2GTOA

Oxidized form of adap hsh3-n
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
96
Chain Sequence
EKKEQKEKEKKEQEIKKKFKLTGPIQVIHLAKACCDVKGGKNELSFKQGEQIEIIRITDNPEGKWLGRTARGSYGYIKTTAVEIDYDSLKLKKDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FYN-binding protein
publication title Redox-Regulated Conformational Changes in an SH3 Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2gtoA01
2DF6A 1G83A 2J7IA 2L3QA 3NMZC 4OMPA 3REAB 2L3PA 4AFZC 2KROA 1UHFA 2EYZA 1I0CA 1TUDA 1CKAA 2NWMA 1OEBA 3I35A 2DRMA 1PRMC 2M0YA 2HCKA 4J9BA 4RTUA 1WFWA 3M0PA 1FMKA 2OI3A 1MUZA 3O5ZA 2KXCA 5FWBA 1WXUA 2CSIA 2EPDA 2RNAA 2W10A 2EW3A 4J9DA 4Z88A 2VVKA 1YNZA 2K9GA 1SHFA 4F16A 2D8HA 5I22A 1GRIA 2KRMA 4J9GA 3VS7A 3R6NA 3UATA 2F2VA 3U23A 2FO0A 4A63B 2NUZA 1YWOA 2KR3A 1VYVA 1JQQA 3H41A 3EHQA 4F17A 2JXBA 4HVWA 1UJYA 1UFFA 4RUGA 4CC2A 2ABLA 1E6HA 1K0SA 3H0HA 1T3SA 1KIKA 1G2BA 1WIEA 1HD3A 2LZ6B 3RBBB 3M0UA 3SHWA 4RTVA 1HJDA 3A98A 2FEIA 4DEXA 2V1RA 1T0JA 2HSPA 2K6DA 1X6GA 2QDLA 4LE9A 2RN8A 3TVTA 2RQWA 1X2KA 1Z9ZA 4JJCA 2F2WA 2JMCA 1PKTA 2HEQA 2GNCA 2GQIA 1XOVA 1RI9A 2A37A 1ARKA 1WI7A 1UHCA 3IQLA 4LNPA 4IIMA 2YT6A 1AOJA 1QWEA 2DMOA 2EYYA 1X27A 2J6OA 1NEGA 2JW4A 5FWCA 1AEYA 1JXMA 1ZX6A 1AWWA 1GCQC 1RUWA 4J9EA 2SRCA 1NLOC 3VS5A 2W0ZA 2F2XA 3M0RA 2H8HA 4IIOA 2CH4A 1NM7A 2ED0A 1T3LA 1OOTA 2RQUA 2LNHB 1UDLA 4WCIA 2K7AA 1K4US 5EC7A 1MV3A 3NPFA 2KRSA 1ZUUA 1M27C 2G6FX 1UUEA 4AG2C 1UJ0A 2DL3A 2K79A 1QCFA 2YUNA 2PZ1A 1TUCA 1E6GA 2MOXA 2PTKA 1Y57A 3EG0A 2L2PA 4ZNXA 3QWXX 5IHKA 1JXOA 1M3BA 3C0CA 2FG0A 4RTXA 2EYWA 2ENMA 5L23A 1SHGA 2JM8A 4EIKA 1ABQA 4CC7A 1M30A 2CUBA 2RQVA 3I5RA 2CDTA 2KEAA 1GBQA 4RTZA 2DL7A 4Z8AA 1NYGA 1SRLA 2DA9A 2AZVA 1KSWA 2KGTA 4KRTA 3I5SA 4R0KA 2HBWA 4CC3A 4J9CA 2ROLA 2CUDA 1J3TA 1YP5A 2JS0A 3LH5A 2DBMA 1NG2A 2JMAA 1JU5C 4FSSA 2FRWA 4RTTA 2CH4W 2D0NA 4F14A 3UA7A 2AK5A 2C0TA 1GCPA 2L3SA 1CSKA 2LJ1A 1HSQA 2DJQA 2KT1A 2EGCA 1GCQA 2LJ3A 2GTOA 4AFQC 2XMFA 2CT3A 2A28A 2C0OA 1U5SA 2CT4A 3VS1A 3QWYA 4HVVA 1X6BA 5GJVB 1WXTA 1YN8A 1PKSA 4ESRA 4J9HA 2KBTA 2DM1A 1IO6A 2HDAA 1M3CA 2E5KA 2FPDA 2GBQA 4GLMA 1LCKA 1PNJA 1U3OA 1T0HA 3VRYA 4QT7A 2D1XA 2YDLA 5HCKA 3KFVA 1QWFA 2B86A 2K3BA 1GFDA 3EGUA 5GJWB 4RTWA 4D8DA 2D8JA 1RLPC 2CSQA 3TSZA 1OV3A 2MCNA 2KRNA 3I9QA 5IHIA 2GTJA 1Z9QA 1AZGB 2IIMA 3VS3A 3EG2A 2EKHA 1SRMA 3H0FA 2JS2A 2KNBB 3TSWA 2DRKA 2O31A 1CKBA 1W1FA 1AD5A 4K11A 2LP5A 2BTTA 2RQTA 2ED1A 2JTEA 4JJBA 2GGRA 2EGAA 2JM9A 2KYBA 1M8MA 4AG1C 1UG1A 2L0AA 3FJ5A 1I1JA 4OMLA 1ZSGA 3VS6A 1UE9A 2K2MA 4ORZA 4JZ4A 1B3QA 2X3WD 4OMMA 2ESWA 3ZL7C 4RTYA 1GBRA 1KFZA 1QKXA 2J6KA 5IXBA 2C0IA 2DLPA 1TG0A 3THKA 3EG3A 4J9IA 2EYXA 1OPLA 1JO8A 2X3XD 3M0QA 4M4ZA 2YUOA 2KXDA 2YSQA 5IH2A 1GL5A 2RMOA 1W6XA 4LUDA 1YCSB 1SPKA 1OPKA 1H92A 2DE0X 4LN2A 2J05A 1MV0B 4AFSC 1KJWA 1ABOA 1UECA 3CQTA 1N5ZA 1QKWA 1X43A 2FPEA 2DILA 2A08A 2J6FA 1PRLC 2VKNA 1W70A 2OJ2A 2AKLA 4OMOA 3NHNA 5ECAA 2EGEA 1AVZC 1SEMA 3M0SA 2DNUA 3PVLA 4E6RA 5IXFA 2YUPA 2PNIA 2M51A 4X1VA 2MIOA 4AFUC 1FYNA 1H3HA 2OAWA 2BZYA 1ZUKA 1AZEA 4J9FA 1Y0MA 1X69A 4DEYA 1BU1A 2LMJA 1UTIA 1VYTA 4LUEA 2DYBA 2LX7A 1YWPA 1U06A 1E7OA 1WX6A 3VS4A 2RF0A 2I0NA 1AWXA 1K9AA 1UGVA 1JEGA 1NYFA 1VYUA 2AZSA 2SEMA 2VWFA 2LQNA 2P4RA 3JV3A 1WDXA 1WA7A 1GFCA 2LJ0A 2EQIA 4JPBW 3SEMA 1B07A 3GBQA 3EG1A 1ZUYA 3VRZA 1S1NA 2DVJA 4JZ3A 1EFNA 1K76A 1ZLMA 4OMQA 1SSHA 1NEBA 2LCSA 1BB9A 2JT4A 2RPNA 2ROTA 1WXBA 2BZ8A 3H0IA 1H8KA 1AWOA 2KT8A 1PHTA 4GBQA 1NLPC 4Z89A 1VA7A 3M0TA 4HVUA 3UA6A 2EBPA 1BBZA 2DBKA 2ECZA 2KYMA 1WYXA 4D8KA 1AWJA 1WLPB 5FW9A 2AKKA 2EVRA 3NGPA 4OMNA 1ZBJA 3PVQA 2V1QA 1K1ZA 2KE9A 2LQWA 1I07A 2A36A 2O2OA 2O9SA 3REBB 2DL4A 2FRYA 4HXJA 1BK2A 4CC4B 2CREA 4HCKA 1K0XA 2O9VA 3EHRA 1V1CA 2DL8A 4JJDA 2J06A 2RQRA 5IHNA 3RNJA 2DX1A 3VS2A 1PWTA 2YUQA 3UF4A 4Y92A 3VS0A 3PE0A 1X2QA 2FPFA 5I11A 1QLYA 2O88A 3ULRB 1RLQC 1A0NB 1M3AA 2BZXA 2DL5A
