S A;  2H0I A;  4GRF A;  2GQM A;  4IGJ A;  2OE3 A;  4MJC A;  3W8J A;  2GST A;  3A5W A;  5G2Z A;  1U88 A;  5E4W A;  1PKW A;  5F07 A;  1W89 A;  4IN0 A;  2NTO A;  1GSQ A;  1A23 A;  4PNG A;  5FHI A;  3PGT A;  4KF9 A;  5ELA A;  5ECL B;  1KEB A;  2EIQ A;  2VCT A;  2K8S A;  4QL9 A;  2MMZ A;  1XOA A;  1SVL A;  3VWV A;  1PMT A;  3W6G A;  3N5O A;  3GKM A;  5GSS A;  1TXU A;  1GTI A;  2FHE A;  5HFI A;  1T1V A;  2H0G A;  4J57 E;  1E6B A;  1U6T A;  2B5Y A;  4K5S A;  3DD3 A;  3IC8 A;  3GRX A;  2I1U A;  5LD0 A;  4HQZ A;  1RK4 A;  4I8B A;  4FXY P;  1V57 A;  1ZZY A;  3ZIT A;  3QD9 A;  1OC9 A;  3QOU A;  4TR0 A;  1B9X C;  1T4Y A;  2OE1 A;  4BL7 A;  4PQH A;  4AKI A;  3HVS A;  3SBC A;  6GSS A;  1GP1 A;  2MYG A;  1GNE A;  3U6V A;  2X99 A;  4JBB A;  3QMX A;  1SK0 A;  5G5E A;  2L6C A;  3CQF A;  3FRC A;  4QMK A;  2R0C A;  1IYH A;  4I5Q A;  1ZOF A;  2VCQ A;  4XRD A;  1YJ6 A;  2OBI A;  2VCZ A;  3IR4 A;  2XBI A;  4O5R A;  2EIR A;  1SKR B;  1EOH A;  5D93 A;  5B6N A;  2TRC P;  16GS A;  5DJL A;  3IV4 A;  4Z2T A;  5A4U A;  1X9S B;  4LL4 B;  3ZZX A;  3A3T A;  1QMV A;  3EU3 A;  4WXT A;  2VOC A;  4KND A;  1IYI A;  1EP7 A;  4KGI A;  5ECS A;  1AC1 A;  1GWC A;  1OYJ A;  4QQ7 A;  1PSQ A;  4FYU A;  3D22 A;  2DML A;  1T7P B;  2LJA A;  3DIE A;  4HZ2 A;  3E0U A;  8GSS A;  20GS A;  4WF5 A;  2LQO A;  1JHB A;  5CRW A;  2V1M A;  1A24 A;  3MAK A;  1R5P A;  2JZT A;  5CRG A;  4GWR A;  4WET A;  2BJX A;  1GH2 A;  4BVX B;  3TJK A;  4X1U A;  2H8L A;  3GL5 A;  1DE1 A;  4KB3 A;  1NW2 A;  2B7J A;  2XPE A;  3G7J A;  4BWQ A;  2MZC A;  3GUS A;  3CHX C;  1XOB A;  1G6Y A;  4F82 A;  3N9J A;  1MDJ A;  2FCH A;  3WGX A;  5DAL A;  4MF6 A;  2R0P A;  1W4V A;  2KP2 A;  1I9D A;  2DKI A;  1GNW A;  1HNA A;  2B7K A;  1PGT A;  1PX7 A;  2C8U A;  2EFC A;  2IPA A;  4ULX A;  3TJG A;  4CY6 A;  1A2L A;  1R7H A;  1O81 A;  5GZZ B;  1AW9 A;  2YJ7 A;  4J56 E;  3EWL A;  4PTS A;  3TKS E;  3TCO A;  4HSC X;  1J9B A;  3GNJ A;  1XG8 A;  3HJM A;  4AI6 A;  2QSI A;  5HR3 A;  2N5F A;  4EC0 A;  3TOT A;  3QR6 A;  3FW2 A;  3BJ5 A;  1ZYE A;  5F06 A;  4AKG A;  5A34 B;  2EFD A;  2VD0 A;  5JWO B;  2OE0 A;  3EE2 A;  4EKZ A;  4MH2 A;  1FOH A;  1TK8 B;  2EFE A;  1JZD A;  5CAX A;  2X49 A;  5IQY A;  4K0G A;  1ZGN A;  2PER A;  3FZ4 A;  4OWY A;  1B9Y C;  2R37 A;  4TXO A;  1ERW A;  2GLR A;  1BJX A;  3IRA A;  3F0I A;  3VPT A;  2VLT A;  3VWX A;  2H0H A;  3EMP A;  1KNG A;  3ZL5 A;  2NBS A;  2YCD A;  2VM2 A;  3MYD A;  1YF0 A;  5AIV A;  2J23 A;  1S3C A;  3WD6 A;  4QL7 A;  5AIX A;  3WYW A;  3HY2 A;  2IME A;  2F9S A;  4IVF A;  2F3M A;  2HSH A;  3TKS A;  2MMA A;  3GA4 A;  1O7U A;  3ZFB A;  2HSM B;  4XHM A;  2O7K A;  4KSO A;  1M2D A;  5E59 A;  3IHQ A;  2V6K A;  2VL3 A;  3GH9 A;  2L4Q A;  2JAC A;  2WVX A;  1QUW A;  3UAR A;  4LMW A;  2E0Q A;  2FA8 A;  2LJK A;  4AF2 A;  2YZH A;  2H75 A;  4ZL8 A;  1FB6 A;  3IBH A;  1LBK A;  1TP9 A;  2GS3 A;  2EFH A;  4AJ8 A;  1OE8 A;  1SL0 B;  1OE7 A;  5BMU B;  1ON4 A;  1QFN A;  1OVN A;  2IIY A;  3EC3 A;  1Z6M A;  1VF1 A;  1VF3 A;  2DJJ A;  4TR1 A;  3IHG A;  2ES7 A;  4MPG A;  2H74 A;  2PBJ A;  1F37 A;  5A5H B;  3W8S A;  5AIS A;  1GUH A;  4CW9 A;  5B7C A;  1TJD A;  2IFQ A;  1BF5 A;  1K0N A;  1M2A A;  3LSZ A;  2DKH A;  2IMF A;  1PA3 A;  1Z3E A;  3KP8 A;  2R0G A;  3GX0 A;  12GS A;  2GSS A;  4NHW A;  2G2Q A;  2GGT A;  3R3E A;  3BOA A;  3H1N A;  3US3 A;  1BG5 A;  3RHB A;  5ECQ B;  2FGX A;  4RQX A;  5KN2 A;  2FNO A;  5JCG A;  1SL2 B;  1O85 A;  5DAK A;  4KAE A;  3LFL A;  4E68 A;  1TU7 A;  1M9B A;  2YWO A;  3CSI A;  3G9B A;  3P8W A;  5A1N B;  1BX9 A;  2O5V A;  2AYT A;  2FA4 A;  4WR4 A;  4KE3 A;  2IL3 A;  1WP0 A;  3ISO A;  2R5G A;  2HI7 A;  