2GT2A

Structure of the e. coli gdp-mannose mannosyl hydrolase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
158
structure length
151
Chain Sequence
FLRQEDFATVVRSTPLVSLDFIVENSRGEFLLGKRTNRPAQGYWFVPGGRVQKDETLEAAFERLTMAELGLRLPITAGQFYGVWQHFYDDNFSGTDFTTHYVVLGFRFRVSEEELLDYRWLTSDALLASDNVHANSRAYFLAEKRTGVPGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-mannose mannosyl hydrolase
publication title X-ray, NMR, and mutational studies of the catalytic cycle of the GDP-mannose mannosyl hydrolase reaction.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 41
structure length 151
sequence length 158
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.-:
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2gt2A00
3MDGA 3AC9A 3E57A 4S2YA 5FSLA 3SMDA 3X0PA 1Q27A 4HVYA 1PUSA 1Q33A 1V8VA 1VIQA 5ANTA 4S2WA 2GT4A 1RYAA 5DEQA 1MP2A 1G0SA 2FKBA 1X83A 3FCMA 3MCFA 3FSPA 1NQZA 2DSCA 2GT2A 5FSOA 3RH7A 4S2XA 3Q2TA 2B2KA 2I8UA 5ANWA 2XSQA 5BONA 1SZ3A 3FK9A 1XSBA 3X0NA 4C9WA 5DD4A 2R5WA 2VNQA 3GRNA 3KVHA 3EESA 3O52A 4JZTA 1VC9A 2I6KA 4MPOA 1K2EA 2O1CA 3F6AA 4ILQA 4NFWA 2YVMA 2PQVA 1V8WA 1U20A 5C7TA 2PNYA 1MR2A 2G73A 2KDWA 3Q93A 5ANUA 2YVPA 3U53A 3X0SA 3ZR0A 3COUA 3O8SA 1K26A 2A8PA 2VNPA 2GB5A 3X0OA 1PPWA 2QJTA 5CFJA 1RRSA 1NQYA 1XSCA 5HZXA 1V8NA 5ANSA 4V14A 4JZSA 3X0MA 2DSBA 3R03A 3HYQA 1V8SA 3GG6A 3A6SA 4HFQA 5CFIA 4ZG0A 2DSDA 3FFUA 3J7Ye 2I8TA 1G9QA 2A8RA 1OW2A 2B0VA 3X0QA 2RRKA 2AZWA 2DHOA 2J8QA 1HX3A 4NFXA 1VCDA 4YOQA 3GZ8A 1V8YA 1X51A 1V8LA 3EF5A 4N1TA 5IW4A 3Q2SA 2O5FA 4JZVA 2A6TA 2KDVA 2Q9PA 5ANVA 3MGMA 4S2VA 3X0LA 5IW5A 3N9UA 3OGAA 3SHDA 5DDGA 5ISYA 1F3YA 3BHOA 3I7UA 1KHZA 1XSAA 2A8SA 1TUMA 1MQEA 2FVVA 3EXQA 4IJXA 3HHJA 4KG3A 5FSNA 1HZTA 1PPVA 3H95A 5GHNA 5I8UA 5GHIA 4JZUA 3DKUA 1V8RA 1R67A 1NFZA 1V8UA 1PVFA 2A8TA 5GHMA 1KT9A 3SONA 3Q1PA 4N1UA 4DYWA 3FJYA 2O5WA 5GHPA 1JRKA 5GHJA 2JVBA 1SJYA 1Q54A 1MK1A 3GZ5A 3EEUA 3X0IA 5GHQA 1SOIA 4YPRA 3G0QA 1PUNA 2G74A 3GWYA 1VHGA 2YVNA 5FSIA 1VK6A 1V8TA 3ID9A 3Q91A 