2GT4A

Crystal structure of the y103f mutant of the gdp-mannose mannosyl hydrolase in complex with gdp-mannose and mg+2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
160
structure length
160
Chain Sequence
MMFLRQEDFATVVRSTPLVSLDFIVENSRGEFLLGKRTNRPAQGYWFVPGGRVQKDETLEAAFERLTMAELGLRLPITAGQFYGVWQHFYDDNFSGTDFTTHFVVLGFRFRVSEEELLLPDEQHDDYRWLTSDALLASDNVHANSRAYFLAEKRTGVPGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-mannose mannosyl hydrolase
publication title X-ray, NMR, and mutational studies of the catalytic cycle of the GDP-mannose mannosyl hydrolase reaction.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 39
structure length 160
sequence length 160
chains with identical sequence B, C
ec nomenclature ec 3.6.1.-:
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2gt4A00
4DYWA 2A6TA 3OGAA 5GHOA 3X0OA 1X84A 1MP2A 1HZTA 1GA7A 1G9QA 5LPGA 5C8LA 1PUQA 3AC9A 4KTBA 4MPOA 1V8VA 1X83A 5FSIA 4C9XA 3FSPA 3GZ5A 5GHQA 1SZ3A 2FKBA 1TUMA 3A6TA 3BM4A 3I7VA 3X0KA 4KG3A 2DUKA 4ICKA 1XSCA 5IW5A 3Q1PA 3Q2TA 2FMLA 2A8RA 4KYXA 1K2EA 2YYHA 4IJXA 3COUA 1V8SA 3X0LA 3MDIA 2YVNA 3I7UA 4N1TA 3O69A 3ZR0A 3J7Ye 1MQWA 3ID9A 5GHMA 1V8UA 2B0VA 1JRKA 3FCMA 3E57A 2I8UA 1QVJA 2B2KA 3N77A 2KDVA 1VCDA 2O1CA 1KT9A 4YPHA 5DD4A 2PQVA 1K26A 4K6EA 4ZG0A 2GB5A 1RRQA 1SJYA 2I6KA 1VIUA 4JZUA 1V8TA 5DPKA 1Q54A 1X51A 3X0IA 4JZVA 1SOIA 3QSJA 3X0PA 1NQYA 1V8MA 1Q33A 1R67A 4KG4A 4S2VA 1V8WA 3O8SA 1V8YA 2J8QA 5HZXA 1PPVA 3FJYA 5ANWA 3I9XA 2CL3A 3Q93A 3L85A 4NFWA 1PPWA 2GT2A 2YVOA 3GZ8A 3MCFA 3SMDA 2JVBA 3BAPA 3X0MA 5ISYA 2VNPA 3A6UA 4JZSA 1SU2A 3X0QA 2YVMA 2DSCA 5GHPA 2AZWA 5IW4A 1NQZA 3O6ZA 3CNGA 1IRYA 5FSKA 5DDGA 3MGMA 5FSLA 1Q27A 1RYAA 4S2YA 2QKMB 2FVVA 1NFZA 3EESA 4V14A 2KDWA 5ANTA 3HYQA 2ICJA 1XSBA 3X0JA 1PPXA 2O5FA 3DKUA 3SONA 5GHNA 2A8SA 3H95A 3U53A 3X0SA 3X0RA 2A8PA 3P6YA 3GRNA 1HX3A 3R03A 2I8TA 1MQEA 2RRKA 4S2WA 5BONA 5CFIA 3FK9A 4YOQA 5ANVA 3GZ6A 3GWYA 4NFXA 5I8UA 2Q9PA 2QJOA 1MR2A 3KVHA 1G0SA 3F6AA 1JKNA 3A6VA 3MDGA 4S2XA 3Q4IA 