1GTB A;  4IJ3 A;  1MDK A;  4POB A;  4WR5 A;  2F8F A;  6GSU A;  4POL A;  4NHZ A;  2LJR A;  2BTO T;  1ZYN A;  2V41 A;  2C0G A;  3TB2 A;  9GSS A;  2IMD A;  1TOF A;  5LNK e;  2XPD A;  1GSU A;  3TGZ A;  1M9A A;  5H5R A;  3D6I A;  1EV9 A;  1SYX A;  3I69 A;  3BBY A;  3KIJ A;  4GST A;  2HFD A;  2KUC A;  2YJH A;  4K8M A;  3HZ8 A;  4MF5 A;  3DVX A;  2WUL A;  2DBC A;  5HR2 A;  3HDC A;  1XVW A;  4MMM A;  4TVE A;  1GLQ A;  3MNG A;  4JR6 A;  2DSA A;  2TRX A;  2MMO A;  5KOX A;  1X5E A;  1R26 A;  1TW9 A;  3I43 A;  4XS4 B;  1FG4 A;  5ID2 A;  1X9M B;  2GT5 A;  1JFU A;  1PFO A;  5IMD A;  3QFB C;  5L71 A;  4ML1 A;  4HQS A;  2NPB A;  3MSZ A;  4N11 A;  2WW3 A;  1E2Y A;  1WPI A;  3F4R A;  3CTF A;  10GS A;  3VI5 A;  3KP9 A;  4ECC A;  1GSS A;  5HR0 A;  1C72 A;  2H19 A;  1PQN A;  4AKH A;  2K8V A;  4GDF A;  3H79 A;  4Q5R A;  1PN9 A;  4F03 A;  3LOR A;  5CO3 A;  2VCX A;  2ON5 A;  2XBQ A;  1K0D A;  1G7O A;  2O8V B;  2OAD A;  1XVQ A;  2CAI A;  2WJU A;  2QGV A;  4JR4 A;  3EUR A;  4TR4 A;  1N25 A;  4HI7 A;  2HT9 A;  2CVK A;  4EIQ A;  3PPU A;  2XHF A;  2VCW A;  2H1G A;  1V58 A;  4N30 A;  2H01 A;  5J5N A;  4D73 B;  2K6V A;  1VF2 A;  1RW1 A;  5D9X A;  2A2P A;  4Z2R A;  3KXO A;  1AAZ A;  2HSN B;  4GF0 A;  2RM6 A;  1Z5Y E;  3KD0 A;  4EVM A;  2L5L A;  3ERF A;  3SWL A;  3GL3 A;  2VKZ G;  1ZCP A;  1MEK A;  1PN0 A;  3E3E A;  4HU9 A;  4OD7 A;  2MBT A;  1TK5 B;  2P0G A;  3WT1 A;  3J7Y b;  2AAW A;  4ZIL A;  4G19 A;  19GS A;  4IHU A;  1Z6N A;  4DSS A;  4FIW A;  4TW5 A;  4IP6 A;  3Q74 A;  5EVO A;  1XXU A;  1YEP A;  3IK7 A;  3KEB A;  3GTU A;  1U87 A;  3RBT A;  1SKS B;  4HJM A;  3TKS C;  1FAA A;  1MD4 A;  4YQV A;  5A4W A;  4HUA A;  4G9H A;  1BAY A;  2JSZ A;  1TXX A;  4CY8 A;  3BCI A;  3A2X A;  2XC2 A;  4KA0 A;  3UVH A;  1B8X A;  5F05 A;  4KDX A;  4K6X A;  3HZ4 A;  2H1L A;  2HZE B;  4ISD A;  3ZRD A;  4PQI A;  1FVJ A;  3UVT A;  1O8W A;  2IMK A;  5J3R A;  2HRK B;  2YWI A;  3O3T A;  1YEW C;  1A0F A;  1ZMA A;  5EL8 A;  4V2M A;  4Z7X A;  5D9W A;  1A2J A;  4L0U A;  2WVY A;  2M80 A;  4IEL A;  2VCV A;  2EIO A;  1S3D A;  4KDU A;  2FWE A;  1VRS D;  4HDE A;  2I81 A;  3TKQ A;  1YEX A;  3FEU A;  5HR1 A;  2VL9 A;  2N5A A;  4EUY A;  1MTC A;  5IMZ A;  4PI0 C;  3P2A A;  4K7O A;  1J0F A;  4NWY A;  4PUR A;  3F6F A;  4WBJ A;  1O6J A;  1QGV A;  3IC4 A;  1SVO A;  2AV4 A;  3VWW A;  1K3O A;  4JE1 A;  3WT2 A;  4LMV A;  4H86 A;  2K9F A;  1K0B A;  3L78 A;  3KGK A;  2P31 A;  1JZW A;  3HMJ G;  5ABR A;  3CWG A;  1GSD A;  1FOV A;  4MNN A;  1UC7 A;  4PXO A;  1GUM A;  2VLV A;  1EZK A;  3L4N A;  3TJB A;  4E8H A;  1XWB A;  3FZ9 A;  2PWJ A;  1M7T A;  5B6M A;  4EO3 A;  1X5C A;  3I9V 2;  5DCH A;  1EP8 A;  3KMO A;  3C73 A;  1YQ1 A;  4NV5 A;  1U3I A;  4L5O A;  2KHP A;  4XRA A;  1ACV A;  3DVW A;  1ZL9 A;  2M46 A;  4BA7 A;  1EGO A;  3CRT A;  3QAG A;  2VUP A;  1PL1 A;  3GH6 A;  4MF7 A;  4HS1 A;  5ECH B;  3FZ5 A;  3GV1 A;  1OC9 B;  3TOU A;  4I2T A;  2YPM A;  2A2R A;  1S3R A;  5DQS A;  4BL7 B;  4K1F A;  2H6Y A;  1R5A A;  3O76 A;  4F2I A;  1PKZ A;  3S9F A;  1TI1 A;  2GVP A;  2PVO C;  1V98 A;  2LS5 A;  3FK8 A;  3KH7 A;  1HD2 A;  3IK9 A;  1YDK A;  3CRU A;  5J9B A;  3VLN A;  3EVI A;  1SVM A;  1O73 A;  1GUK A;  1WOU A;  2WW1 A;  2X8C A;  1SL1 B;  2HSM A;  4NAX A;  1JZO A;  2LTK A;  4MZW A;  1PD2 1;  3VI7 A;  1QXH A;  1I5G A;  3IOS A;  3KCM A;  2C0F A;  3FY7 A;  1N8J A;  4WF4 A;  3D0Z A;  1TI3 A;  3TRX A;  4V1A p;  3M1G A;  2WDU A;  1DE2 A;  2D2Z A;  2YWM A;  3LG6 A;  3K8N A;  2HLS A;  1XWK A;  3QPM A;  2M72 A;  4LLR A;  2YOI A;  4MJA A;  5AGY A;  2OJL A;  4IQA A;  4V2L A;  5F0G A;  1A2M A;  1G7E A;  11GS A;  4YQU A;  2I9H A;  3F4S A;  2E7P A;  