1GA7A 3I9XA 4KTBA 1MQWA 1X84A 2CL3A 3A6UA 3GZ6A 3P6YA 2B06A 3F13A 3P5TA 2FMLA 4KG4A 1VRLA 5DPKA 1PPXA 2YYHA 3QSJA 4ICKA 3Q4IA 5FSKA 5C7QA 5LPGA 3O61A 2QKMB 3MDIA 3ACAA 1JKNA 3I7VA 1V8IA 1VIUA 1VHZA 5BS6A 1QVJA 3WHWA 1IRYA 1PUQA 4K6EA 1VC8A 3A6TA 5FSMA 3CNGA 2ICJA 3O69A 3O6ZA 2A8QA 3X0KA 3A6VA 1KTGA 2QJOA 5GHOA 1I9AA 3ZR1A 3X0JA 4C9XA 3X0RA 2YVOA 4YPHA 3N77A 1RRQA 5C8LA 2DUKA 1NFSA 3L85A 1MUTA 2W4EA 1V8MA 3BAPA 4KYXA 1SU2A 3BM4A 3DUPA 2ICKA
chains in the Genus database with same CATH superfamily
3MDGA 3AC9A 3E57A 4S2YA 5FSLA 3SMDA 3X0PA 1Q27A 4HVYA 1PUSA 1Q33A 1V8VA 1VIQA 5ANTA 4S2WA 2GT4A 1RYAA 5DEQA 1MP2A 1G0SA 2FKBA 1X83A 3FCMA 3MCFA 3FSPA 1NQZA 2DSCA 2GT2A 5FSOA 3RH7A 4S2XA 3Q2TA 2B2KA 2I8UA 5ANWA 2XSQA 5BONA 1SZ3A 3FK9A 1XSBA 3X0NA 4C9WA 5DD4A 2R5WA 2VNQA 3GRNA 3KVHA 3EESA 3O52A 4JZTA 1VC9A 2I6KA 4MPOA 1K2EA 2O1CA 3F6AA 4ILQA 4NFWA 2YVMA 2PQVA 1V8WA 1U20A 5C7TA 2PNYA 1MR2A 2G73A 2KDWA 3Q93A 5ANUA 2YVPA 3U53A 3X0SA 3ZR0A 3COUA 3O8SA 1K26A 2A8PA 2VNPA 2GB5A 3X0OA 1PPWA 2QJTA 5CFJA 1RRSA 1NQYA 1XSCA 5HZXA 1V8NA 5ANSA 4V14A 4JZSA 3X0MA 2DSBA 3R03A 3HYQA 1V8SA 3GG6A 3A6SA 4HFQA 5CFIA 4ZG0A 2DSDA 2CZRA 3FFUA 3J7Ye 2I8TA 1G9QA 2A8RA 1OW2A 2B0VA 3X0QA 2RRKA 2AZWA 4J7HA 2DHOA 2J8QA 1HX3A 4NFXA 1VCDA 4YOQA 3GZ8A 1V8YA 1X51A 1V8LA 3EF5A 4N1TA 5IW4A 3Q2SA 2O5FA 4JZVA 2A6TA 2KDVA 2Q9PA 5ANVA 3MGMA 4S2VA 3X0LA 5IW5A 3N9UA 3OGAA 3SHDA 5DDGA 5ISYA 1F3YA 3BHOA 3I7UA 1KHZA 1XSAA 2A8SA 1TUMA 1MQEA 2FVVA 3EXQA 4IJXA 3HHJA 4KG3A 5FSNA 1HZTA 1PPVA 3H95A 5GHNA 5I8UA 5GHIA 4JZUA 3DKUA 1V8RA 1R67A 1NFZA 1V8UA 1PVFA 2A8TA 5GHMA 1KT9A 3SONA 3Q1PA 4N1UA 4DYWA 3FJYA 2O5WA 5GHPA 1JRKA 5GHJA 2JVBA 1SJYA 1Q54A 1MK1A 3GZ5A 3EEUA 3X0IA 5GHQA 1SOIA 4YPRA 3G0QA 1PUNA 2G74A 3GWYA 1VHGA 2YVNA 5FSIA 1VK6A 1V8TA 3ID9A 3Q91A 1GA7A 3I9XA 4KTBA 1MQWA 1X84A 2CL3A 3A6UA 3GZ6A 3P6YA 2B06A 3F13A 3P5TA 2FMLA 4KG4A 1VRLA 5DPKA 1PPXA 2YYHA 3QSJA 4ICKA 3Q4IA 5FSKA 5C7QA 5LPGA 3O61A 2QKMB 3MDIA 3ACAA 1JKNA 3I7VA 1V8IA 1VIUA 1VHZA 5BS6A 1QVJA 3WHWA 1IRYA 1PUQA 4K6EA 1VC8A 3A6TA 5FSMA 3CNGA 2ICJA 3O69A 3O6ZA 2A8QA 3X0KA 3A6VA 1KTGA 2QJOA 5GHOA 1I9AA 3ZR1A 3X0JA 4C9XA 3X0RA 2YVOA 4YPHA 3N77A 1RRQA 5C8LA 2DUKA 1NFSA 3L85A 1MUTA 4J7GA 2W4EA 1V8MA 3BAPA 4KYXA 1SU2A 3BM4A 3DUPA 2ICKA