4ILQA 1PUSA 2A8TA 1NFSA 3ACAA 3BHOA 5ANSA 2B06A 2DSBA 1I9AA 3O61A 2R5WA 4HVYA 5FSMA 1VHGA 1MUTA 1V8NA 2XSQA 3SHDA 1KTGA 4YPRA 1RRSA 3RH7A 2A8QA 3F13A 3P5TA 2QJTA 4N1UA 3WHWA 3EF5A 5DEQA 5GHJA 1F3YA 1VC8A 3DUPA 4C9WA 3Q91A 1VIQA 3X0NA 3A6SA 2DSDA 2ICKA 5FSNA 3ZR1A 3FFUA 2W4EA 3Q2SA 5C7QA 2DHOA 5CFJA 2GT4A 1KHZA 5ANUA 3EXQA 1VC9A 3G0QA 2YVPA 1VK6A 5FSOA 1VHZA 1V8IA 1U20A 1XSAA 2G74A 1V8LA 2G73A 2O5WA 3EEUA 3GG6A 3HHJA 1MK1A 4JZTA 5GHIA 5BS6A 1V8RA 3N9UA 3O52A 2VNQA 1OW2A 1VRLA 2PNYA 1PUNA 1PVFA 5C7TA 4HFQA
chains in the Genus database with same CATH superfamily
4DYWA 2A6TA 3OGAA 5GHOA 3X0OA 1X84A 1MP2A 1HZTA 1GA7A 1G9QA 5LPGA 5C8LA 1PUQA 3AC9A 4KTBA 4MPOA 1V8VA 1X83A 5FSIA 4C9XA 3FSPA 3GZ5A 5GHQA 1SZ3A 2FKBA 1TUMA 3A6TA 3BM4A 3I7VA 3X0KA 4KG3A 2DUKA 4ICKA 1XSCA 5IW5A 3Q1PA 3Q2TA 2FMLA 2A8RA 4KYXA 1K2EA 2YYHA 4IJXA 3COUA 1V8SA 3X0LA 3MDIA 2YVNA 3I7UA 4N1TA 3O69A 3ZR0A 3J7Ye 1MQWA 3ID9A 5GHMA 1V8UA 2B0VA 1JRKA 3FCMA 3E57A 2I8UA 1QVJA 2B2KA 3N77A 2KDVA 1VCDA 2O1CA 1KT9A 4YPHA 5DD4A 2PQVA 1K26A 4J7HA 4K6EA 4ZG0A 2GB5A 1RRQA 1SJYA 2I6KA 1VIUA 4JZUA 1V8TA 5DPKA 1Q54A 1X51A 3X0IA 4JZVA 1SOIA 3QSJA 3X0PA 1NQYA 1V8MA 1Q33A 1R67A 4KG4A 4S2VA 1V8WA 3O8SA 1V8YA 2J8QA 5HZXA 1PPVA 3FJYA 5ANWA 3I9XA 2CL3A 3Q93A 3L85A 4NFWA 1PPWA 2GT2A 2YVOA 3GZ8A 3MCFA 3SMDA 2JVBA 3BAPA 3X0MA 5ISYA 2VNPA 3A6UA 4JZSA 1SU2A 3X0QA 2YVMA 2DSCA 5GHPA 2AZWA 5IW4A 1NQZA 3O6ZA 3CNGA 1IRYA 5FSKA 5DDGA 3MGMA 5FSLA 1Q27A 1RYAA 4S2YA 2QKMB 2FVVA 1NFZA 3EESA 4V14A 2KDWA 5ANTA 3HYQA 2ICJA 1XSBA 3X0JA 1PPXA 2O5FA 3DKUA 4J7GA 3SONA 5GHNA 2A8SA 3H95A 3U53A 3X0SA 3X0RA 2A8PA 3P6YA 3GRNA 1HX3A 3R03A 2I8TA 1MQEA 2RRKA 4S2WA 5BONA 5CFIA 3FK9A 4YOQA 5ANVA 3GZ6A 3GWYA 4NFXA 5I8UA 2Q9PA 2QJOA 1MR2A 3KVHA 1G0SA 3F6AA 1JKNA 3A6VA 3MDGA 4S2XA 3Q4IA 4ILQA 1PUSA 2A8TA 1NFSA 3ACAA 3BHOA 5ANSA 2B06A 2DSBA 1I9AA 3O61A 2R5WA 4HVYA 5FSMA 1VHGA 1MUTA 1V8NA 2XSQA 3SHDA 1KTGA 4YPRA 1RRSA 3RH7A 2A8QA 3F13A 3P5TA 2QJTA 4N1UA 3WHWA 3EF5A 5DEQA 5GHJA 1F3YA 1VC8A 3DUPA 4C9WA 3Q91A 