5BMU A;  2Z9S A;  3NZN A;  1EV4 A;  4IKH A;  1EGR A;  2RM5 A;  2VL2 A;  1PRX A;  2ON7 A;  4Q5N A;  2DIZ A;  3HVN A;  3LJR A;  4FO5 A;  1KBN A;  3UEM A;  1TK0 B;  3ZVJ D;  1B4Q A;  5KN1 A;  2PU9 C;  4TOP A;  2PN8 A;  5DAL B;  5IOX A;  1ABA A;  1TRV A;  2QA1 A;  3HCZ A;  2NDO A;  2CAQ A;  3C1S A;  3LGC A;  3RAZ A;  1XW9 A;  4BPY A;  4BVY A;  5J4V A;  2PMT A;  2GQL A;  1J08 A;  5ENU A;  3R2Q A;  2O89 A;  3LWA A;  3UIW A;  3L0H A;  3ERW A;  2FY6 A;  2IN3 A;  3ZIJ A;  4KH7 A;  3M3M A;  1H75 A;  1WE0 A;  2LV3 A;  2L6D A;  5IO2 A;  4KCA A;  4ZIJ A;  2FWF A;  1K0C A;  2VD1 A;  3HKR A;  3NIV A;  5C04 A;  4OO4 A;  3TU3 B;  4MCU A;  4OCE A;  2N5B A;  2DLX A;  1I1I P;  2WS2 A;  2H72 A;  4EF0 A;  22GS A;  2JL4 A;  3EYT A;  1XCC A;  3IA1 A;  4PGT A;  2MBS A;  4ECB A;  4GQC A;  2VO4 A;  3QAV A;  4O7H A;  1TRS A;  4KDY A;  4MJE A;  2WW2 A;  1B48 A;  2WZS A;  2C80 A;  3I6A A;  4MH3 A;  1UA5 A;  3H8Q A;  4TXO B;  1GSF A;  1FO5 A;  2X8H A;  3F63 A;  5J4U A;  3ME7 A;  3FR9 A;  4Z2U A;  3CBU A;  4ZB8 A;  4MZC A;  1URM A;  5IMF A;  4MP4 A;  3GIX A;  5HFK A;  4XTS A;  2RUE A;  5DDL A;  1JLW A;  3FR3 A;  4NPB A;  3CSH A;  3PIN A;  1HNB A;  4HJ2 A;  2E2M A;  1GTU A;  3ED3 A;  3GUR A;  1THX A;  4GLT A;  4ACS A;  5ECR B;  3HYP A;  5G5F A;  2L4C A;  3JCM L;  4EIP A;  3VUR A;  17GS A;  2CZ2 A;  4ZBD A;  3VFI A;  4MJB A;  13GS A;  3FMW A;  4IBP A;  3KH9 A;  1X9W B;  2A2S A;  2O85 A;  3HJP A;  4CDO A;  4O5Q A;  1NHO A;  3C71 A;  1Z7R A;  3D5J A;  4A5P A;  2WVZ A;  1WWJ A;  2B6M A;  2GZZ A;  4GSN A;  3FHK A;  3RFR C;  3Q18 A;  2H1B A;  4TN8 A;  2HNL A;  1NSW A;  4IW9 A;  1AQW A;  3ZRE A;  4V2N A;  2P5Q A;  2RII A;  3P7X A;  2KP1 A;  2MMN A;  1SEN A;  6GSX A;  2HYX A;  3BD2 A;  2OT3 A;  5ECI B;  2LST A;  3HJO A;  2AJQ B;  4K7I A;  2LRN A;  4TR1 B;  3LEF A;  2P5R A;  2F51 A;  2CX4 A;  3IPZ A;  3RPN A;  3U5R E;  5DCG A;  2FWH A;  4X4J A;  1ERV A;  4MZB A;  5HQP A;  3EPT A;  1XW6 A;  1A8L A;  4E8E A;  4OO5 A;  1F2E A;  5JCU A;  1CQG A;  1X0R A;  3GMF A;  5IM9 A;  4Q5F A;  4ZL9 A;  3A2V A;  2EC4 A;  3DKS A;  2F8A A;  1XBS A;  4D73 A;  2H6X A;  4ML6 A;  3H93 A;  3P90 A;  2GZP A;  3Q19 A;  1XWA A;  3V1W A;  4RUV A;  2H71 A;  4YQM A;  4EL1 A;  4JRR A;  2IJY A;  4EDY A;  3KTL A;  4V1A g;  2A4V A;  3QAW A;  4HOJ A;  5DQY A;  1FHE A;  1U3A A;  18GS A;  4GQF A;  1OC8 A;  2LNT A;  4F9Z A;  4G10 A;  5AN1 A;  3F4T A;  4LA1 A;  1FW1 A;  4EDZ A;  1SD9 A;  1TRW A;  3UJ1 A;  2WFC A;  1K3L A;  4I2U A;  3ZVJ A;  2REM A;  4L0W A;  2YV7 A;  1GUL A;  4CHS A;  3TRQ A;  1B4P A;  1QK8 A;  1Q4J A;  2DJ1 A;  2X8G A;  3GN3 A;  1VF4 A;  5GST A;  1GTA A;  4G2E A;  1OKT A;  3FYG A;  3HXS A;  2HRA A;  2WZ9 A;  4OCF A;  3PR8 A;  1SD8 A;  4PI2 C;  4ILF A;  4YAV A;  3Q6O A;  3WGE A;  4G0K A;  3G7Y A;  1HYU A;  3DYR A;  2V2G A;  4X0X A;  3M8N A;  2PUK C;  3CSJ A;  3OR5 A;  4N0Z A;  4N3Z A;  4IP1 A;  5BRT A;  2UV8 G;  3ZTL A;  5ECK B;  3UOM A;  5F8B A;  1SK2 A;  2CZ3 A;  4TRX A;  4XS1 A;  4GSS A;  5G30 A;  1OAZ A;  3TUE A;  1A8Y A;  2L5O A;  1YF1 A;  1YY7 A;  2LRC A;  4J2F A;  4GTU A;  3UMA A;  4L8E A;  1EOG A;  4WKW A;  1MD3 A;  5ID2 B;  1HQO A;  3D21 A;  2H6Z A;  3WGD A;  1XW5 A;  2V6O A;  2HQT A;  2VM1 A;  3ME8 A;  4PQ1 A;  3MDK A;  5HFG A;  1F9M A;  1AQX A;  1ERT A;  5IIZ A;  3APQ A;  1KTE A;  3AY8 A;  3M9K A;  3F8U A;  1DBY A;  3CTG A;  1M3J A;  4AGS A;  5ECP B;  2CA8 A;  3DXB A;  2AB6 A;  2GDR A;  2LEG A;  1EWX A;  3UBL A;  2C3Q A;  2CT6 A;  2CX3 A;  2H1D A;  4DSQ A;  2IMI A;  1M2B A;  2YAN A;  4AJ6 A;  4POM A;  1K0A A;  4IQ1 A;  1XPV A;  4OFT A;  5CP1 A;  3HA9 A;  5IMV A;  1YVL A;  4WBR D;  2DC5 A;  3A2W