chains in the Genus database with same CATH topology
3MDGA 3AC9A 3E57A 4S2YA 5FSLA 3SMDA 3X0PA 1Q27A 4HVYA 1PUSA 1Q33A 1V8VA 1VIQA 5ANTA 4S2WA 2GT4A 1RYAA 5DEQA 1MP2A 1G0SA 2FKBA 1X83A 3FCMA 3MCFA 3FSPA 1NQZA 2DSCA 2GT2A 5FSOA 3RH7A 4S2XA 3Q2TA 2B2KA 2I8UA 5ANWA 2XSQA 5BONA 1SZ3A 3FK9A 1XSBA 3X0NA 4C9WA 5DD4A 2R5WA 2VNQA 3GRNA 3KVHA 3EESA 3O52A 4JZTA 1VC9A 2I6KA 4MPOA 1K2EA 2O1CA 3F6AA 4ILQA 4NFWA 2YVMA 2PQVA 1V8WA 1U20A 5C7TA 2PNYA 1MR2A 2G73A 2KDWA 3Q93A 5ANUA 2YVPA 3U53A 3X0SA 3ZR0A 3COUA 3O8SA 1K26A 2A8PA 2VNPA 2GB5A 3X0OA 1PPWA 2QJTA 5CFJA 1RRSA 1NQYA 1XSCA 5HZXA 1V8NA 5ANSA 4V14A 4JZSA 3X0MA 2DSBA 3R03A 3HYQA 1V8SA 3GG6A 3A6SA 4HFQA 5CFIA 4ZG0A 2DSDA 2CZRA 3FFUA 3J7Ye 2I8TA 1G9QA 2A8RA 1OW2A 2B0VA 3X0QA 2RRKA 2AZWA 4J7HA 2DHOA 2J8QA 1HX3A 4NFXA 1VCDA 4YOQA 3GZ8A 1V8YA 1X51A 1V8LA 3EF5A 4N1TA 5IW4A 3Q2SA 2O5FA 4JZVA 2A6TA 2KDVA 2Q9PA 5ANVA 3MGMA 4S2VA 3X0LA 5IW5A 3N9UA 3OGAA 3SHDA 5DDGA 5ISYA 1F3YA 3BHOA 3I7UA 1KHZA 1XSAA 2A8SA 1TUMA 1MQEA 2FVVA 3EXQA 4IJXA 3HHJA 4KG3A 5FSNA 1HZTA 1PPVA 3H95A 5GHNA 5I8UA 5GHIA 4JZUA 3DKUA 1V8RA 1R67A 1NFZA 1V8UA 1PVFA 2A8TA 5GHMA 1KT9A 3SONA 3Q1PA 4N1UA 4DYWA 3FJYA 2O5WA 5GHPA 1JRKA 5GHJA 2JVBA 1SJYA 1Q54A 1MK1A 3GZ5A 3EEUA 3X0IA 5GHQA 1SOIA 4YPRA 3G0QA 1PUNA 2G74A 3GWYA 1VHGA 2YVNA 5FSIA 1VK6A 1V8TA 3ID9A 3Q91A 1GA7A 3I9XA 4KTBA 1MQWA 1X84A 2CL3A 3A6UA 3GZ6A 3P6YA 2B06A 3F13A 3P5TA 2FMLA 4KG4A 1VRLA 5DPKA 1PPXA 2YYHA 3QSJA 4ICKA 3Q4IA 5FSKA 5C7QA 5LPGA 3O61A 2QKMB 3MDIA 3ACAA 1JKNA 3I7VA 1V8IA 1VIUA 1VHZA 5BS6A 1QVJA 3WHWA 1IRYA 1PUQA 4K6EA 1VC8A 3A6TA 5FSMA 3CNGA 2ICJA 3O69A 3O6ZA 2A8QA 3X0KA 3A6VA 1KTGA 2QJOA 5GHOA 1I9AA 3ZR1A 3X0JA 4C9XA 3X0RA 2YVOA 4YPHA 3N77A 1RRQA 5C8LA 2DUKA 1NFSA 3L85A 1MUTA 4J7GA 2W4EA 1V8MA 3BAPA 