1VIQA 3X0NA 3A6SA 2DSDA 2ICKA 5FSNA 3ZR1A 3FFUA 2W4EA 3Q2SA 5C7QA 2CZRA 2DHOA 2GT4A 5CFJA 1KHZA 5ANUA 3EXQA 1VC9A 3G0QA 2YVPA 1VK6A 5FSOA 1VHZA 1V8IA 1U20A 1XSAA 2G74A 1V8LA 2G73A 2O5WA 3EEUA 3GG6A 3HHJA 1MK1A 4JZTA 5GHIA 5BS6A 1V8RA 3N9UA 3O52A 2VNQA 1OW2A 1VRLA 2PNYA 1PUNA 1PVFA 5C7TA 4HFQA
chains in the Genus database with same CATH topology
4DYWA 2A6TA 3OGAA 5GHOA 3X0OA 1X84A 1MP2A 1HZTA 1GA7A 1G9QA 5LPGA 5C8LA 1PUQA 3AC9A 4KTBA 4MPOA 1V8VA 1X83A 5FSIA 4C9XA 3FSPA 3GZ5A 5GHQA 1SZ3A 2FKBA 1TUMA 3A6TA 3BM4A 3I7VA 3X0KA 4KG3A 2DUKA 4ICKA 1XSCA 5IW5A 3Q1PA 3Q2TA 2FMLA 2A8RA 4KYXA 1K2EA 2YYHA 4IJXA 3COUA 1V8SA 3X0LA 3MDIA 2YVNA 3I7UA 4N1TA 3O69A 3ZR0A 3J7Ye 1MQWA 3ID9A 5GHMA 1V8UA 2B0VA 1JRKA 3FCMA 3E57A 2I8UA 1QVJA 2B2KA 3N77A 2KDVA 1VCDA 2O1CA 1KT9A 4YPHA 5DD4A 2PQVA 1K26A 4J7HA 4K6EA 4ZG0A 2GB5A 1RRQA 1SJYA 2I6KA 1VIUA 4JZUA 1V8TA 5DPKA 1Q54A 1X51A 3X0IA 4JZVA 1SOIA 3QSJA 3X0PA 1NQYA 1V8MA 1Q33A 1R67A 4KG4A 4S2VA 1V8WA 3O8SA 1V8YA 2J8QA 5HZXA 1PPVA 3FJYA 5ANWA 3I9XA 2CL3A 3Q93A 3L85A 4NFWA 1PPWA 2GT2A 2YVOA 3GZ8A 3MCFA 3SMDA 2JVBA 3BAPA 3X0MA 5ISYA 2VNPA 3A6UA 4JZSA 1SU2A 3X0QA 2YVMA 2DSCA 5GHPA 2AZWA 5IW4A 1NQZA 3O6ZA 3CNGA 1IRYA 5FSKA 5DDGA 3MGMA 5FSLA 1Q27A 1RYAA 4S2YA 2QKMB 2FVVA 1NFZA 3EESA 4V14A 2KDWA 5ANTA 3HYQA 2ICJA 1XSBA 3X0JA 1PPXA 2O5FA 3DKUA 4J7GA 3SONA 5GHNA 2A8SA 3H95A 3U53A 3X0SA 3X0RA 2A8PA 3P6YA 3GRNA 1HX3A 3R03A 2I8TA 1MQEA 2RRKA 4S2WA 5BONA 5CFIA 3FK9A 4YOQA 5ANVA 3GZ6A 3GWYA 4NFXA 5I8UA 2Q9PA 2QJOA 1MR2A 3KVHA 1G0SA 3F6AA 1JKNA 3A6VA 3MDGA 4S2XA 3Q4IA 4ILQA 1PUSA 2A8TA 1NFSA 3ACAA 3BHOA 5ANSA 2B06A 2DSBA 1I9AA 3O61A 2R5WA 4HVYA 5FSMA 1VHGA 1MUTA 1V8NA 2XSQA 3SHDA 1KTGA 4YPRA 1RRSA 3RH7A 2A8QA 3F13A 3P5TA 2QJTA 4N1UA 3WHWA 3EF5A 5DEQA 5GHJA 1F3YA 1VC8A 3DUPA 4C9WA 3Q91A 1VIQA 3X0NA 3A6SA 2DSDA 2ICKA 5FSNA 3ZR1A 3FFUA 2W4EA 3Q2SA 5C7QA 2CZRA 2DHOA 2GT4A 5CFJA 1KHZA 5ANUA 3EXQA 1VC9A 3G0QA 2YVPA 1VK6A 5FSOA 1VHZA 1V8IA 1U20A 1XSAA 2G74A 1V8LA 2G73A 2O5WA 3EEUA 3GG6A 3HHJA 1MK1A 4JZTA 5GHIA 