A;  4RI7 A;  3GYK A;  3QDN A;  5CNW A;  4MAB A;  1TKD B;  5KOW A;  2YN1 A;  1CQH A;  3RHC A;  5G1L A;  1XFL A;  4BVX A;  4OFM A;  2I3Y A;  3C1R A;  4I97 A;  1JLV A;  4FQU A;  1BQ7 A;  3L9U A;  3DWV A;  4OMV A;  1XWC A;  1BED A;  5D9T A;  4ZBA A;  3HVX A;  2G0F A;  1DUG A;  2C4J A;  3RGB C;  3GHA A;  1WMJ A;  2B5E A;  2FUG 2;  1BG1 A;  4RQR A;  4YKG A;  3E9J B;  2ZCT A;  3IAM 2;  1T3B A;  1FB0 A;  2KLX A;  4MK3 A;  4NMU A;  6GST A;  2GQK A;  4DSS B;  2WGR A;  4ZB9 A;  1ERU A;  7GSS A;  1AXD A;  3H4K A;  1NHY A;  5J4Y A;  2LUS A;  5LCZ A;  3GKK A;  3UAP A;  3GTU B;  2FD3 A;  1LU4 A;  3HD5 A;  5FWG A;  2H70 A;  3PH9 A;  1ZYQ B;  2X4A A;  1SKW B;  2OBK A;  5GAN D;  3LYP A;  2IWT A;  3O6T A;  4LL1 B;  2CV4 A;  5A34 A;  3F6D A;  2YP6 A;  4DEJ A;  1OC3 A;  4GXZ A;  6GSY A;  1AIU A;  1AUC A;  1SJ6 A;  5H5Q A;  3ERG A;  2OAC A;  5JWQ B;  1G6W A;  4O32 A;  3TKR A;  2RLI A;  2OKA A;  2JZR A;  2YV9 A;  1F6M C;  4MPF A;  3CMI A;  4K5R A;  5IMA A;  4PNF A;  1WJK A;  5CRE A;  4WEY A;  2H73 A;  2B1K A;  3ZML A;  6GSV A;  2YZU A;  2B5X A;  2FLS A;  4ID0 A;  1THO A;  2YWN A;  1K0O A;  2GZY A;  14GS A;  4I6X A;  4P3Y B;  1YZX A;  3TJJ A;  3LQ7 A;  3G7I A;  2HXK A;  2CQ9 A;  1PX6 A;  4KUN A;  3NOF A;  1GRX A;  3VPQ A;  2GSR A;  2NVL A;  2B1L A;  2A4H A;  4G01 A;  5C00 A;  4EXJ A;  4W66 A;  3VWU A;  4AJ7 A;  2JAD A;  1X5D A;  2L59 A;  4O92 A;  2LRT A;  2X64 A;  4IS0 A;  3GKX A;  4HEA 2;  2DJ0 A;  1YKC A;  1TRU A;  2H30 A;  1DSB A;  4USS A;  2WCI A;  1ML6 A;  3FKF A;  2UZ8 A;  2B3S A;  1A0R P;  2ALB A;  1HNC A;  5G1K A;  4KW6 A;  2ZNM A;  3J7Y k;  3VK9 A;  2TIR A;  4OFN A;  1Y25 A;  2O36 A;  5IMC A;  5D73 A;  5EY6 A;  4FH8 A;  5D8I A;  2PGT A;  2BMX A;  3M0F A;  4EE0 A;  3F9U A;  3IDV A;  3TRP A;  4DSR A;  2C3N A;  5A5H A;  2WW0 A;  4POK A;  1V40 A;  2HZF A;  1QQ2 A;  1FVK A;  3GKN A;  2CVB A;  3CYN A;  2GT6 A;  1RQM A;  3L9S A;  2AHE A;  2R2J A;  3ZYW A;  1BYE A;  4NXI A;  1MDI A;  4HZ4 A;  3F3Q A;  1M0U A;  4KCE A;  4G0I A;  2K18 A;  2H66 A;  4K7N A;  5IOW A;  3IE3 A;  3CXG A;  4K9Z A;  2RUF A;  1ZYP A;  4Q5Q A;  3KMN A;  2C0E A;  4MDC A;  1T8E B;  2R3X A;  5A1N A;  2C1Y A;  5ECM B;  3LW9 A;  2WB9 A;  4XCS A;  3M9J A;  1Y1U A;  4PX1 A;  3DRN A;  2O3E A;  3C7M A;  5CYY A;  2H1A A;  3UL3 A;  2HRF A;  1NM3 A;  2GSQ A;  3DML A;  4JZQ A;  3FZA A;  4PHZ C;  4O5U A;  5KEJ A;  2HRN A;  1F3B A;  3ZMK A;  4K0N A;  4XS6 A;  4ECJ A;  2QA2 A;  3HVV A;  4ZBB A;  1LJR A;  4KX4 A;  2DJK A;  3IAS 2;  4FYC A;  3EIN A;  4PUA A;  4NV2 A;  1EEM A;  1F3A A;  3D4M A;  1Q98 A;  1XZO A;  5J41 A;  2V32 A;  4N10 A;  3RDW A;  3GSS A;  1Y6E A;  5GAP D;  5FT3 A;  4DVC A;  5IPG A;  2J9H A;  2VAF A;  3TKP A;  3A5I A;  2KOK A;  4AKX B;  3ZFL A;  4BVY B;  2O87 A;  2JZS A;  5D96 A;  1EEJ A;  2LKU A;  3KJY A;  4XS4 A;  3TJF A;  1OKD A;  1SU9 A;  2WVX B;  5D9V A;  3LXT A;  3F3R A;  3L9V A;  2HE3 A;  5ELG A;  2L57 A;  4JED A;  5COH A;  2CVD A;  3HHV A;  3EMX A;  1SJI A;  3DGQ A; 
#chains in the Genus database with same CATH homology
 5ECO B;  5INY A;  5B8A A;  5G31 A;  1K3Y A;  2DJ3 A;  1ST9 A;  3EU4 A;  1V9W A;  3C8E A;  2PVQ A;  5JCW A;  2H76 A;  5CRH A;  1M99 A;  2HSY A;  4X43 A;  1T00 A;  2OA7 A;  4TR3 A;  4BWS A;  3KTB A;  4HU7 A;  4ECI A;  3APS A;  5DJM A;  2DMM A;  5EPF A;  2IFQ B;  4L5L A;  3QCP A;  1GLP A;  2AUV A;  4GCI A;  1VGL A;  3LXZ A;  3ZLP A;  3FR6 A;  3MWH A;  1N2A A;  3IXR A;  2I4A A;  3ZIV A;  2HSN A;  4TKY A;  2FWG A;  1UN2 A;  2YNX A;  3RPP A;  2QKE A;  4MA9 A;  3DEX A;  1K0M A;  4RI6 A;  1SYR A;  3KZQ A;  4TXV A;  5DAK B;  2C0D A;  2QC7 A;  3GST A;  1AQV A;  4ZB7 A;  2JU5 A;  3GFK