4KYXA 1SU2A 3BM4A 3DUPA 2ICKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MDG A;  3AC9 A;  3E57 A;  4S2Y A;  5FSL A;  3SMD A;  3X0P A;  1Q27 A;  4HVY A;  1PUS A;  1Q33 A;  1V8V A;  1VIQ A;  5ANT A;  4S2W A;  2GT4 A;  1RYA A;  5DEQ A;  1MP2 A;  1G0S A;  2FKB A;  1X83 A;  3FCM A;  3MCF A;  3FSP A;  1NQZ A;  2DSC A;  2GT2 A;  5FSO A;  3RH7 A;  4S2X A;  3Q2T A;  2B2K A;  2I8U A;  5ANW A;  2XSQ A;  5BON A;  1SZ3 A;  3FK9 A;  1XSB A;  3X0N A;  4C9W A;  5DD4 A;  2R5W A;  2VNQ A;  3GRN A;  3KVH A;  3EES A;  3O52 A;  4JZT A;  1VC9 A;  2I6K A;  4MPO A;  1K2E A;  2O1C A;  3F6A A;  4ILQ A;  4NFW A;  2YVM A;  2PQV A;  1V8W A;  1U20 A;  5C7T A;  2PNY A;  1MR2 A;  2G73 A;  2KDW A;  3Q93 A;  5ANU A;  2YVP A;  3U53 A;  3X0S A;  3ZR0 A;  3COU A;  3O8S A;  1K26 A;  2A8P A;  2VNP A;  2GB5 A;  3X0O A;  1PPW A;  2QJT A;  5CFJ A;  1RRS A;  1NQY A;  1XSC A;  5HZX A;  1V8N A;  5ANS A;  4V14 A;  4JZS A;  3X0M A;  2DSB A;  3R03 A;  3HYQ A;  1V8S A;  3GG6 A;  3A6S A;  4HFQ A;  5CFI A;  4ZG0 A;  2DSD A;  3FFU A;  3J7Y e;  2I8T A;  1G9Q A;  2A8R A;  1OW2 A;  2B0V A;  3X0Q A;  2RRK A;  2AZW A;  2DHO A;  2J8Q A;  1HX3 A;  4NFX A;  1VCD A;  4YOQ A;  3GZ8 A;  1V8Y A;  1X51 A;  1V8L A;  3EF5 A;  4N1T A;  5IW4 A;  3Q2S A;  2O5F A;  4JZV A;  2A6T A;  2KDV A;  2Q9P A;  5ANV A;  3MGM A;  4S2V A;  3X0L A;  5IW5 A;  3N9U A;  3OGA A;  3SHD A;  5DDG A;  5ISY A;  1F3Y A;  3BHO A;  3I7U A;  1KHZ A;  1XSA A;  2A8S A;  1TUM A;  1MQE A;  2FVV A;  3EXQ A;  4IJX A;  3HHJ A;  4KG3 A;  5FSN A;  1HZT A;  1PPV A;  3H95 A;  5GHN A;  5I8U A;  5GHI A;  4JZU A;  3DKU A;  1V8R A;  1R67 A;  1NFZ A;  1V8U A;  1PVF A;  2A8T A;  5GHM A;  1KT9 A;  3SON A;  3Q1P A;  4N1U A;  4DYW A;  3FJY A;  2O5W A;  5GHP A;  1JRK A;  5GHJ A;  2JVB A;  1SJY A;  1Q54 A;  1MK1 A;  3GZ5 A;  3EEU A;  3X0I A;  5GHQ A;  1SOI A;  4YPR A;  3G0Q A;  1PUN A;  2G74 A;  3GWY A;  1VHG A;  2YVN A;  5FSI A;  1VK6 A;  1V8T A;  3ID9 A;  3Q91 A;  1GA7 A;  3I9X A;  4KTB A;  1MQW A;  1X84 