5BS6A 1V8RA 3N9UA 3O52A 2VNQA 1OW2A 1VRLA 2PNYA 1PUNA 1PVFA 5C7TA 4HFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DYW A;  2A6T A;  3OGA A;  5GHO A;  3X0O A;  1X84 A;  1MP2 A;  1HZT A;  1GA7 A;  1G9Q A;  5LPG A;  5C8L A;  1PUQ A;  3AC9 A;  4KTB A;  4MPO A;  1V8V A;  1X83 A;  5FSI A;  4C9X A;  3FSP A;  3GZ5 A;  5GHQ A;  1SZ3 A;  2FKB A;  1TUM A;  3A6T A;  3BM4 A;  3I7V A;  3X0K A;  4KG3 A;  2DUK A;  4ICK A;  1XSC A;  5IW5 A;  3Q1P A;  3Q2T A;  2FML A;  2A8R A;  4KYX A;  1K2E A;  2YYH A;  4IJX A;  3COU A;  1V8S A;  3X0L A;  3MDI A;  2YVN A;  3I7U A;  4N1T A;  3O69 A;  3ZR0 A;  3J7Y e;  1MQW A;  3ID9 A;  5GHM A;  1V8U A;  2B0V A;  1JRK A;  3FCM A;  3E57 A;  2I8U A;  1QVJ A;  2B2K A;  3N77 A;  2KDV A;  1VCD A;  2O1C A;  1KT9 A;  4YPH A;  5DD4 A;  2PQV A;  1K26 A;  4K6E A;  4ZG0 A;  2GB5 A;  1RRQ A;  1SJY A;  2I6K A;  1VIU A;  4JZU A;  1V8T A;  5DPK A;  1Q54 A;  1X51 A;  3X0I A;  4JZV A;  1SOI A;  3QSJ A;  3X0P A;  1NQY A;  1V8M A;  1Q33 A;  1R67 A;  4KG4 A;  4S2V A;  1V8W A;  3O8S A;  1V8Y A;  2J8Q A;  5HZX A;  1PPV A;  3FJY A;  5ANW A;  3I9X A;  2CL3 A;  3Q93 A;  3L85 A;  4NFW A;  1PPW A;  2GT2 A;  2YVO A;  3GZ8 A;  3MCF A;  3SMD A;  2JVB A;  3BAP A;  3X0M A;  5ISY A;  2VNP A;  3A6U A;  4JZS A;  1SU2 A;  3X0Q A;  2YVM A;  2DSC A;  5GHP A;  2AZW A;  5IW4 A;  1NQZ A;  3O6Z A;  3CNG A;  1IRY A;  5FSK A;  5DDG A;  3MGM A;  5FSL A;  1Q27 A;  1RYA A;  4S2Y A;  2QKM B;  2FVV A;  1NFZ A;  3EES A;  4V14 A;  2KDW A;  5ANT A;  3HYQ A;  2ICJ A;  1XSB A;  3X0J A;  1PPX A;  2O5F A;  3DKU A;  3SON A;  5GHN A;  2A8S A;  3H95 A;  3U53 A;  3X0S A;  3X0R A;  2A8P A;  3P6Y A;  3GRN A;  1HX3 A;  3R03 A;  2I8T A;  1MQE A;  2RRK A;  4S2W A;  5BON A;  5CFI A;  3FK9 A;  4YOQ A;  5ANV A;  3GZ6 A;  3GWY A;  4NFX A;  5I8U A;  2Q9P A;  2QJO A;  1MR2 A;  3KVH A;  1G0S A;  3F6A A;  1JKN A;  3A6V A;  3MDG A;  4S2X A;  3Q4I A;  4ILQ A;  1PUS A;  2A8T A;  1NFS A;  3ACA A;  3BHO A;  5ANS A;  2B06 A;  2DSB A;  1I9A A;  3O61 A;  2R5W A;  