A;  5ECN B;  5J47 A;  3LYK A;  2WRT A;  5A4V A;  3TDG A;  4ZL7 A;  1G0T A;  1Z9H A;  2VLU A;  5J40 A;  3UBK A;  2LNS A;  1ILO A;  2R4V A;  4FYB A;  2GTU A;  3D4T A;  5DVB A;  1V2A A;  3APO A;  2E2G A;  4MLY A;  1SK1 A;  4YH2 A;  2PPT A;  4G0L A;  3KM6 A;  5CRD A;  1XIY A;  1SJZ A;  4ICY A;  2C3T A;  4N0V A;  1YKA A;  6GSW A;  4F0C A;  1XWG A;  1UVZ A;  1S3A A;  2R6K A;  2DIY A;  2HZE A;  4ZB6 A;  1GSY A;  5J9C A;  1TU8 A;  1TTZ A;  1GSE A;  4F0B A;  5JWR B;  1GL8 A;  3GX8 A;  2ZUP A;  2DJ2 A;  5B8B A;  3BCK A;  5IO0 A;  2HRK A;  5DBQ A;  4YAP A;  4JU5 A;  5KN3 A;  5IPH A;  4K2X A;  5A5K A;  4KSM A;  2JSY A;  1USB A;  1WRY A;  1PL2 A;  1TDI A;  2VL2 C;  5KN0 A;  1JZR A;  1WIK A;  1T4Z A;  4YKF A;  1O8X A;  4XIH A;  4K2D A;  3QFA C;  4PUF C;  1Z7P A;  1H4O A;  4ZXG A;  4IJI A;  2LQQ A;  3MIX A;  1R4W A;  2VIM A;  5H5S A;  2H0I A;  4GRF A;  2GQM A;  4IGJ A;  2OE3 A;  4MJC A;  3W8J A;  2GST A;  3A5W A;  5G2Z A;  1U88 A;  5E4W A;  1PKW A;  5F07 A;  1W89 A;  4IN0 A;  2NTO A;  1GSQ A;  1A23 A;  4PNG A;  5FHI A;  3PGT A;  4KF9 A;  5ELA A;  5ECL B;  1KEB A;  2EIQ A;  2VCT A;  2K8S A;  4QL9 A;  2MMZ A;  1XOA A;  1SVL A;  3VWV A;  1PMT A;  3W6G A;  3N5O A;  3GKM A;  5GSS A;  1TXU A;  1GTI A;  2FHE A;  5HFI A;  1T1V A;  2H0G A;  4J57 E;  1E6B A;  1U6T A;  2B5Y A;  4K5S A;  3DD3 A;  3IC8 A;  3GRX A;  2I1U A;  5LD0 A;  4HQZ A;  1RK4 A;  4I8B A;  1V57 A;  1ZZY A;  3ZIT A;  3QD9 A;  1OC9 A;  3QOU A;  4TR0 A;  1B9X C;  1T4Y A;  2OE1 A;  4BL7 A;  4PQH A;  4AKI A;  3HVS A;  3SBC A;  6GSS A;  1GP1 A;  2MYG A;  1GNE A;  3U6V A;  2X99 A;  4JBB A;  3QMX A;  1SK0 A;  5G5E A;  2L6C A;  3FRC A;  4QMK A;  2R0C A;  1IYH A;  4I5Q A;  1ZOF A;  2VCQ A;  4XRD A;  1YJ6 A;  2OBI A;  2VCZ A;  3IR4 A;  2XBI A;  4O5R A;  2EIR A;  1SKR B;  1EOH A;  5D93 A;  5B6N A;  2TRC P;  16GS A;  5DJL A;  3IV4 A;  4Z2T A;  5A4U A;  1X9S B;  4LL4 B;  3ZZX A;  3A3T A;  1QMV A;  3EU3 A;  4WXT A;  2VOC A;  4KND A;  1IYI A;  1EP7 A;  4KGI A;  5ECS A;  1AC1 A;  1GWC A;  1OYJ A;  4QQ7 A;  1PSQ A;  4FYU A;  3D22 A;  2DML A;  1T7P B;  2LJA A;  3DIE A;  4HZ2 A;  3E0U A;  8GSS A;  20GS A;  4WF5 A;  2LQO A;  1JHB A;  5CRW A;  2V1M A;  1A24 A;  3MAK A;  1R5P A;  2JZT A;  5CRG A;  4GWR A;  4WET A;  2BJX A;  1GH2 A;  4BVX B;  3TJK A;  4X1U A;  2H8L A;  3GL5 A;  1DE1 A;  4KB3 A;  1NW2 A;  2B7J A;  2XPE A;  3G7J A;  4BWQ A;  2MZC A;  3GUS A;  1XOB A;  1G6Y A;  4F82 A;  3N9J A;  1MDJ A;  2FCH A;  3WGX A;  5DAL A;  4MF6 A;  2R0P A;  1W4V A;  2KP2 A;  1I9D A;  2DKI A;  1GNW A;  1HNA A;  2B7K A;  1PGT A;  1PX7 A;  2C8U A;  2EFC A;  2IPA A;  4ULX A;  3TJG A;  4CY6 A;  1A2L A;  1R7H A;  1O81 A;  5GZZ B;  1AW9 A;  2YJ7 A;  4J56 E;  3EWL A;  4PTS A;  3TKS E;  3TCO A;  1J9B A;  3GNJ A;  3HJM A;  4AI6 A;  2QSI A;  5HR3 A;  2N5F A;  4EC0 A;  3TOT A;  3QR6 A;  3FW2 A;  3BJ5 A;  1ZYE A;  5F06 A;  4AKG A;  5A34 B;  2EFD A;  2VD0 A;  5JWO B;  2OE0 A;  3EE2 A;  4EKZ A;  4MH2 A;  1FOH A;  1TK8 B;  2EFE A;  1JZD A;  5CAX A;  2X49 A;  5IQY A;  4K0G A;  1ZGN A;  2PER A;  3FZ4 A;  4OWY A;  1B9Y C;  2R37 A;  4TXO A;  1ERW A;  2GLR A;  1BJX A;  3IRA A;  3F0I A;  3VPT A;  2VLT A;  3VWX A;  2H0H A;  3EMP A;  1KNG A;  3ZL5 A;  2NBS A;  2YCD A;  2VM2 A;  3MYD A;  1YF0 A;  5AIV A;  2J23 A;  1S3C A;  3WD6 A;  4QL7 A;  5AIX A;  3WYW A;  3HY2 A;  2IME A;  2F9S A;  4IVF A;  2F3M A;  2HSH A;  3TKS A;  2MMA A;  3GA4 A;  1O7U A;  3ZFB A;  2HSM B;  4XHM A;  2O7K A;  4KSO A;  1M2D A;  5E59 A;  3IHQ A;  2V6K A;  2VL3 A;  3GH9 A;  2L4Q A;  2JAC A;  1QUW A;  3UAR A;  4LMW A;  2E0Q A;  2FA8 A;  2LJK A;  4AF2 A;  2YZH A;  2H75 A;  4ZL8 A;  1FB6 A;  