A;  2CL3 A;  3A6U A;  3GZ6 A;  3P6Y A;  2B06 A;  3F13 A;  3P5T A;  2FML A;  4KG4 A;  1VRL A;  5DPK A;  1PPX A;  2YYH A;  3QSJ A;  4ICK A;  3Q4I A;  5FSK A;  5C7Q A;  5LPG A;  3O61 A;  2QKM B;  3MDI A;  3ACA A;  1JKN A;  3I7V A;  1V8I A;  1VIU A;  1VHZ A;  5BS6 A;  1QVJ A;  3WHW A;  1IRY A;  1PUQ A;  4K6E A;  1VC8 A;  3A6T A;  5FSM A;  3CNG A;  2ICJ A;  3O69 A;  3O6Z A;  2A8Q A;  3X0K A;  3A6V A;  1KTG A;  2QJO A;  5GHO A;  1I9A A;  3ZR1 A;  3X0J A;  4C9X A;  3X0R A;  2YVO A;  4YPH A;  3N77 A;  1RRQ A;  5C8L A;  2DUK A;  1NFS A;  3L85 A;  1MUT A;  2W4E A;  1V8M A;  3BAP A;  4KYX A;  1SU2 A;  3BM4 A;  3DUP A;  2ICK A; 
#chains in the Genus database with same CATH topology
 3MDG A;  3AC9 A;  3E57 A;  4S2Y A;  5FSL A;  3SMD A;  3X0P A;  1Q27 A;  4HVY A;  1PUS A;  1Q33 A;  1V8V A;  1VIQ A;  5ANT A;  4S2W A;  2GT4 A;  1RYA A;  5DEQ A;  1MP2 A;  1G0S A;  2FKB A;  1X83 A;  3FCM A;  3MCF A;  3FSP A;  1NQZ A;  2DSC A;  2GT2 A;  5FSO A;  3RH7 A;  4S2X A;  3Q2T A;  2B2K A;  2I8U A;  5ANW A;  2XSQ A;  5BON A;  1SZ3 A;  3FK9 A;  1XSB A;  3X0N A;  4C9W A;  5DD4 A;  2R5W A;  2VNQ A;  3GRN A;  3KVH A;  3EES A;  3O52 A;  4JZT A;  1VC9 A;  2I6K A;  4MPO A;  1K2E A;  2O1C A;  3F6A A;  4ILQ A;  4NFW A;  2YVM A;  2PQV A;  1V8W A;  1U20 A;  5C7T A;  2PNY A;  1MR2 A;  2G73 A;  2KDW A;  3Q93 A;  5ANU A;  2YVP A;  3U53 A;  3X0S A;  3ZR0 A;  3COU A;  3O8S A;  1K26 A;  2A8P A;  2VNP A;  2GB5 A;  3X0O A;  1PPW A;  2QJT A;  5CFJ A;  1RRS A;  1NQY A;  1XSC A;  5HZX A;  1V8N A;  5ANS A;  4V14 A;  4JZS A;  3X0M A;  2DSB A;  3R03 A;  3HYQ A;  1V8S A;  3GG6 A;  3A6S A;  4HFQ A;  5CFI A;  4ZG0 A;  2DSD A;  2CZR A;  3FFU A;  3J7Y e;  2I8T A;  1G9Q A;  2A8R A;  1OW2 A;  2B0V A;  3X0Q A;  2RRK A;  2AZW A;  4J7H A;  2DHO A;  2J8Q A;  1HX3 A;  4NFX A;  1VCD A;  4YOQ A;  3GZ8 A;  1V8Y A;  1X51 A;  1V8L A;  3EF5 A;  4N1T A;  5IW4 A;  3Q2S A;  2O5F A;  4JZV A;  2A6T A;  2KDV A;  2Q9P A;  5ANV A;  3MGM A;  4S2V A;  3X0L A;  5IW5 A;  3N9U A;  