chains in the Genus database with same CATH superfamily
2F1LA 4DOVA 5LJ5j 1N8RR 1OU9A 1I0CA 2RA2A 1X6OA 4M7DD 4DBRA 4AT1B 2NWMA 5FU7B 1OEBA 3I35A 3J81E 2M0YA 3DLLA 2HCKA 4J9BA 4RTUA 3HRTA 2XKOC 2E12A 1KC8U 3LGLA 3CCLA 1P92A 2EQKA 5IT9E 3I56T 2DKGA 3INZA 1S72A 4C8QG 3X24B 3JCMW 1SHFA 5I22A 2RHYA 2KRMA 1NE8A 1KD1C 4MZMA 2JOYA 2L3RA 4A63B 3CCST 2OTLT 1WGSA 4PK4A 1BI2A 4EPCA 3JB9I 5CAIA 3MCAB 1VYVA 1JQQA 3EHQA 1QVGS 4F17A 4RUGA 1VQ4A 1B34B 4RG2A 1WHKA 5GAMg 1WIEA 2LZ6B 3URGA 4IUTA 1HJDA 4DEXA 1KG1A 4F04B 4NOYA 2QDLA 2F5TX 4LE9A 3EGDA 5CVIA 1HYOA 4CI0C 1Z9ZA 3PTAA 1VQ9T 1G8XA 2RJEA 2HD0A 3G6EQ 4PL6A 1YI2T 2MI6A 4RG8A 4PJJA 2MPXC 4PJMA 3QXEB 1QWEA 2DMOA 3MEUA 4M75G 4IUVA 5FWCA 5KYXB 5GAOl 2JJ9A 3OMGA 1GCQC 3WVDB 4PJNA 4M77B 4J6YA 3JCMe 4EMKA 2X51A 1M2OA 4B9XA 2R5MA 1I5OB 3CCMT 2W0ZA 1YHQA 5D7UA 2H3JA 2EJ9A 2H8HA 4PJLA 4QVDA 5CQYA 1R8OB 2QASA 2PUKB 4WCIA 4MDXA 2K7AA 1K4US 3ME9A 4C5HA 4XTZA 5LJ5f 1ZUUA 4A4KA 1G3SA 2X9HA 3WVEB 1WHLA 4X9DA 2CKKA 1VQMA 1K8AC 3CC2A 1QCFA 1VQ8T 3CEYA 2MOXA 1MMGA 2PTKA 1Y57A 3QJ6A 5GAN7 2IG0A 2MMPA 4C8QE 3QWXX 4FT4A 1JXOA 2CP3A 4EMKC 2FG0A 3CMET 3H6ZA 4N0AC 1NBEB 3OYYA 4O6JA 1SKUB 2ZPBB 2COYA 4HCZA 3FEOA 3I5RA 2CDTA 1YIJA 3KXTA 3VU3C 1UGSB 1D3BA 4JRPA 1VQ6A 4R0KA 1TSFA 4CC3A 2CUDA 1J3TA 1YP5A 2GF7A 2JS0A 3LH5A 5LJ5h 1KQSS 2FRWA 3PFSA 3UA7A 2RHUA 4C92C 1GCPA 1RI0A 1CSKA 3UWNA 1VQKA 1KD1U 4BY6B 3PIPA 2EGCA 3GPLA 1Q95G 5GANj 4M7AA 5KYYA 4E7IA 4E47A 2A28A 2E64A 3X20B 1D0ZA 4HKEA 3VS1A 5KYUA 1WJQA 4C92F 2LX9A 4HVVA 4M77D 3RKWA 2VYTA 2E1HA 4F7UB 1YN8A 1PKSA 4ATOA 4M75E 4PFPA 2DM1A 5AT1B 1IO6A 4JUVA 1VQOA 2DETA 3PIOA 2E5KA 2GBQA 1LCKA 4GY5A 4KT0E 1QP2A 4A4HA 3JCMJ 1Q82C 2WSCE 1M1KC 3VRYA 2NUTB 3JB9G 1M1GA 2O4XA 3CCSA 2B86A 2K3BA 1I5LA 3T9NA 4OMFB 4D8DA 3SD4A 1RLPC 2CSQA 4Z02A 3G4SQ 1Z9QA 1AZGB 6AT1B 4M7AC 3EG2A 2EKHA 2JS2A 3JAME 2AHJB 2DRKA 3CCJQ 1AD5A 1FWZA 1AT1B 3BW1A 2RQTA 4E7JA 4OB3B 4QKUA 4X9CA 1FMVA 1IXDA 2ED1A 4M7AF 2JTEA 3ER0A 2EGAA 5A0LA 3EFSA 1YJ9T 4LDYA 1M8MA 1VQ9A 4OMLA 2EYQA 3RUXA 3VS6A 3JCMd 2DXUA 3C4SA 4WTOB 4JZ4A 1YI2A 3OYEA 3QYHB 3RR6A 3LYIA 5IXBA 1TTHB 2DLPA 5GAMh 3PNWC 4J9IA 3E9GA 5CR2A 3HL8A 2A3LA 1IB8A 1OPLA 5GAMe 1K8AU 2YUOA 3M58A 1RAIB 5IH2A 2DEQA 4M78C 1W6XA 4LUDA 1YCSB 1OYXA 1FXXA 1C0MA 1OPKA 2EQUA 1XNIA 2QA4T 4LDUA 3MHXA 1NJIC 1Q7YR 1MNDA 5CKBA 4AFSC 1KJWA 2XHCA 5GANf 2OTJT 1R0CB 2XU8A 3MPUB 2HZYA 3M56A 4M78F 3CQTA 1N5ZA 2EQMA 1PD1A 1QCOA 2VKNA 2AKLA 5GMKj 1AVZC 1PCXA 5IXFA 4M7DF 3CMAQ 2ZZDA 2DYIA 2M51A 4X1VA 2KQWA 4L59A 1X01A 3SFMA 4DQ2A 2P0QA 5DLOA 1MMAA 1VYTA 4LUEA 3CXCA 2LX7A 3V8KA 1YWPA 1WX6A 2GFAA 5LJ3g 3L2ZA 3VS4A 1OZ3A 1K9AA 1VYUA 4QQGA 4JS5A 2AZSA 2E70A 2XDDA 2VWFA 5GANh 1XQHA 3SWNB 4BUGA 1Q86R 3MEAA 1Q82U 2YRCA 4JPBW 3SEMA 1MGQA 1M1KU 2MWPA 4DBQA 2DZCA 3EG1A 1LPLA 4RKUE 2XI9A 2Z0WA 1S1NA 5GAN2 4HCBA 1K76A 2LDMA 4OMQA 1VQ8Q 2ROTA 3EFRA 4ELZC 3JCMX 1VQ5Q 2BZ8A 4PNOA 2HL5C 1H8KA 1AWOA 5I2SA 4GBQA 4XK8E 2LTOA 5KE2A 4E2FB 3QG1A 1QW1A 4FSXA 2CP5A 1N27A 2DJZA 2KYMA 1WYXA 1BCOA 2DVEA 1AWJA 5CIUA 3NGPA 4J6WA 4XTVA 3VKIA 1F1BB 3CCQQ 3G6ET 2E3IA 1IGUA 2F69A 1H3ZA 3PGGA 2K5FA 2X4XA 1BK2A 4DA4A 2R5AA 4HCKA 2BKDN 2O9VA 4XAXB 1OQKA 2RQRA 3RNJA 3OMCA 3V7SA 3UF4A 3VS0A 4BI4A 1QLYA 1UGQB 2O88A 1WJRA 1RLQC 3AT1B 4OGCA 1M3AA 1YJ9A 2DXCA 3CCUQ 2EAYA 2DL5A 1MMNA 2J7IA 5GAMd 2RD1A 3NMZC 5KCHA 5KYUB 1NJIU 3KUFA 2HQXA 1TUDA 1TWBA 4C8QB 1WFWA 1D1CA 2FB7A 4A4FA 1WZOA 1K73C 5KYWA 1MUZA 1YFNA 2RB6A 1WXUA 2CSIA 2RNAA 4J9DA 5LL6S 3A5ZB 3EFOB 4C0DC 2DIQA 3VS7A 2L8DA 4Y91A 4RMOA 