3IBH A;  1LBK A;  1TP9 A;  2GS3 A;  2EFH A;  4AJ8 A;  1OE8 A;  1SL0 B;  1OE7 A;  5BMU B;  1ON4 A;  1QFN A;  1OVN A;  2IIY A;  3EC3 A;  1Z6M A;  1VF1 A;  1VF3 A;  2DJJ A;  4TR1 A;  3IHG A;  2ES7 A;  4MPG A;  2H74 A;  2PBJ A;  1F37 A;  5A5H B;  3W8S A;  5AIS A;  1GUH A;  4CW9 A;  5B7C A;  1TJD A;  2IFQ A;  1BF5 A;  1K0N A;  1M2A A;  3LSZ A;  2DKH A;  2IMF A;  1PA3 A;  1Z3E A;  3KP8 A;  2R0G A;  3GX0 A;  12GS A;  2GSS A;  4NHW A;  2G2Q A;  2GGT A;  3R3E A;  3BOA A;  3H1N A;  3US3 A;  1BG5 A;  3RHB A;  5ECQ B;  2FGX A;  4RQX A;  5KN2 A;  2FNO A;  5JCG A;  1SL2 B;  1O85 A;  5DAK A;  4KAE A;  3LFL A;  4E68 A;  1TU7 A;  1M9B A;  2YWO A;  3CSI A;  3G9B A;  3P8W A;  5A1N B;  1BX9 A;  2O5V A;  2AYT A;  2FA4 A;  4WR4 A;  4KE3 A;  2IL3 A;  1WP0 A;  3ISO A;  2R5G A;  2HI7 A;  1GTB A;  4IJ3 A;  1MDK A;  4POB A;  4WR5 A;  2F8F A;  6GSU A;  4POL A;  4NHZ A;  2LJR A;  2BTO T;  1ZYN A;  2V41 A;  2C0G A;  3TB2 A;  9GSS A;  2IMD A;  1TOF A;  5LNK e;  2XPD A;  1GSU A;  3TGZ A;  1M9A A;  5H5R A;  3D6I A;  1EV9 A;  1SYX A;  3I69 A;  3BBY A;  3KIJ A;  4GST A;  2HFD A;  2KUC A;  2YJH A;  4K8M A;  3HZ8 A;  4MF5 A;  3DVX A;  2WUL A;  2DBC A;  5HR2 A;  3HDC A;  1XVW A;  4MMM A;  4TVE A;  1GLQ A;  3MNG A;  4JR6 A;  2DSA A;  2TRX A;  2MMO A;  5KOX A;  1X5E A;  1R26 A;  1TW9 A;  3I43 A;  4XS4 B;  1FG4 A;  5ID2 A;  1X9M B;  2GT5 A;  1JFU A;  5IMD A;  3QFB C;  5L71 A;  4ML1 A;  4HQS A;  2NPB A;  3MSZ A;  4N11 A;  1E2Y A;  1WPI A;  3F4R A;  3CTF A;  10GS A;  3VI5 A;  3KP9 A;  4ECC A;  1GSS A;  5HR0 A;  1C72 A;  2H19 A;  1PQN A;  4AKH A;  2K8V A;  4GDF A;  3H79 A;  4Q5R A;  1PN9 A;  4F03 A;  3LOR A;  5CO3 A;  2VCX A;  2ON5 A;  2XBQ A;  1K0D A;  1G7O A;  2O8V B;  2OAD A;  1XVQ A;  2CAI A;  2WJU A;  2QGV A;  4JR4 A;  3EUR A;  4TR4 A;  1N25 A;  4HI7 A;  2HT9 A;  2CVK A;  4EIQ A;  3PPU A;  2XHF A;  2VCW A;  2H1G A;  1V58 A;  4N30 A;  2H01 A;  5J5N A;  4D73 B;  2K6V A;  1VF2 A;  1RW1 A;  5D9X A;  2A2P A;  4Z2R A;  3KXO A;  1AAZ A;  2HSN B;  4GF0 A;  2RM6 A;  1Z5Y E;  3KD0 A;  4EVM A;  2L5L A;  3ERF A;  3SWL A;  3GL3 A;  2VKZ G;  1ZCP A;  1MEK A;  1PN0 A;  3E3E A;  4HU9 A;  4OD7 A;  2MBT A;  1TK5 B;  2P0G A;  3WT1 A;  3J7Y b;  2AAW A;  4ZIL A;  4G19 A;  19GS A;  4IHU A;  1Z6N A;  4DSS A;  4FIW A;  4TW5 A;  4IP6 A;  3Q74 A;  5EVO A;  1XXU A;  1YEP A;  3IK7 A;  3KEB A;  3GTU A;  1U87 A;  3RBT A;  1SKS B;  4HJM A;  3TKS C;  1FAA A;  1MD4 A;  4YQV A;  5A4W A;  4HUA A;  4G9H A;  1BAY A;  2JSZ A;  1TXX A;  4CY8 A;  3BCI A;  3A2X A;  2XC2 A;  4KA0 A;  3UVH A;  1B8X A;  5F05 A;  4KDX A;  4K6X A;  3HZ4 A;  2H1L A;  2HZE B;  4ISD A;  3ZRD A;  4PQI A;  1FVJ A;  3UVT A;  1O8W A;  2IMK A;  5J3R A;  2HRK B;  2YWI A;  3O3T A;  1A0F A;  1ZMA A;  5EL8 A;  4V2M A;  4Z7X A;  5D9W A;  1A2J A;  4L0U A;  2M80 A;  4IEL A;  2VCV A;  2EIO A;  1S3D A;  4KDU A;  2FWE A;  1VRS D;  4HDE A;  2I81 A;  3TKQ A;  1YEX A;  3FEU A;  5HR1 A;  2VL9 A;  2N5A A;  4EUY A;  1MTC A;  5IMZ A;  3P2A A;  4K7O A;  1J0F A;  4NWY A;  4PUR A;  3F6F A;  4WBJ A;  1O6J A;  1QGV A;  3IC4 A;  1SVO A;  2AV4 A;  3VWW A;  1K3O A;  4JE1 A;  3WT2 A;  4LMV A;  4H86 A;  2K9F A;  1K0B A;  3L78 A;  3KGK A;  2P31 A;  1JZW A;  3HMJ G;  5ABR A;  3CWG A;  1GSD A;  1FOV A;  4MNN A;  1UC7 A;  4PXO A;  1GUM A;  2VLV A;  1EZK A;  3L4N A;  3TJB A;  4E8H A;  1XWB A;  3FZ9 A;  2PWJ A;  1M7T A;  5B6M A;  4EO3 A;  1X5C A;  3I9V 2;  5DCH A;  1EP8 A;  3KMO A;  3C73 A;  1YQ1 A;  4NV5 A;  1U3I A;  4L5O A;  2KHP A;  4XRA A;  1ACV A;  3DVW A;  1ZL9 A;  2M46 A;  4BA7 A;  1EGO A;  3CRT A;  3QAG A;  2VUP A;  1PL1 A;  3GH6 A;  4MF7 A;  4HS1 A;  5ECH B;  3FZ5 A;  3GV1 A;  