3OGA A;  3SHD A;  5DDG A;  5ISY A;  1F3Y A;  3BHO A;  3I7U A;  1KHZ A;  1XSA A;  2A8S A;  1TUM A;  1MQE A;  2FVV A;  3EXQ A;  4IJX A;  3HHJ A;  4KG3 A;  5FSN A;  1HZT A;  1PPV A;  3H95 A;  5GHN A;  5I8U A;  5GHI A;  4JZU A;  3DKU A;  1V8R A;  1R67 A;  1NFZ A;  1V8U A;  1PVF A;  2A8T A;  5GHM A;  1KT9 A;  3SON A;  3Q1P A;  4N1U A;  4DYW A;  3FJY A;  2O5W A;  5GHP A;  1JRK A;  5GHJ A;  2JVB A;  1SJY A;  1Q54 A;  1MK1 A;  3GZ5 A;  3EEU A;  3X0I A;  5GHQ A;  1SOI A;  4YPR A;  3G0Q A;  1PUN A;  2G74 A;  3GWY A;  1VHG A;  2YVN A;  5FSI A;  1VK6 A;  1V8T A;  3ID9 A;  3Q91 A;  1GA7 A;  3I9X A;  4KTB A;  1MQW A;  1X84 A;  2CL3 A;  3A6U A;  3GZ6 A;  3P6Y A;  2B06 A;  3F13 A;  3P5T A;  2FML A;  4KG4 A;  1VRL A;  5DPK A;  1PPX A;  2YYH A;  3QSJ A;  4ICK A;  3Q4I A;  5FSK A;  5C7Q A;  5LPG A;  3O61 A;  2QKM B;  3MDI A;  3ACA A;  1JKN A;  3I7V A;  1V8I A;  1VIU A;  1VHZ A;  5BS6 A;  1QVJ A;  3WHW A;  1IRY A;  1PUQ A;  4K6E A;  1VC8 A;  3A6T A;  5FSM A;  3CNG A;  2ICJ A;  3O69 A;  3O6Z A;  2A8Q A;  3X0K A;  3A6V A;  1KTG A;  2QJO A;  5GHO A;  1I9A A;  3ZR1 A;  3X0J A;  4C9X A;  3X0R A;  2YVO A;  4YPH A;  3N77 A;  1RRQ A;  5C8L A;  2DUK A;  1NFS A;  3L85 A;  1MUT A;  4J7G A;  2W4E A;  1V8M A;  3BAP A;  4KYX A;  1SU2 A;  3BM4 A;  3DUP A;  2ICK A; 
#chains in the Genus database with same CATH homology
 3MDG A;  3AC9 A;  3E57 A;  4S2Y A;  5FSL A;  3SMD A;  3X0P A;  1Q27 A;  4HVY A;  1PUS A;  1Q33 A;  1V8V A;  1VIQ A;  5ANT A;  4S2W A;  2GT4 A;  1RYA A;  5DEQ A;  1MP2 A;  1G0S A;  2FKB A;  1X83 A;  3FCM A;  3MCF A;  3FSP A;  1NQZ A;  2DSC A;  2GT2 A;  5FSO A;  3RH7 A;  4S2X A;  3Q2T A;  2B2K A;  2I8U A;  5ANW A;  2XSQ A;  5BON A;  1SZ3 A;  3FK9 A;  1XSB A;  3X0N A;  4C9W A;  5DD4 A;  2R5W A;  2VNQ A;  3GRN A;  3KVH A;  3EES A;  3O52 A;  4JZT A;  1VC9 A;  2I6K A;  4MPO A;  1K2E A;  2O1C A;  3F6A A;  4ILQ A;  4NFW A;  2YVM A;  2PQV A;  1V8W A;  1U20 A;  5C7T A;  2PNY A;  1MR2 A;  2G73 A;  2KDW A;  3Q93 A;  5ANU A;  