2BE9B 2QA4A 2NUZA 1N8RC 3M9QA 3EH1A 5GMKh 2E3HA 4FL6A 4OVAA 2JXBA 3G7ZA 1UFFA 1VQNA 2E4HA 1E6HA 5GAOq 1T3SA 5CQXA 4N4IA 3CCVQ 3OS1A 1FX7A 2YXYA 1RABB 4OB1B 3A98A 4O5VA 5A2QE 5FU6B 2K6DA 3O8VA 3JB9J 3HPWA 4IUPA 4A4EA 5LJ3f 3TVTA 1X2KA 1I4K1 2WACA 4ZN1A 1PKTA 2GNCA 2HEQA 1ARKA 2IVWA 4M75B 1WI7A 3FDRA 3IQLA 1VQ7T 3CCEQ 1QVPA 4LNPA 1W2BA 4IIMA 2YT6A 4FT2A 1NEGA 3EGXA 2MF2A 2X4YA 1O9SA 1JXMA 2ZPFB 1RUWA 5LJ5g 2SRCA 5C0MA 1NLOC 4LD6A 5I2MA 2QTXA 4N4GA 1WNLA 3E2UA 3VS5A 2DXBA 4JRQA 5CCAA 2P84A 2QK0A 1VQPQ 1KQ2A 1VQLT 1NM7A 3H8ZA 2LNHB 4AMCA 1RAHB 4C0GA 3V7CA 5DLQE 2X4WA 1YITQ 2KRSA 2MK5A 3OYGA 4XTUA 3G4ST 5LJ3h 4XU2A 2LRQA 2DL3A 2KI7A 2P0KA 1Y71A 1NPRA 2K79A 1EIFA 2YUNA 3CCJT 3WXMB 3LLRA 1KHIA 3L2RA 2PZ1A 4E7LA 1E6GA 3HSBA 2I2LA 5FRMA 3EG0A 4BI8B 2D0QB 3F70A 1BCMA 1RAAB 1M1FA 2EYWA 4M7AG 1SHGA 3VUZA 2JM8A 2CUBA 2KEAA 3GNFB 2QI2A 3VV0A 2DL7A 2DA9A 2AZVA 3MP6A 3V8LA 3FC3A 9ATCB 2ROLA 1K73U 1M2VA 3CXCP 2DBMA 2JMAA 4RTTA 2ZPIB 4M75D 3CD6Q 2YRVA 1WHGA 4PLIA 2LJ1A 3AHUA 2DJQA 2KT1A 1GCQA 2LJ3A 2GCXA 2GFUA 5CKFA 1EZZB 1N8RU 2C0OA 2VB6A 3OYBA 3QUIA 1ZSZB 1X6BA 1K9MR 1WXTA 3OQ5A 2YHTA 3L1AA 1PNJA 2EQJA 4C92E 3PMIA 1TU0B 2FZCB 2ZPEB 3CMAT 4QT7A 4PJOA 5I21A 5GAOp 1UGRB 4JRKA 2QG9B 2CS7A 2KRNA 3I9QA 4KBMB 3MKDA 4C5GA 1SRMA 1ZA1B 3QKJA 3Q1JA 4PFZA 2O31A 1CKBA 4LDWA 4N0AA 2LP5A 2BTTA 3CCLQ 2NUPB 2DZ9A 1VIFA 3S3MA 3X25B 3CPWS 2NYSA 1KQ1A 4AG1C 3FJ5A 1ZSGA 4ORZA 1ZQ1A 5HK0A 4M7AE 1M5Q1 4RTYA 1KFZA 4PJOC 2CZ7B 1QKXA 5FLXE 2DTHA 4C92A 1VQ4Q 3EG3A 5GANg 1VQ5T 2EYXA 1D1BA 1JO8A 1ZHIA 1RAFB 1QVFP 3META 2KXDA 4PJOF 1QCNA 2DD4A 2RMOA 2V8KA 2AIRB 1Y96A 5LJ3d 2FVUA 1H92A 2WSEE 1R0BG 2J05A 3QJYA 2BE7D 3PMTA 2LNVA 3CCQT 1RL2A 3A8MB 1QKWA 7AT1B 4IUQA 1I81A 3M59A 3JB9D 3QSUA 3OBYA 3G4SA 1PM3A 1LVKA 1W70A 3SWNC 2DTOA 2ATCB 2ZGWA 4M78E 3CCJA 3L2WA 4OMOA 3NHNA 5LJ5e 5GMKm 3E1SA 5GAN3 1SEMA 2O01E 1VQ7Q 2DEUA 3JCMQ 1N9SA 2K3XA 2K2VA 4P5NA 2DFUA 4AFUC 4OB2B 1H3HA 4XU0A 3CCUT 1Q7YC 2QAZA 3P8HA 5GAN8 2JVVA 1W4SA 5M9OA 4M7DE 1OU8A 2KAFA 2XG8D 2DYBA 4NL3A 4R55A 1RACB 2I0NA 3I56A 2K4YA 4J7IA 1UGVA 1G3YA 1JEGA 1W2BP 1PD0A 1VQLQ 2P4RA 1WDXA 1GFCA 2LJ0A 1G3WA 3CPWA 2OTLA 1B07A 2JTMA 1UGPB 3GBQA 1SG5A 2CYZB 3CXCS 2DVJA 3GOXA 2G3RA 1EFNA 1ZLMA 3TCJA 3CCRQ 1BB9A 4M78A 2RPNA 1YIJQ 2XDBA 1WXBA 3BY7A 2HL3A 2KT8A 2EJGA 3CCVT 1NLPC 2CP7A 4J83A 3M0TA 2CGHA 4HVUA 5CKHA 2RJFA 3UA6A 3RESA 1Q86C 1BBZA 4KGZB 4HCCA 1QP3A 2MWOA 4M7DA 1WQ7A 5FW9A 1WLPB 2AKKA 2HSEB 1VQKQ 3VYHB 2CP2A 2V1QA 3CCET 2LQWA 5GMKi 2O9SA 3REBB 2QGGA 1Y07A 4CC4B 3EHRA 3HKSA 3G71Q 3CCMA 4QVCA 2P0PA 2J06A 2DX1A 3VS2A 1PWTA 2YUQA 1VQOQ 3PE0A 4MMKA 4Q5WA 5J26A 4KH1B 1A0NB 4BE2A 4FIBA 1YJNQ 1D0XA 1VQPT 2BZXA 2DF6A 1G83A 3L2UA 3NTIA 3X28B 4OMPA 4B9WA 2XD0A 4QQ6A 4AFZC 2KROA 1UHFA 4KUDK 4M7DC 3QHSA 1CKAA 3RERA 1TXQA 1YITT 2E6ZA 1VQ8A 3M0PA 2DD5A 3EGDB 1FMKA 4N4HA 3QPHA 2WSFE 4FYXB 3O5ZA 4QQDA 2KXCA 1G5VA 5FWBA 4DOWA 1G3TA 4V2SA 2EPDA 2W10A 1WPYA 4Z88A 5A0GA 2VVKA 1ZA2B 2QXFA 1YNZA 4F16A 3CMEA 2RHZA 2D8HA 1GRIA 4J9GA 3R6NA 3UATA 2F2VA 4JJNK 1Q81R 3U23A 1YCYA 4DBHA 1QVFS 2HQHA 5C6SA 2YRDA 4C0ZA 5LJ5d 1Q7YU 4ANJA 2EIFA 1IGQA 2KR3A 3BFMA 2KVQG 3CCQA 3H41A 4HVWA 4EMKB 2DERA 3RKYA 4CC2A 2ABLA 3UT1A 4NS5A 2V8IA 2JTFA 5A0DA 2X4JA 5GANe 3MJXA 1VUBA 3RBBB 3TREA 3M0UA 1H641 3SHWA 4RTVA 3QYGB 2HSPA 1X6GA 2RI5A 2RN8A 3CPFA 4J8OA 3CD6T 2HBPA 3D7SB 4JJCA 4JLIA 2GQIA 2A37A 1UHCA 2M1HA 2QEXQ 3JSCA 1AOJA 3LWHA 2EYYA 1UEBA 2J6OA 3HRUA 1LOJA 4KGVB 2V26A 2JZ2A 1AEYA 1IZ6A 5AYFA 3DLMA 1B34A 2EKOA 1Q86U 4XTWA 3M0RA 3M55A 4IIOA 3CBOA 3FJPA 5FU7C 3HFOA 1W2BS 2CH4A 2VXFA 2ED0A 1T3LA 2RQUA 2XK0A 2DXTA 1UDLA 4QVZA 1D3BB 1BYMA 5EC7A 3JCMV 1MV3A 4NL2A 3NPFA 1VIEA 2G6FX 4LD9K 2LQ8A 1UJ0A 