1OC9 B;  3TOU A;  4I2T A;  2YPM A;  2A2R A;  5DQS A;  4BL7 B;  4K1F A;  2H6Y A;  1R5A A;  3O76 A;  4F2I A;  1PKZ A;  3S9F A;  1TI1 A;  2GVP A;  2PVO C;  1V98 A;  2LS5 A;  3KH7 A;  3FK8 A;  1HD2 A;  3IK9 A;  1YDK A;  3CRU A;  5J9B A;  3VLN A;  3EVI A;  1SVM A;  1O73 A;  1GUK A;  1WOU A;  2X8C A;  1SL1 B;  2HSM A;  4NAX A;  1JZO A;  2LTK A;  4MZW A;  1PD2 1;  3VI7 A;  1QXH A;  1I5G A;  3IOS A;  3KCM A;  2C0F A;  3FY7 A;  1N8J A;  4WF4 A;  3D0Z A;  1TI3 A;  3TRX A;  4V1A p;  3M1G A;  2WDU A;  1DE2 A;  2D2Z A;  2YWM A;  3LG6 A;  3K8N A;  2HLS A;  1XWK A;  3QPM A;  2M72 A;  4LLR A;  2YOI A;  4MJA A;  5AGY A;  2OJL A;  4IQA A;  4V2L A;  5F0G A;  1A2M A;  1G7E A;  11GS A;  4YQU A;  2I9H A;  3F4S A;  2E7P A;  5BMU A;  2Z9S A;  3NZN A;  1EV4 A;  4IKH A;  1EGR A;  2RM5 A;  2VL2 A;  1PRX A;  2ON7 A;  4Q5N A;  2DIZ A;  3LJR A;  4FO5 A;  1KBN A;  3UEM A;  1TK0 B;  3ZVJ D;  1B4Q A;  5KN1 A;  2PU9 C;  4TOP A;  2PN8 A;  5DAL B;  5IOX A;  1ABA A;  1TRV A;  2QA1 A;  3HCZ A;  2NDO A;  2CAQ A;  3C1S A;  3LGC A;  3RAZ A;  1XW9 A;  4BPY A;  4BVY A;  5J4V A;  2PMT A;  2GQL A;  1J08 A;  5ENU A;  3R2Q A;  2O89 A;  3LWA A;  3UIW A;  3L0H A;  3ERW A;  2FY6 A;  2IN3 A;  3ZIJ A;  4KH7 A;  3M3M A;  1H75 A;  1WE0 A;  2LV3 A;  2L6D A;  5IO2 A;  4KCA A;  4ZIJ A;  2FWF A;  1K0C A;  2VD1 A;  3HKR A;  3NIV A;  5C04 A;  4OO4 A;  3TU3 B;  4MCU A;  4OCE A;  2N5B A;  2DLX A;  2WS2 A;  2H72 A;  4EF0 A;  22GS A;  2JL4 A;  3EYT A;  1XCC A;  3IA1 A;  4PGT A;  2MBS A;  4ECB A;  4GQC A;  2VO4 A;  3QAV A;  4O7H A;  1TRS A;  4KDY A;  4MJE A;  1B48 A;  2C80 A;  3I6A A;  4MH3 A;  1UA5 A;  3H8Q A;  4TXO B;  1GSF A;  1FO5 A;  2X8H A;  3F63 A;  5J4U A;  3ME7 A;  3FR9 A;  4Z2U A;  3CBU A;  4ZB8 A;  4MZC A;  1URM A;  5IMF A;  4MP4 A;  3GIX A;  5HFK A;  4XTS A;  2RUE A;  5DDL A;  1JLW A;  3FR3 A;  4NPB A;  3CSH A;  3PIN A;  1HNB A;  4HJ2 A;  2E2M A;  1GTU A;  3ED3 A;  3GUR A;  1THX A;  4GLT A;  4ACS A;  5ECR B;  3HYP A;  5G5F A;  2L4C A;  3JCM L;  4EIP A;  3VUR A;  17GS A;  2CZ2 A;  4ZBD A;  3VFI A;  4MJB A;  13GS A;  3FMW A;  4IBP A;  3KH9 A;  1X9W B;  2A2S A;  2O85 A;  3HJP A;  4CDO A;  4O5Q A;  1NHO A;  3C71 A;  1Z7R A;  3D5J A;  4A5P A;  1WWJ A;  2B6M A;  2GZZ A;  4GSN A;  3FHK A;  3Q18 A;  2H1B A;  4TN8 A;  2HNL A;  1NSW A;  4IW9 A;  1AQW A;  3ZRE A;  4V2N A;  2P5Q A;  2RII A;  3P7X A;  2KP1 A;  2MMN A;  1SEN A;  6GSX A;  2HYX A;  3BD2 A;  2OT3 A;  5ECI B;  2LST A;  3HJO A;  2AJQ B;  4K7I A;  2LRN A;  4TR1 B;  3LEF A;  2P5R A;  2F51 A;  2CX4 A;  3IPZ A;  3RPN A;  3U5R E;  5DCG A;  2FWH A;  4X4J A;  1ERV A;  4MZB A;  5HQP A;  3EPT A;  1XW6 A;  1A8L A;  4E8E A;  4OO5 A;  1F2E A;  5JCU A;  1CQG A;  1X0R A;  3GMF A;  5IM9 A;  4Q5F A;  4ZL9 A;  3A2V A;  2EC4 A;  3DKS A;  2F8A A;  1XBS A;  4D73 A;  2H6X A;  4ML6 A;  3H93 A;  3P90 A;  2GZP A;  3Q19 A;  1XWA A;  3V1W A;  4RUV A;  2H71 A;  4YQM A;  4EL1 A;  4JRR A;  2IJY A;  4EDY A;  3KTL A;  4V1A g;  2A4V A;  3QAW A;  4HOJ A;  5DQY A;  1FHE A;  1U3A A;  18GS A;  4GQF A;  1OC8 A;  2LNT A;  4F9Z A;  4G10 A;  5AN1 A;  3F4T A;  4LA1 A;  1FW1 A;  4EDZ A;  1SD9 A;  1TRW A;  3UJ1 A;  2WFC A;  1K3L A;  4I2U A;  3ZVJ A;  2REM A;  4L0W A;  2YV7 A;  1GUL A;  4CHS A;  3TRQ A;  1B4P A;  1QK8 A;  1Q4J A;  2DJ1 A;  2X8G A;  3GN3 A;  1VF4 A;  5GST A;  1GTA A;  4G2E A;  1OKT A;  3FYG A;  3HXS A;  2HRA A;  2WZ9 A;  4OCF A;  3PR8 A;  1SD8 A;  4ILF A;  4YAV A;  3Q6O A;  3WGE A;  4G0K A;  3G7Y A;  1HYU A;  3DYR A;  2V2G A;  4X0X A;  3M8N A;  2PUK C;  3CSJ A;  3OR5 A;  4N0Z A;  4N3Z A;  4IP1 A;  5BRT A;  2UV8 G;  3ZTL A;  5ECK B;  3UOM A;  5F8B A;  1SK2 A;  2CZ3 A;  4TRX