2GTCA

Crystal structure of the hypthetical protein from bacillus cereus (atcc 14579). northeast structural genomics target bcr11
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
103
structure length
103
Chain Sequence
MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMDEMKELAKQKGANAIVGVDVDYEVVRDGMLMVAVSGTAVRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the hypthetical protein from Bacillus cereus (ATCC 14579). Northeast structural genomics Target BcR11
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Structural genomics, unknown function
molecule keywords UPF0145 protein BC_1816
total genus 20
structure length 103
sequence length 103
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01906 YbjQ_1 Putative heavy-metal-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.70 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Hypothetical protein apc22750. Chain B 2gtcA00
1Y2IA 2GTCA 2Y1BA 3QKBA 2L8YA 1VR4A
chains in the Genus database with same CATH superfamily
3U6YA 2H9UA 1JO0A 2EH1A 1RQ8A 1DCJA 1NFHA 3ZIHA 2Q3VA 4HVZA 4Q15A 3ZIGA 3DSCA 1NJ6A 3TSPA 3HZ7A 3VTIA 1H4QA 3ZIIA 2IFEA 2A2YA 1NJ5A 2LN3A 1S8EA 4HD0A 3VTHA 4NZTM 3QKBA 3LVKB 2L8YA 1JDQA 4K87A 4K88A 2BKYX 4FCXA 2M71A 3WBMA 3ZIEA 4Z9EA 1NJ8A 4EO0A 4FBKA 2P9BA 1H4TA 1II7A 3TTFA 2Y1BA 4FBWA 3TSQA 4HVCA 1VM0A 1PAVA 1H4SA 1NH9A 4FBQA 1NJ1A 3DSDA 2LXRA 1TIGA 4YDQA 2GTCA 3IABB 1VR4A 2EK0A 1XEZA 1Y9XA 1LN4A 1JE3A 4WI1A 1UDVA 1Y2IA 4TWAA 3TTDA 3TOEA 4K86A 3TTCA 1H0YA 2CRQA 1NFJA 3T1IA 2Z7CA 1HC7A 4NCXA 3LVJC 3P04A 1H0XA 3TSUA 1NJ2A 4OLFA 3IABA 3IALA 4NZRM 4YKEA
chains in the Genus database with same CATH topology
1Y2IA 2GTCA 2Y1BA 3QKBA 2L8YA 1VR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y2I A;  2GTC A;  2Y1B A;  3QKB A;  2L8Y A;  1VR4 A; 
#chains in the Genus database with same CATH topology
 3U6Y A;  2H9U A;  1JO0 A;  2EH1 A;  1RQ8 A;  1DCJ A;  1NFH A;  3ZIH A;  2Q3V A;  4HVZ A;  4Q15 A;  3ZIG A;  3DSC A;  1NJ6 A;  3TSP A;  3HZ7 A;  3VTI A;  1H4Q A;  3ZII A;  2IFE A;  2A2Y A;  1NJ5 A;  2LN3 A;  1S8E A;  4HD0 A;  3VTH A;  4NZT M;  3QKB A;  3LVK B;  2L8Y A;  1JDQ A;  4K87 A;  4K88 A;  2BKY X;  4FCX A;  2M71 A;  3WBM A;  3ZIE A;  4Z9E A;  1NJ8 A;  4EO0 A;  4FBK A;  2P9B A;  1H4T A;  1II7 A;  3TTF A;  2Y1B A;  4FBW A;  3TSQ A;  4HVC A;  1VM0 A;  1PAV A;  1H4S A;  1NH9 A;  4FBQ A;  1NJ1 A;  3DSD A;  2LXR A;  1TIG A;  4YDQ A;  2GTC A;  3IAB B;  1VR4 A;  2EK0 A;  1XEZ A;  1Y9X A;  1LN4 A;  1JE3 A;  4WI1 A;  1UDV A;  1Y2I A;  4TWA A;  3TTD A;  3TOE A;  4K86 A;  3TTC A;  1H0Y A;  2CRQ A;  1NFJ A;  3T1I A;  2Z7C A;  1HC7 A;  4NCX A;  3LVJ C;  3P04 A;  1H0X A;  3TSU A;  1NJ2 A;  4OLF A;  3IAB A;  3IAL A;  4NZR M;  4YKE A; 
#chains in the Genus database with same CATH homology
 1Y2I A;  2GTC A;  2Y1B A;  3QKB A;  2L8Y A;  1VR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...