4A4GA 2EFIA 1TUCA 4X34A 3JB9H 4M7AB 1OX9A 3M53A 3NFCA 4E7SA 5KYYB 2F5KA 4PLLA 3RKXA 3CCLT 1XJWB 2L2PA 5KYXA 4ZNXA 2YLCA 5IHKA 1M3BA 3C0CA 3JCMb 3J7AF 4M77A 4RTXA 5L23A 4ZGEB 1QVFA 2FZGB 4EIKA 1M30A 5J39A 2PQWA 1GBQA 3CCEA 1NYGA 2GQVA 4OGEA 1KSWA 2KGTA 4RCBA 2JNGA 2JUFA 1M90R 1VQ4T 2COWA 2HBWA 5CKEA 1N9RA 1NPPA 4BI3A 1KHCA 2O4XB 1O75A 1RAGB 3OW2A 1NG2A 1BI1A 4KULA 2AK5A 3H9NA 2L3SA 4PJOG 1VQPA 2OTJA 1HSQA 1SF9A 2VGMA 2GTOA 4A54A 1B7TA 2KSSA 1OZ2A 2VV5A 5GMKe 3A8GB 3CPWP 1U5SA 2QQAA 2CT4A 4M77C 3QWYA 3MEVA 2VXEA 5DM7R 3UPUA 4ESRA 4J9HA 3LWIA 4GLMA 4M77F 1U3OA 2RJCA 3M57A 1MNEA 1JJ2S 1WJSA 3MP8A 2D1XA 2YDLA 5HCKA 5GANd 3TU4K 3LX7A 4MZTA 1QWFA 3EGUA 5GJWB 3A8HB 4TVRA 2D8JA 3EAEA 3TSZA 2MCNA 5GMKl 5IHIA 2IIMA 3RMSA 4C92G 1K9MC 3TSWA 3P8DA 1W1FA 4XTYA 1JB0E 4LDXA 2A0FB 4L6V5 3CC2T 3FIFA 2OAUA 4F7UA 2GGRA 3I55Q 3R6OA 1Y7XA 2JM9A 1D09B 2KYBA 4C8QD 1UG1A 1X75C 4BB7A 4BE0A 4BDYA 5FROA 4ZGDB 1B3QA 2X3WD 1OX8A 2JN0A 4QW2A 3CC7Q 2ESWA 3ZL7C 5LJ3e 2J6KA 2NUTA 3CCRT 1OULA 3THKA 3VYGA 1YIJT 1KC8R 3MO8A 1WHMA 1RAEB 2H3EB 4CRIA 2ZAEA 2MYSA 3M0QA 4BY6C 1YJWQ 2YSQA 1GL5A 3HTRA 2COZA 4FYVB 1SPKA 4FM4B 3G6EA 3OYAA 5IAYA 4EMGA 3KBGA 4PJOE 5FRNA 1GXIE 1VQKT 3TQ7P 4BDZA 1ABOA 3A8OB 2E65A 1X43A 2FHDA 2FPEA 1SSFA 2DILA 2A08A 4F7UF 1PRLC 4C0FA 3QDFA 3QDRB 2DTIA 2OJ2A 3OYHA 3G71T 3G1JA 2EGEA 3M0SA 2DNUA 1YBYA 4E6RA 1VQOT 2EWNA 4HA8A 4MZPA 2PNIA 2MIOA 3OSSC 5GAN4 1JJ2A 4B6MA 1YJNT 5DY9A 2HNIA 1MHNA 4FCYA 2OAWA 3OYDA 3BE3A 1V76A 2BZYA 4KUIA 4RCCA 1AZEA 4J9FA 3OS5A 1JRIA 1PG5B 1Y0MA 3JCMf 4M78G 1X69A 3OYJA 2LMJA 5KH6A 3CC4Q 1U06A 1E7OA 2OX7A 5D6WA 1AWXA 1QQJA 4KH0B 4OB0B 3EG9A 2SEMA 3FB9A 2LCLA 4J5YA 2LQNA 3JV3A 2ZPGB 2MAMA 3OBWA 2EQIA 4M7DG 4A53A 2YWWA 1BI3A 5CK9A 5HK3A 4FU6A 3VUBA 4C0DB 2YLBA 1OI1A 3GLXA 2E5QA 3P8BB 2LCSA 2RI3A 1WHJA 3M4GA 4L5GA 2M9UA 2BUDA 1C6VX 3A1PA 1K9MU 1HXDA 3OYCA 4Z89A 2HKNA 1S72Q 3SDZA 1TUGB 3C94A 3JCMh 1IHVA 3L2QA 2QTVA 1KK7A 3OYIA 1VQ7A 2AT1B 2QGFB 4D8KA 5GAMj 3S3OA 1ZBJA 3SWNA 5KYWB 4E7KA 4DBFA 1I07A 4XU1A 2QEXT 1M4ZA 2A36A 2O2OA 1I8FA 2RJDA 3QO3A 1C1AA 2ZCFB 2DL8A 4JJDA 5KCOA 2KMTA 4Y92A 1VQLA 4OP0A 2R58A 2QQ9A 3OS2A 1KD1R 3EH2A 3JRZA 4ZN3A 2B8AA 2L3QA 3LH0A 3REAB 2DPPB 2L3PA 8AT1B 3OW2P 3RMQA 2EYZA 4MMLA 3A8LB 2DRMA 1PRMC 3OA6A 3CCRA 2R57A 5EG2A 2FL7A 2OI3A 1QVGA 3QZ9B 4FYWB 2EW3A 3DB3A 3DB4A 3N5BB 1YHQQ 3M5AA 3HFNA 2K9GA 2NLUA 2CZ0B 3ASKA 4VUBA 5D6XA 2FO0A 3EGXB 2BIVA 1VOMA 3ZBDA 1YWOA 2QQRA 4XQ3A 1UJYA 1K0SA 3H0HA 1VQMQ 3CC2Q 1KIKA 2XIDA 1G2BA 1HD3A 1WHHA 3OS0A 3G71A 2FEIA 2V1RA 1T0JA 4C8QA 4FYYB 1Q81C 1R77A 2RQWA 3BDUA 1D0YA 3L42A 2F2WA 3V8JA 3J80E 4UC4A 1YJNA 1EX4A 1XOVA 2JMCA 1RI9A 2DK3A 3EFOA 2FYKA 3QZ5B 5GAMf 1N6AA 2IPOB 2PVDB 2V8JA 1DJ7B 4EMHA 1X27A 4YTLA 1VQ6Q 2RM4A 2JW4A 4J7FA 3OYMA 1ZX6A 1AWWA 1K8AR 4J9EA 2CP0A 4E7ZA 3MEWA 1PSEA 3X26B 2PU9B 2RH2A 3CMAA 1NZ9A 3C95A 2Y4YA 4IURA 4IKFA 2K57A 5IN1A 2F2XA 2D6FA 4M77G 1OOTA 1FMWA 4C8QC 4ZGJB 4JS4A 3S6WA 2M16A 1WQWA 4FW1A 4JDSA 1LJOA 2KY9A 1M2VB 2X35A 3LW5E 2VASA 1M27C 1UUEA 4AG2C 5HKCA 4M75A 4C8QF 3ZFJA 4XU3A 2LQKA 3I56Q 2HKQB 2RHIA 4E7HA 5D6YA 3C12A 2DO3A 3I55T 3CCSQ 4C5IA 2OTLQ 1KQSA 4HT9A 2ENMA 2LCCA 1ABQA 4CC7A 1ACMB 2RQVA 4MDWA 2ZPHB 3M4YA 4RTZA 1BIBA 3CC7T 1JJ2P 4Z8AA 2QEXA 1VQ5A 1SRLA 4J6XA 3EG9B 5FU6C 1AHJB 1IRXA 4KRTA 3I5SA 1VQNT 2VC8A 1RADB 4J9CA 2Y4XA 2QDYB 4PJOB 3OSVA 1YJWT 4M75C 3FLGA 1JU5C 4FSSA 4F14A 2CH4W 2D0NA 2HMAA 1Q82R 1M1KR 2C0TA 1VQ9Q 5GAOm 5CO7A 2QQSA 3JCMc 4AFQC 2XMFA 1YI2Q 2CT3A 4PFOA 4M75F 2E6NA 1TOVA 4ZTFA 3PT9A 5GJVB 5KE3A 1M90C 3OW2S 2KBTA 2RI2A 4II1A 2HDAA 4BD3A 1M3CA 2FPDA 3CCMQ 4F7UG 2K3YA 1T0HA 3CCUA 2RHXA 2C06A 5J3BA 1Q81U 4ELYC 4C92B 5KYNA 3KFVA 4M77E 1GFDA 2PUOB 4RTWA 