2YVP A;  3U53 A;  3X0S A;  3ZR0 A;  3COU A;  3O8S A;  1K26 A;  2A8P A;  2VNP A;  2GB5 A;  3X0O A;  1PPW A;  2QJT A;  5CFJ A;  1RRS A;  1NQY A;  1XSC A;  5HZX A;  1V8N A;  5ANS A;  4V14 A;  4JZS A;  3X0M A;  2DSB A;  3R03 A;  3HYQ A;  1V8S A;  3GG6 A;  3A6S A;  4HFQ A;  5CFI A;  4ZG0 A;  2DSD A;  2CZR A;  3FFU A;  3J7Y e;  2I8T A;  1G9Q A;  2A8R A;  1OW2 A;  2B0V A;  3X0Q A;  2RRK A;  2AZW A;  4J7H A;  2DHO A;  2J8Q A;  1HX3 A;  4NFX A;  1VCD A;  4YOQ A;  3GZ8 A;  1V8Y A;  1X51 A;  1V8L A;  3EF5 A;  4N1T A;  5IW4 A;  3Q2S A;  2O5F A;  4JZV A;  2A6T A;  2KDV A;  2Q9P A;  5ANV A;  3MGM A;  4S2V A;  3X0L A;  5IW5 A;  3N9U A;  3OGA A;  3SHD A;  5DDG A;  5ISY A;  1F3Y A;  3BHO A;  3I7U A;  1KHZ A;  1XSA A;  2A8S A;  1TUM A;  1MQE A;  2FVV A;  3EXQ A;  4IJX A;  3HHJ A;  4KG3 A;  5FSN A;  1HZT A;  1PPV A;  3H95 A;  5GHN A;  5I8U A;  5GHI A;  4JZU A;  3DKU A;  1V8R A;  1R67 A;  1NFZ A;  1V8U A;  1PVF A;  2A8T A;  5GHM A;  1KT9 A;  3SON A;  3Q1P A;  4N1U A;  4DYW A;  3FJY A;  2O5W A;  5GHP A;  1JRK A;  5GHJ A;  2JVB A;  1SJY A;  1Q54 A;  1MK1 A;  3GZ5 A;  3EEU A;  3X0I A;  5GHQ A;  1SOI A;  4YPR A;  3G0Q A;  1PUN A;  2G74 A;  3GWY A;  1VHG A;  2YVN A;  5FSI A;  1VK6 A;  1V8T A;  3ID9 A;  3Q91 A;  1GA7 A;  3I9X A;  4KTB A;  1MQW A;  1X84 A;  2CL3 A;  3A6U A;  3GZ6 A;  3P6Y A;  2B06 A;  3F13 A;  3P5T A;  2FML A;  4KG4 A;  1VRL A;  5DPK A;  1PPX A;  2YYH A;  3QSJ A;  4ICK A;  3Q4I A;  5FSK A;  5C7Q A;  5LPG A;  3O61 A;  2QKM B;  3MDI A;  3ACA A;  1JKN A;  3I7V A;  1V8I A;  1VIU A;  1VHZ A;  5BS6 A;  1QVJ A;  3WHW A;  1IRY A;  1PUQ A;  4K6E A;  1VC8 A;  3A6T A;  5FSM A;  3CNG A;  2ICJ A;  3O69 A;  3O6Z A;  2A8Q A;  3X0K A;  3A6V A;  1KTG A;  2QJO A;  5GHO A;  1I9A A;  3ZR1 A;  3X0J A;  4C9X A;  3X0R A;  2YVO A;  4YPH A;  3N77 A;  1RRQ A;  5C8L A;  2DUK A;  1NFS A;  3L85 A;  1MUT A;  4J7G A;  2W4E A;  1V8M A;  3BAP A;  4KYX A;  1SU2 A;  3BM4 A;  3DUP A;  2ICK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...