4HVY A;  5FSM A;  1VHG A;  1MUT A;  1V8N A;  2XSQ A;  3SHD A;  1KTG A;  4YPR A;  1RRS A;  3RH7 A;  2A8Q A;  3F13 A;  3P5T A;  2QJT A;  4N1U A;  3WHW A;  3EF5 A;  5DEQ A;  5GHJ A;  1F3Y A;  1VC8 A;  3DUP A;  4C9W A;  3Q91 A;  1VIQ A;  3X0N A;  3A6S A;  2DSD A;  2ICK A;  5FSN A;  3ZR1 A;  3FFU A;  2W4E A;  3Q2S A;  5C7Q A;  2DHO A;  5CFJ A;  2GT4 A;  1KHZ A;  5ANU A;  3EXQ A;  1VC9 A;  3G0Q A;  2YVP A;  1VK6 A;  5FSO A;  1VHZ A;  1V8I A;  1U20 A;  1XSA A;  2G74 A;  1V8L A;  2G73 A;  2O5W A;  3EEU A;  3GG6 A;  3HHJ A;  1MK1 A;  4JZT A;  5GHI A;  5BS6 A;  1V8R A;  3N9U A;  3O52 A;  2VNQ A;  1OW2 A;  1VRL A;  2PNY A;  1PUN A;  1PVF A;  5C7T A;  4HFQ A; 
#chains in the Genus database with same CATH topology
 4DYW A;  2A6T A;  3OGA A;  5GHO A;  3X0O A;  1X84 A;  1MP2 A;  1HZT A;  1GA7 A;  1G9Q A;  5LPG A;  5C8L A;  1PUQ A;  3AC9 A;  4KTB A;  4MPO A;  1V8V A;  1X83 A;  5FSI A;  4C9X A;  3FSP A;  3GZ5 A;  5GHQ A;  1SZ3 A;  2FKB A;  1TUM A;  3A6T A;  3BM4 A;  3I7V A;  3X0K A;  4KG3 A;  2DUK A;  4ICK A;  1XSC A;  5IW5 A;  3Q1P A;  3Q2T A;  2FML A;  2A8R A;  4KYX A;  1K2E A;  2YYH A;  4IJX A;  3COU A;  1V8S A;  3X0L A;  3MDI A;  2YVN A;  3I7U A;  4N1T A;  3O69 A;  3ZR0 A;  3J7Y e;  1MQW A;  3ID9 A;  5GHM A;  1V8U A;  2B0V A;  1JRK A;  3FCM A;  3E57 A;  2I8U A;  1QVJ A;  2B2K A;  3N77 A;  2KDV A;  1VCD A;  2O1C A;  1KT9 A;  4YPH A;  5DD4 A;  2PQV A;  1K26 A;  4J7H A;  4K6E A;  4ZG0 A;  2GB5 A;  1RRQ A;  1SJY A;  2I6K A;  1VIU A;  4JZU A;  1V8T A;  5DPK A;  1Q54 A;  1X51 A;  3X0I A;  4JZV A;  1SOI A;  3QSJ A;  3X0P A;  1NQY A;  1V8M A;  1Q33 A;  1R67 A;  4KG4 A;  4S2V A;  1V8W A;  3O8S A;  1V8Y A;  2J8Q A;  5HZX A;  1PPV A;  3FJY A;  5ANW A;  3I9X A;  2CL3 A;  3Q93 A;  3L85 A;  4NFW A;  1PPW A;  2GT2 A;  2YVO A;  3GZ8 A;  3MCF A;  3SMD A;  2JVB A;  3BAP A;  3X0M A;  5ISY A;  2VNP A;  3A6U A;  4JZS A;  1SU2 A;  3X0Q A;  2YVM A;  2DSC A;  5GHP A;  2AZW A;  5IW4 A;  1NQZ A;  3O6Z A;  3CNG A;  1IRY A;  5FSK A;  5DDG A;  3MGM