2P4TA 1OV3A 3LGFA 4D6WA 2GTJA 3OYNA 3VS3A 3JCMP 3CC4T 3H0FA 2KNBB 1BIAA 1Y96B 4K11A 2L5QA 4XTXA 1ZSZA 2CZ6B 4JJBA 1BKBA 2LT4A 1UB4A 3CMEQ 1TH7A 5LJ3j 1JBMA 2L0AA 1I1JA 5GAN5 4ME7A 1NJIR 1UE9A 2K2MA 2M02A 3OB9A 1PSFA 4PKCC 4OMMA 1GBRA 5GAOr 3HRSA 4PJOD 3OYFA 2C0IA 3CCVA 1TG0A 2PVOB 4IUUA 2X3XD 3NTHA 2E10A 4M4ZA 5GAN6 2RK2A 3DKMA 1U1SA 1M9SA 2A7YA 1S72T 8ATCB 3CBMA 4R56A 4JRIA 4FW2A 4LXCA 3VJPA 1QVGP 2LT1A 2M0OA 1ZSZC 4ZTJA 2DE0X 4LN2A 2CP6A 2NUPA 1MV0B 2EJFA 1IHWA 1UECA 2K5LA 3SB2A 1KC8C 3FRNA 3QBYA 3L2VA 2J6FA 2HQEA 1ZBXA 2E41A 3JCMg 5CKDA 3CBPA 4BE1A 5ECAA 5L8RE 3JB9F 3ZEHA 3OYKA 4C92D 3PVLA 2D9TA 2YUPA 4F7UE 4M78B 3I55A 1FYNA 2L89A 1ZUKA 2PVGB 1YITA 4WF2A 4DEYA 1BU1A 3CC7A 1UTIA 3MP1A 2LC4A 2CZ1B 2KK4A 1TS9A 2RF0A 1NYFA 1U8RA 1M90U 4M7DB 3UDCA 3GIBA 1QMCA 1YJWA 1WA7A 1YHQT 2KDSA 1YJ9Q 2K5IA 2RO0A 2DAQA 4C5EA 3RDVA 2QQBA 3S3NA 4GLKA 2LVMA 1ZUYA 3VRZA 1D1AA 4JZ3A 3BDLA 3GNGA 4M7AD 1SSHA 1NEBA 3M54A 2JT4A 3HHTB 4JLGA 2FZKB 4OF1A 3H0IA 1IREB 1VQMT 2VGNA 1PHTA 2XICA 3NTKA 1VA7A 4HT8A 1V29B 3E19A 3CD6A 2QYZA 2EBPA 3OYLA 2DBKA 3GF5A 2ECZA 3GP8A 1LNXA 3E9FA 2QA4Q 2EVRA 4OMNA 1HK9A 3PVQA 2OTJQ 3RIRA 3HP9A 1K1ZA 3QIIA 1MMDA 2KE9A 1VQNQ 4Y28E 2XDPA 1KQSP 2DL4A 2FRYA 4HXJA 2CREA 4BACA 2Y90A 3CC4A 1VQ6T 1BI0A 1K0XA 4EDUA 5HY6A 1V1CA 1K73R 4LDVA 3TEEA 3V7RA 4M78D 4KGXB 5IHNA 2RK1A 1XTDA 1X2QA 2FPFA 2VUBA 1PC0A 5I11A 3ULRB 2HAXA 1U1TA 2DIGA 3OY9A 1M8VA 5GAOn
chains in the Genus database with same CATH topology
2DF6A 1G83A 2J7IA 2L3QA 3NMZC 4OMPA 3REAB 2L3PA 4AFZC 2KROA 1UHFA 2EYZA 1I0CA 1TUDA 1CKAA 2NWMA 1OEBA 3I35A 2DRMA 1PRMC 2M0YA 2HCKA 4J9BA 4RTUA 1WFWA 3M0PA 1FMKA 2OI3A 1MUZA 3O5ZA 2KXCA 5FWBA 1WXUA 2CSIA 2EPDA 2RNAA 2W10A 2EW3A 4J9DA 4Z88A 2VVKA 1YNZA 2K9GA 1SHFA 4F16A 2D8HA 5I22A 1GRIA 2KRMA 4J9GA 3VS7A 3R6NA 3UATA 2F2VA 3U23A 2FO0A 4A63B 2NUZA 1YWOA 2KR3A 1VYVA 1JQQA 3H41A 3EHQA 4F17A 2JXBA 4HVWA 1UJYA 1UFFA 4RUGA 4CC2A 2ABLA 1E6HA 1K0SA 3H0HA 1T3SA 1KIKA 1G2BA 1WIEA 1HD3A 2LZ6B 3RBBB 3M0UA 3SHWA 4RTVA 1HJDA 3A98A 2FEIA 4DEXA 2V1RA 1T0JA 2HSPA 2K6DA 1X6GA 2QDLA 4LE9A 2RN8A 3TVTA 2RQWA 1X2KA 1Z9ZA 4JJCA 2F2WA 2JMCA 1PKTA 2HEQA 2GNCA 2GQIA 1XOVA 1RI9A 2A37A 1ARKA 1WI7A 1UHCA 3IQLA 4LNPA 4IIMA 2YT6A 1AOJA 1QWEA 2DMOA 2EYYA 1X27A 2J6OA 1NEGA 2JW4A 5FWCA 1AEYA 1JXMA 1ZX6A 1AWWA 1GCQC 1RUWA 4J9EA 2SRCA 1NLOC 3VS5A 2W0ZA 2F2XA 3M0RA 2H8HA 4IIOA 2CH4A 1NM7A 2ED0A 1T3LA 1OOTA 2RQUA 2LNHB 1UDLA 4WCIA 2K7AA 1K4US 5EC7A 1MV3A 3NPFA 2KRSA 1ZUUA 1M27C 2G6FX 1UUEA 4AG2C 1UJ0A 2DL3A 2K79A 1QCFA 2YUNA 2PZ1A 1TUCA 1E6GA 2MOXA 2PTKA 1Y57A 3EG0A 2L2PA 4ZNXA 3QWXX 5IHKA 1JXOA 1M3BA 3C0CA 2FG0A 4RTXA 2EYWA 2ENMA 5L23A 1SHGA 2JM8A 4EIKA 1ABQA 4CC7A 1M30A 2CUBA 2RQVA 3I5RA 2CDTA 2KEAA 1GBQA 4RTZA 2DL7A 4Z8AA 1NYGA 1SRLA 2DA9A 2AZVA 1KSWA 2KGTA 4KRTA 3I5SA 4R0KA 2HBWA 4CC3A 4J9CA 2ROLA 2CUDA 1J3TA 1YP5A 2JS0A 3LH5A 2DBMA 1NG2A 2JMAA 1JU5C 4FSSA 2FRWA 4RTTA 2CH4W 2D0NA 4F14A 3UA7A 2AK5A 2C0TA 1GCPA 2L3SA 1CSKA 2LJ1A 1HSQA 2DJQA 2KT1A 2EGCA 1GCQA 2LJ3A 2GTOA 4AFQC 2XMFA 2CT3A 2A28A 2C0OA 1U5SA 2CT4A 3VS1A 3QWYA 4HVVA 1X6BA 5GJVB 1WXTA 1YN8A 1PKSA 4ESRA 4J9HA 2KBTA 2DM1A 1IO6A 2HDAA 1M3CA 2E5KA 2FPDA 2GBQA 4GLMA 1LCKA 1PNJA 1U3OA 1T0HA 3VRYA 4QT7A 2D1XA 2YDLA 5HCKA 3KFVA 1QWFA 2B86A 2K3BA 1GFDA 3EGUA 5GJWB 4RTWA 4D8DA 2D8JA 1RLPC 2CSQA 3TSZA 1OV3A 2MCNA 2KRNA 3I9QA 5IHIA 2GTJA 1Z9QA 1AZGB 2IIMA 3VS3A 3EG2A 2EKHA 1SRMA 3H0FA 2JS2A 2KNBB 3TSWA 2DRKA 2O31A 1CKBA 1W1FA 1AD5A 4K11A 2LP5A 2BTTA 2RQTA 2ED1A 2JTEA 4JJBA 2GGRA 2EGAA 2JM9A 2KYBA 1M8MA 4AG1C 1UG1A 2L0AA 3FJ5A 1I1JA 4OMLA 1ZSGA 3VS6A 1UE9A 2K2MA 4ORZA 4JZ4A 1B3QA 2X3WD 4OMMA 2ESWA 3ZL7C 4RTYA 1GBRA 1KFZA 1QKXA 2J6KA 5IXBA 2C0IA 2DLPA 