A;  4XS1 A;  4GSS A;  5G30 A;  1OAZ A;  3TUE A;  1A8Y A;  2L5O A;  1YF1 A;  1YY7 A;  2LRC A;  4J2F A;  4GTU A;  3UMA A;  4L8E A;  1EOG A;  4WKW A;  1MD3 A;  5ID2 B;  1HQO A;  3D21 A;  2H6Z A;  3WGD A;  1XW5 A;  2V6O A;  2HQT A;  2VM1 A;  3ME8 A;  4PQ1 A;  3MDK A;  5HFG A;  1F9M A;  1AQX A;  1ERT A;  5IIZ A;  3APQ A;  1KTE A;  3AY8 A;  3M9K A;  3F8U A;  1DBY A;  3CTG A;  4AGS A;  5ECP B;  2CA8 A;  3DXB A;  2AB6 A;  2GDR A;  2LEG A;  1EWX A;  3UBL A;  2C3Q A;  2CT6 A;  2CX3 A;  2H1D A;  4DSQ A;  2IMI A;  1M2B A;  2YAN A;  4AJ6 A;  4POM A;  1K0A A;  4IQ1 A;  1XPV A;  4OFT A;  5CP1 A;  3HA9 A;  5IMV A;  1YVL A;  4WBR D;  2DC5 A;  3A2W A;  4RI7 A;  3GYK A;  3QDN A;  5CNW A;  4MAB A;  1TKD B;  5KOW A;  2YN1 A;  1CQH A;  3RHC A;  5G1L A;  1XFL A;  4BVX A;  4OFM A;  2I3Y A;  3C1R A;  4I97 A;  1JLV A;  4FQU A;  1BQ7 A;  3L9U A;  3DWV A;  4OMV A;  1XWC A;  1BED A;  5D9T A;  4ZBA A;  3HVX A;  2G0F A;  1DUG A;  2C4J A;  3GHA A;  1WMJ A;  2B5E A;  2FUG 2;  1BG1 A;  4RQR A;  4YKG A;  3E9J B;  2ZCT A;  3IAM 2;  1T3B A;  1FB0 A;  2KLX A;  4MK3 A;  4NMU A;  6GST A;  2GQK A;  4DSS B;  2WGR A;  4ZB9 A;  1ERU A;  7GSS A;  1AXD A;  3H4K A;  1NHY A;  5J4Y A;  2LUS A;  5LCZ A;  3GKK A;  3UAP A;  3GTU B;  2FD3 A;  1LU4 A;  3HD5 A;  5FWG A;  2H70 A;  3PH9 A;  1ZYQ B;  2X4A A;  1SKW B;  2OBK A;  5GAN D;  3LYP A;  2IWT A;  3O6T A;  4LL1 B;  2CV4 A;  5A34 A;  3F6D A;  2YP6 A;  4DEJ A;  1OC3 A;  4GXZ A;  6GSY A;  1AIU A;  1AUC A;  1SJ6 A;  5H5Q A;  3ERG A;  2OAC A;  5JWQ B;  1G6W A;  4O32 A;  3TKR A;  2RLI A;  2OKA A;  2JZR A;  2YV9 A;  1F6M C;  4MPF A;  3CMI A;  4K5R A;  5IMA A;  4PNF A;  1WJK A;  5CRE A;  4WEY A;  2H73 A;  2B1K A;  3ZML A;  6GSV A;  2YZU A;  2B5X A;  2FLS A;  4ID0 A;  1THO A;  2YWN A;  1K0O A;  2GZY A;  14GS A;  4I6X A;  4P3Y B;  1YZX A;  3TJJ A;  3LQ7 A;  3G7I A;  2HXK A;  2CQ9 A;  1PX6 A;  4KUN A;  3NOF A;  1GRX A;  3VPQ A;  2GSR A;  2NVL A;  2B1L A;  2A4H A;  4G01 A;  5C00 A;  4EXJ A;  4W66 A;  3VWU A;  4AJ7 A;  2JAD A;  1X5D A;  2L59 A;  4O92 A;  2LRT A;  2X64 A;  4IS0 A;  3GKX A;  4HEA 2;  2DJ0 A;  1YKC A;  1TRU A;  2H30 A;  1DSB A;  4USS A;  2WCI A;  1ML6 A;  3FKF A;  2UZ8 A;  2B3S A;  1A0R P;  2ALB A;  1HNC A;  5G1K A;  4KW6 A;  2ZNM A;  3J7Y k;  3VK9 A;  2TIR A;  4OFN A;  1Y25 A;  5IMC A;  5D73 A;  5EY6 A;  4FH8 A;  5D8I A;  2PGT A;  2BMX A;  3M0F A;  4EE0 A;  3F9U A;  3IDV A;  3TRP A;  4DSR A;  2C3N A;  5A5H A;  4POK A;  1V40 A;  2HZF A;  1QQ2 A;  1FVK A;  3GKN A;  2CVB A;  3CYN A;  2GT6 A;  1RQM A;  3L9S A;  2AHE A;  2R2J A;  3ZYW A;  1BYE A;  4NXI A;  1MDI A;  4HZ4 A;  3F3Q A;  1M0U A;  4KCE A;  4G0I A;  2K18 A;  2H66 A;  4K7N A;  5IOW A;  3IE3 A;  3CXG A;  4K9Z A;  2RUF A;  1ZYP A;  4Q5Q A;  3KMN A;  2C0E A;  4MDC A;  1T8E B;  2R3X A;  5A1N A;  2C1Y A;  5ECM B;  3LW9 A;  2WB9 A;  4XCS A;  3M9J A;  1Y1U A;  4PX1 A;  3DRN A;  3C7M A;  5CYY A;  2H1A A;  3UL3 A;  2HRF A;  1NM3 A;  2GSQ A;  3DML A;  4JZQ A;  3FZA A;  4O5U A;  5KEJ A;  2HRN A;  1F3B A;  3ZMK A;  4K0N A;  4XS6 A;  4ECJ A;  2QA2 A;  3HVV A;  4ZBB A;  1LJR A;  4KX4 A;  2DJK A;  3IAS 2;  4FYC A;  3EIN A;  4PUA A;  4NV2 A;  1EEM A;  1F3A A;  3D4M A;  1Q98 A;  1XZO A;  5J41 A;  2V32 A;  4N10 A;  3RDW A;  3GSS A;  1Y6E A;  5GAP D;  5FT3 A;  4DVC A;  5IPG A;  2J9H A;  2VAF A;  3TKP A;  3A5I A;  2KOK A;  4AKX B;  3ZFL A;  4BVY B;  2O87 A;  2JZS A;  5D96 A;  1EEJ A;  2LKU A;  3KJY A;  4XS4 A;  3TJF A;  1OKD A;  1SU9 A;  5D9V A;  3LXT A;  3F3R A;  3L9V A;  2HE3 A;  5ELG A;  2L57 A;  4JED A;  5COH A;  2CVD A;  3HHV A;  3EMX A;  1SJI A;  3DGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...