A;  5FSL A;  1Q27 A;  1RYA A;  4S2Y A;  2QKM B;  2FVV A;  1NFZ A;  3EES A;  4V14 A;  2KDW A;  5ANT A;  3HYQ A;  2ICJ A;  1XSB A;  3X0J A;  1PPX A;  2O5F A;  3DKU A;  4J7G A;  3SON A;  5GHN A;  2A8S A;  3H95 A;  3U53 A;  3X0S A;  3X0R A;  2A8P A;  3P6Y A;  3GRN A;  1HX3 A;  3R03 A;  2I8T A;  1MQE A;  2RRK A;  4S2W A;  5BON A;  5CFI A;  3FK9 A;  4YOQ A;  5ANV A;  3GZ6 A;  3GWY A;  4NFX A;  5I8U A;  2Q9P A;  2QJO A;  1MR2 A;  3KVH A;  1G0S A;  3F6A A;  1JKN A;  3A6V A;  3MDG A;  4S2X A;  3Q4I A;  4ILQ A;  1PUS A;  2A8T A;  1NFS A;  3ACA A;  3BHO A;  5ANS A;  2B06 A;  2DSB A;  1I9A A;  3O61 A;  2R5W A;  4HVY A;  5FSM A;  1VHG A;  1MUT A;  1V8N A;  2XSQ A;  3SHD A;  1KTG A;  4YPR A;  1RRS A;  3RH7 A;  2A8Q A;  3F13 A;  3P5T A;  2QJT A;  4N1U A;  3WHW A;  3EF5 A;  5DEQ A;  5GHJ A;  1F3Y A;  1VC8 A;  3DUP A;  4C9W A;  3Q91 A;  1VIQ A;  3X0N A;  3A6S A;  2DSD A;  2ICK A;  5FSN A;  3ZR1 A;  3FFU A;  2W4E A;  3Q2S A;  5C7Q A;  2CZR A;  2DHO A;  2GT4 A;  5CFJ A;  1KHZ A;  5ANU A;  3EXQ A;  1VC9 A;  3G0Q A;  2YVP A;  1VK6 A;  5FSO A;  1VHZ A;  1V8I A;  1U20 A;  1XSA A;  2G74 A;  1V8L A;  2G73 A;  2O5W A;  3EEU A;  3GG6 A;  3HHJ A;  1MK1 A;  4JZT A;  5GHI A;  5BS6 A;  1V8R A;  3N9U A;  3O52 A;  2VNQ A;  1OW2 A;  1VRL A;  2PNY A;  1PUN A;  1PVF A;  5C7T A;  4HFQ A; 
#chains in the Genus database with same CATH homology
 4DYW A;  2A6T A;  3OGA A;  5GHO A;  3X0O A;  1X84 A;  1MP2 A;  1HZT A;  1GA7 A;  1G9Q A;  5LPG A;  5C8L A;  1PUQ A;  3AC9 A;  4KTB A;  4MPO A;  1V8V A;  1X83 A;  5FSI A;  4C9X A;  3FSP A;  3GZ5 A;  5GHQ A;  1SZ3 A;  2FKB A;  1TUM A;  3A6T A;  3BM4 A;  3I7V A;  3X0K A;  4KG3 A;  2DUK A;  4ICK A;  1XSC A;  5IW5 A;  3Q1P A;  3Q2T A;  2FML A;  2A8R A;  4KYX A;  1K2E A;  2YYH A;  4IJX A;  3COU A;  1V8S A;  3X0L A;  3MDI A;  2YVN A;  3I7U A;  4N1T A;  3O69 A;  3ZR0 A;  3J7Y e;  1MQW A;  3ID9 A;  5GHM A;  1V8U A;  2B0V A;  1JRK A;  3FCM A;  3E57 A;  2I8U A;  1QVJ A;  2B2K A;  3N77 A;  2KDV A;  1VCD A;  2O1C A;  