1TG0A 3THKA 3EG3A 4J9IA 2EYXA 1OPLA 1JO8A 2X3XD 3M0QA 4M4ZA 2YUOA 2KXDA 2YSQA 5IH2A 1GL5A 2RMOA 1W6XA 4LUDA 1YCSB 1SPKA 1OPKA 1H92A 2DE0X 4LN2A 2J05A 1MV0B 4AFSC 1KJWA 1ABOA 1UECA 3CQTA 1N5ZA 1QKWA 1X43A 2FPEA 2DILA 2A08A 2J6FA 1PRLC 2VKNA 1W70A 2OJ2A 2AKLA 4OMOA 3NHNA 5ECAA 2EGEA 1AVZC 1SEMA 3M0SA 2DNUA 3PVLA 4E6RA 5IXFA 2YUPA 2PNIA 2M51A 4X1VA 2MIOA 4AFUC 1FYNA 1H3HA 2OAWA 2BZYA 1ZUKA 1AZEA 4J9FA 1Y0MA 1X69A 4DEYA 1BU1A 2LMJA 1UTIA 1VYTA 4LUEA 2DYBA 2LX7A 1YWPA 1U06A 1E7OA 1WX6A 3VS4A 2RF0A 2I0NA 1AWXA 1K9AA 1UGVA 1JEGA 1NYFA 1VYUA 2AZSA 2SEMA 2VWFA 2LQNA 2P4RA 3JV3A 1WDXA 1WA7A 1GFCA 2LJ0A 2EQIA 4JPBW 3SEMA 1B07A 3GBQA 3EG1A 1ZUYA 3VRZA 1S1NA 2DVJA 4JZ3A 1EFNA 1K76A 1ZLMA 4OMQA 1SSHA 1NEBA 2LCSA 1BB9A 2JT4A 2RPNA 2ROTA 1WXBA 2BZ8A 3H0IA 1H8KA 1AWOA 2KT8A 1PHTA 4GBQA 1NLPC 4Z89A 1VA7A 3M0TA 4HVUA 3UA6A 2EBPA 1BBZA 2DBKA 2ECZA 2KYMA 1WYXA 4D8KA 1AWJA 1WLPB 5FW9A 2AKKA 2EVRA 3NGPA 4OMNA 1ZBJA 3PVQA 2V1QA 1K1ZA 2KE9A 2LQWA 1I07A 2A36A 2O2OA 2O9SA 3REBB 2DL4A 2FRYA 4HXJA 1BK2A 4CC4B 2CREA 4HCKA 1K0XA 2O9VA 3EHRA 1V1CA 2DL8A 4JJDA 2J06A 2RQRA 5IHNA 3RNJA 2DX1A 3VS2A 1PWTA 2YUQA 3UF4A 4Y92A 3VS0A 3PE0A 1X2QA 2FPFA 5I11A 1QLYA 2O88A 3ULRB 1RLQC 1A0NB 1M3AA 2BZXA 2DL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DF6 A;  1G83 A;  2J7I A;  2L3Q A;  3NMZ C;  4OMP A;  3REA B;  2L3P A;  4AFZ C;  2KRO A;  1UHF A;  2EYZ A;  1I0C A;  1TUD A;  1CKA A;  2NWM A;  1OEB A;  3I35 A;  2DRM A;  1PRM C;  2M0Y A;  2HCK A;  4J9B A;  4RTU A;  1WFW A;  3M0P A;  1FMK A;  2OI3 A;  1MUZ A;  3O5Z A;  2KXC A;  5FWB A;  1WXU A;  2CSI A;  2EPD A;  2RNA A;  2W10 A;  2EW3 A;  4J9D A;  4Z88 A;  2VVK A;  1YNZ A;  2K9G A;  1SHF A;  4F16 A;  2D8H A;  5I22 A;  1GRI A;  2KRM A;  4J9G A;  3VS7 A;  3R6N A;  3UAT A;  2F2V A;  3U23 A;  2FO0 A;  4A63 B;  2NUZ A;  1YWO A;  2KR3 A;  1VYV A;  1JQQ A;  3H41 A;  3EHQ A;  4F17 A;  2JXB A;  4HVW A;  1UJY A;  1UFF A;  4RUG A;  4CC2 A;  2ABL A;  1E6H A;  1K0S A;  3H0H A;  1T3S A;  1KIK A;  1G2B A;  1WIE A;  1HD3 A;  2LZ6 B;  3RBB B;  3M0U A;  3SHW A;  4RTV A;  1HJD A;  3A98 A;  2FEI A;  4DEX A;  2V1R A;  1T0J A;  2HSP A;  2K6D A;  1X6G A;  2QDL A;  4LE9 A;  2RN8 A;  3TVT A;  2RQW A;  1X2K A;  1Z9Z A;  4JJC A;  2F2W A;  2JMC A;  1PKT A;  2HEQ A;  2GNC A;  2GQI A;  1XOV A;  1RI9 A;  2A37 A;  1ARK A;  1WI7 A;  1UHC A;  3IQL A;  4LNP A;  4IIM A;  2YT6 A;  1AOJ A;  1QWE A;  2DMO A;  2EYY A;  1X27 A;  2J6O A;  1NEG A;  2JW4 A;  5FWC A;  1AEY A;  1JXM A;  1ZX6 A;  1AWW A;  1GCQ C;  1RUW A;  4J9E A;  2SRC A;  1NLO C;  3VS5 A;  2W0Z A;  2F2X A;  3M0R A;  2H8H A;  4IIO A;  2CH4 A;  1NM7 A;  2ED0 A;  1T3L A;  1OOT A;  2RQU A;  2LNH B;  1UDL A;  4WCI A;  2K7A A;  1K4U S;  5EC7 A;  1MV3 A;  3NPF A;  2KRS A;  1ZUU A;  1M27 C;  2G6F X;  1UUE A;  4AG2 C;  1UJ0 A;  2DL3 A;  2K79 A;  1QCF A;  2YUN A;  2PZ1 A;  1TUC A;  1E6G A;  2MOX A;  2PTK A;  1Y57 A;  3EG0 A;  2L2P A;  4ZNX A;  3QWX X;  5IHK A;  1JXO A;  1M3B A;  3C0C A;  2FG0 A;  4RTX A;  2EYW A;  2ENM A;  5L23 A;  1SHG A;  2JM8 A;  4EIK A;  1ABQ A;  4CC7 A;  1M30 A;  2CUB A;  2RQV A;  3I5R A;  2CDT A;  2KEA A;  1GBQ A;  4RTZ A;  2DL7 A;  4Z8A A;  1NYG A;  1SRL A;  2DA9 A;  2AZV A;  1KSW A;  2KGT A;  4KRT A;  3I5S A;  4R0K A;  2HBW A;  4CC3 A;  4J9C A;  2ROL A;  2CUD A;  1J3T A;  1YP5 A;  2JS0 A;  3LH5 A;  2DBM A;  1NG2 A;  2JMA A;  1JU5 C;  4FSS A;  2FRW A;  4RTT A;  2CH4 W;  2D0N A;  4F14 A;  3UA7 A;  2AK5 A;  2C0T A;  1GCP A;  2L3S A;  1CSK A;  2LJ1 A;  1HSQ A;  2DJQ A;  2KT1 A;  2EGC A;  1GCQ A;  2LJ3 A;  2GTO A;  4AFQ C;  2XMF A;  2CT3 A;  2A28 A;  2C0O A;  1U5S A;  2CT4 A;  3VS1 A;  3QWY A;  4HVV A;  1X6B A;  5GJV B;  1WXT A;  1YN8 A;  1PKS A;  4ESR A;  4J9H A;  2KBT A;  2DM1 A;  1IO6 A;  2HDA A;  1M3C A;  2E5K A;  2FPD A;  2GBQ A;  4GLM A;  1LCK A;  1PNJ A;  1U3O A;  1T0H A;  3VRY A;  4QT7 A;  2D1X A;  2YDL A;  5HCK A;  3KFV A;  1QWF A;  2B86 A;  2K3B A;  1GFD A;  3EGU A;  5GJW B;  4RTW A;  4D8D A;  2D8J A;  1RLP C;  2CSQ A;  3TSZ A;  1OV3 A;  2MCN A;  2KRN A;  3I9Q A;  5IHI A;  2GTJ A;  1Z9Q A;  1AZG B;  2IIM A;  3VS3 A;  3EG2 A;  2EKH A;  1SRM A;  3H0F A;  2JS2 A;  2KNB B;  3TSW A;  2DRK A;  2O31 A;  1CKB A;  1W1F A;  1AD5 A;  4K11 A;  2LP5 A;  2BTT A;  2RQT A;  2ED1 A;  2JTE A;  4JJB A;  2GGR A;  2EGA A;  2JM9 A;  2KYB A;  1M8M A;  4AG1 C;  1UG1 A;  2L0A A;  3FJ5 A;  1I1J A;  4OML A;  1ZSG A;  3VS6 A;  1UE9 A;  2K2M A;  4ORZ A;  4JZ4 A;  1B3Q A;  2X3W D;  4OMM A;  2ESW A;  3ZL7 C;  4RTY A;  1GBR A;  1KFZ A;  1QKX A;  2J6K A;  5IXB A;  2C0I A;  2DLP A;  1TG0 A;  3THK A;  3EG3 A;  4J9I A;  2EYX A;  1OPL A;  1JO8 A;  2X3X D;  3M0Q A;  4M4Z A;  2YUO A;  2KXD A;  2YSQ A;  5IH2 A;  1GL5 A;  2RMO A;  1W6X A;  4LUD A;  1YCS B;  1SPK A;  1OPK A;  1H92 A;  2DE0 X;  4LN2 A;  2J05 A;  1MV0 B;  4AFS C;  1KJW A;  1ABO A;  1UEC A;  3CQT A;  1N5Z A;  1QKW A;  1X43 A;  2FPE A;  2DIL A;  2A08 A;  2J6F A;  1PRL C;  2VKN A;  1W70 A;  2OJ2 A;  2AKL A;  4OMO A;  3NHN A;  5ECA A;  2EGE A;  1AVZ C;  1SEM A;  3M0S A;  2DNU A;  3PVL A;  4E6R A;  5IXF A;  2YUP A;  2PNI A;  2M51 A;  4X1V A;  2MIO A;  4AFU C;  1FYN A;  1H3H A;  2OAW A;  2BZY A;  1ZUK A;  1AZE A;  4J9F A;  1Y0M A;  1X69 A;  4DEY A;  1BU1 A;  2LMJ A;  1UTI A;  1VYT A;  4LUE A;  2DYB A;  2LX7 A;  1YWP A;  1U06 A;  1E7O A;  1WX6 A;  3VS4 A;  2RF0 A;  2I0N A;  1AWX A;  1K9A A;  1UGV A;  1JEG A;  1NYF A;  1VYU A;  2AZS A;  2SEM A;  2VWF A;  2LQN A;  2P4R A;  3JV3 A;  1WDX A;  1WA7 A;  1GFC A;  2LJ0 A;  2EQI A;  4JPB W;  3SEM A;  1B07 A;  3GBQ A;  3EG1 A;  1ZUY A;  3VRZ A;  1S1N A;  2DVJ A;  4JZ3 A;  1EFN A;  1K76 A;  1ZLM A;  4OMQ A;  1SSH A;  1NEB A;  2LCS A;  1BB9 A;  2JT4 A;  2RPN A;  2ROT A;  1WXB A;  2BZ8 A;  3H0I A;  1H8K A;  1AWO A;  2KT8 A;  1PHT A;  4GBQ A;  1NLP C;  4Z89 A;  1VA7 A;  3M0T A;  4HVU A;  3UA6 A;  2EBP A;  1BBZ A;  2DBK A;  2ECZ A;  2KYM A;  1WYX A;  4D8K A;  1AWJ A;  1WLP B;  5FW9 A;  2AKK A;  2EVR A;  3NGP A;  4OMN A;  1ZBJ A;  3PVQ A;  2V1Q A;  1K1Z A;  2KE9 A;  2LQW A;  1I07 A;  2A36 A;  2O2O A;  2O9S A;  3REB B;  2DL4 A;  2FRY A;  4HXJ A;  1BK2 A;  4CC4 B;  2CRE A;  4HCK A;  1K0X A;  2O9V A;  3EHR A;  1V1C A;  2DL8 A;  4JJD A;  2J06 A;  2RQR A;  5IHN A;  3RNJ A;  2DX1 A;  3VS2 A;  1PWT A;  2YUQ A;  3UF4 A;  4Y92 A;  3VS0 A;  3PE0 A;  1X2Q A;  2FPF A;  5I11 A;  1QLY A;  2O88 A;  3ULR B;  1RLQ C;  1A0N B;  1M3A A;  2BZX A;  2DL5 A; 
#chains in the Genus database with same CATH topology
 2F1L A;  4DOV A;  5LJ5 j;  1N8R R;  1OU9 A;  1I0C A;  2RA2 A;  1X6O A;  4M7D D;  4DBR A;  4AT1 B;  2NWM A;  5FU7 B;  1OEB A;  3I35 A;  3J81 E;  2M0Y A;  3DLL A;  2HCK A;  4J9B A;  4RTU A;  3HRT A;  2XKO C;  2E12 A;  1KC8 U;  3LGL A;  3CCL A;  1P92 A;  2EQK A;  5IT9 E;  3I56 T;  2DKG A;  3INZ A;  1S72 A;  4C8Q G;  3X24 B;  3JCM W;  1SHF A;  5I22 A;  2RHY A;  2KRM A;  1NE8 A;  1KD1 C;  4MZM A;  2JOY A;  2L3R A;  4A63 B;  3CCS T;  2OTL T;  1WGS A;  4PK4 A;  1BI2 A;  4EPC A;  3JB9 I;  5CAI A;  3MCA B;  1VYV A;  1JQQ A;  3EHQ A;  1QVG S;  4F17 A;  4RUG A;  1VQ4 A;  1B34 B;  4RG2 A;  1WHK A;  5GAM g;  1WIE A;  2LZ6 B;  3URG A;  4IUT A;  1HJD A;  4DEX A;  1KG1 A;  4F04 B;  4NOY A;  2QDL A;  2F5T X;  4LE9 A;  3EGD A;  5CVI A;  1HYO A;  4CI0 C;  1Z9Z A;  3PTA A;  1VQ9 T;  1G8X A;  2RJE A;  2HD0 A;  3G6E Q;  4PL6 A;  1YI2 T;  