1KT9 A;  4YPH A;  5DD4 A;  2PQV A;  1K26 A;  4J7H A;  4K6E A;  4ZG0 A;  2GB5 A;  1RRQ A;  1SJY A;  2I6K A;  1VIU A;  4JZU A;  1V8T A;  5DPK A;  1Q54 A;  1X51 A;  3X0I A;  4JZV A;  1SOI A;  3QSJ A;  3X0P A;  1NQY A;  1V8M A;  1Q33 A;  1R67 A;  4KG4 A;  4S2V A;  1V8W A;  3O8S A;  1V8Y A;  2J8Q A;  5HZX A;  1PPV A;  3FJY A;  5ANW A;  3I9X A;  2CL3 A;  3Q93 A;  3L85 A;  4NFW A;  1PPW A;  2GT2 A;  2YVO A;  3GZ8 A;  3MCF A;  3SMD A;  2JVB A;  3BAP A;  3X0M A;  5ISY A;  2VNP A;  3A6U A;  4JZS A;  1SU2 A;  3X0Q A;  2YVM A;  2DSC A;  5GHP A;  2AZW A;  5IW4 A;  1NQZ A;  3O6Z A;  3CNG A;  1IRY A;  5FSK A;  5DDG A;  3MGM A;  5FSL A;  1Q27 A;  1RYA A;  4S2Y A;  2QKM B;  2FVV A;  1NFZ A;  3EES A;  4V14 A;  2KDW A;  5ANT A;  3HYQ A;  2ICJ A;  1XSB A;  3X0J A;  1PPX A;  2O5F A;  3DKU A;  4J7G A;  3SON A;  5GHN A;  2A8S A;  3H95 A;  3U53 A;  3X0S A;  3X0R A;  2A8P A;  3P6Y A;  3GRN A;  1HX3 A;  3R03 A;  2I8T A;  1MQE A;  2RRK A;  4S2W A;  5BON A;  5CFI A;  3FK9 A;  4YOQ A;  5ANV A;  3GZ6 A;  3GWY A;  4NFX A;  5I8U A;  2Q9P A;  2QJO A;  1MR2 A;  3KVH A;  1G0S A;  3F6A A;  1JKN A;  3A6V A;  3MDG A;  4S2X A;  3Q4I A;  4ILQ A;  1PUS A;  2A8T A;  1NFS A;  3ACA A;  3BHO A;  5ANS A;  2B06 A;  2DSB A;  1I9A A;  3O61 A;  2R5W A;  4HVY A;  5FSM A;  1VHG A;  1MUT A;  1V8N A;  2XSQ A;  3SHD A;  1KTG A;  4YPR A;  1RRS A;  3RH7 A;  2A8Q A;  3F13 A;  3P5T A;  2QJT A;  4N1U A;  3WHW A;  3EF5 A;  5DEQ A;  5GHJ A;  1F3Y A;  1VC8 A;  3DUP A;  4C9W A;  3Q91 A;  1VIQ A;  3X0N A;  3A6S A;  2DSD A;  2ICK A;  5FSN A;  3ZR1 A;  3FFU A;  2W4E A;  3Q2S A;  5C7Q A;  2CZR A;  2DHO A;  2GT4 A;  5CFJ A;  1KHZ A;  5ANU A;  3EXQ A;  1VC9 A;  3G0Q A;  2YVP A;  1VK6 A;  5FSO A;  1VHZ A;  1V8I A;  1U20 A;  1XSA A;  2G74 A;  1V8L A;  2G73 A;  2O5W A;  3EEU A;  3GG6 A;  3HHJ A;  1MK1 A;  4JZT A;  5GHI A;  5BS6 A;  1V8R A;  3N9U A;  3O52 A;  2VNQ A;  1OW2 A;  1VRL A;  2PNY A;  1PUN A;  1PVF A;  5C7T A;  4HFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...