2MI6 A;  4RG8 A;  4PJJ A;  2MPX C;  4PJM A;  3QXE B;  1QWE A;  2DMO A;  3MEU A;  4M75 G;  4IUV A;  5FWC A;  5KYX B;  5GAO l;  2JJ9 A;  3OMG A;  1GCQ C;  3WVD B;  4PJN A;  4M77 B;  4J6Y A;  3JCM e;  4EMK A;  2X51 A;  1M2O A;  4B9X A;  2R5M A;  1I5O B;  3CCM T;  2W0Z A;  1YHQ A;  5D7U A;  2H3J A;  2EJ9 A;  2H8H A;  4PJL A;  4QVD A;  5CQY A;  1R8O B;  2QAS A;  2PUK B;  4WCI A;  4MDX A;  2K7A A;  1K4U S;  3ME9 A;  4C5H A;  4XTZ A;  5LJ5 f;  1ZUU A;  4A4K A;  1G3S A;  2X9H A;  3WVE B;  1WHL A;  4X9D A;  2CKK A;  1VQM A;  1K8A C;  3CC2 A;  1QCF A;  1VQ8 T;  3CEY A;  2MOX A;  1MMG A;  2PTK A;  1Y57 A;  3QJ6 A;  5GAN 7;  2IG0 A;  2MMP A;  4C8Q E;  3QWX X;  4FT4 A;  1JXO A;  2CP3 A;  4EMK C;  2FG0 A;  3CME T;  3H6Z A;  4N0A C;  1NBE B;  3OYY A;  4O6J A;  1SKU B;  2ZPB B;  2COY A;  4HCZ A;  3FEO A;  3I5R A;  2CDT A;  1YIJ A;  3KXT A;  3VU3 C;  1UGS B;  1D3B A;  4JRP A;  1VQ6 A;  4R0K A;  1TSF A;  4CC3 A;  2CUD A;  1J3T A;  1YP5 A;  2GF7 A;  2JS0 A;  3LH5 A;  5LJ5 h;  1KQS S;  2FRW A;  3PFS A;  3UA7 A;  2RHU A;  4C92 C;  1GCP A;  1RI0 A;  1CSK A;  3UWN A;  1VQK A;  1KD1 U;  4BY6 B;  3PIP A;  2EGC A;  3GPL A;  1Q95 G;  5GAN j;  4M7A A;  5KYY A;  4E7I A;  4E47 A;  2A28 A;  2E64 A;  3X20 B;  1D0Z A;  4HKE A;  3VS1 A;  5KYU A;  1WJQ A;  4C92 F;  2LX9 A;  4HVV A;  4M77 D;  3RKW A;  2VYT A;  2E1H A;  4F7U B;  1YN8 A;  1PKS A;  4ATO A;  4M75 E;  4PFP A;  2DM1 A;  5AT1 B;  1IO6 A;  4JUV A;  1VQO A;  2DET A;  3PIO A;  2E5K A;  2GBQ A;  1LCK A;  4GY5 A;  4KT0 E;  1QP2 A;  4A4H A;  3JCM J;  1Q82 C;  2WSC E;  1M1K C;  3VRY A;  2NUT B;  3JB9 G;  1M1G A;  2O4X A;  3CCS A;  2B86 A;  2K3B A;  1I5L A;  3T9N A;  4OMF B;  4D8D A;  3SD4 A;  1RLP C;  2CSQ A;  4Z02 A;  3G4S Q;  1Z9Q A;  1AZG B;  6AT1 B;  4M7A C;  3EG2 A;  2EKH A;  2JS2 A;  3JAM E;  2AHJ B;  2DRK A;  3CCJ Q;  1AD5 A;  1FWZ A;  1AT1 B;  3BW1 A;  2RQT A;  4E7J A;  4OB3 B;  4QKU A;  4X9C A;  1FMV A;  1IXD A;  2ED1 A;  4M7A F;  2JTE A;  3ER0 A;  2EGA A;  5A0L A;  3EFS A;  1YJ9 T;  4LDY A;  1M8M A;  1VQ9 A;  4OML A;  2EYQ A;  3RUX A;  3VS6 A;  3JCM d;  2DXU A;  3C4S A;  4WTO B;  4JZ4 A;  1YI2 A;  3OYE A;  3QYH B;  3RR6 A;  3LYI A;  5IXB A;  1TTH B;  2DLP A;  5GAM h;  3PNW C;  4J9I A;  3E9G A;  5CR2 A;  3HL8 A;  2A3L A;  1IB8 A;  1OPL A;  5GAM e;  1K8A U;  2YUO A;  3M58 A;  1RAI B;  5IH2 A;  2DEQ A;  4M78 C;  1W6X A;  4LUD A;  1YCS B;  1OYX A;  1FXX A;  1C0M A;  1OPK A;  2EQU A;  1XNI A;  2QA4 T;  4LDU A;  3MHX A;  1NJI C;  1Q7Y R;  1MND A;  5CKB A;  4AFS C;  1KJW A;  2XHC A;  5GAN f;  2OTJ T;  1R0C B;  2XU8 A;  3MPU B;  2HZY A;  3M56 A;  4M78 F;  3CQT A;  1N5Z A;  2EQM A;  1PD1 A;  1QCO A;  2VKN A;  2AKL A;  5GMK j;  1AVZ C;  1PCX A;  5IXF A;  4M7D F;  3CMA Q;  2ZZD A;  2DYI A;  2M51 A;  4X1V A;  2KQW A;  4L59 A;  1X01 A;  3SFM A;  4DQ2 A;  2P0Q A;  5DLO A;  1MMA A;  1VYT A;  4LUE A;  3CXC A;  2LX7 A;  3V8K A;  1YWP A;  1WX6 A;  2GFA A;  5LJ3 g;  3L2Z A;  3VS4 A;  1OZ3 A;  1K9A A;  1VYU A;  4QQG A;  4JS5 A;  2AZS A;  2E70 A;  2XDD A;  2VWF A;  5GAN h;  1XQH A;  3SWN B;  4BUG A;  1Q86 R;  3MEA A;  1Q82 U;  2YRC A;  4JPB W;  3SEM A;  1MGQ A;  1M1K U;  2MWP A;  4DBQ A;  2DZC A;  3EG1 A;  1LPL A;  4RKU E;  2XI9 A;  2Z0W A;  1S1N A;  5GAN 2;  4HCB A;  1K76 A;  2LDM A;  4OMQ A;  1VQ8 Q;  2ROT A;  3EFR A;  4ELZ C;  3JCM X;  1VQ5 Q;  2BZ8 A;  4PNO A;  2HL5 C;  1H8K A;  1AWO A;  5I2S A;  4GBQ A;  4XK8 E;  2LTO A;  5KE2 A;  4E2F B;  3QG1 A;  1QW1 A;  4FSX A;  2CP5 A;  1N27 A;  2DJZ A;  2KYM A;  1WYX A;  1BCO A;  2DVE A;  1AWJ A;  5CIU A;  3NGP A;  4J6W A;  4XTV A;  3VKI A;  1F1B B;  3CCQ Q;  3G6E T;  2E3I A;  1IGU A;  2F69 A;  1H3Z A;  3PGG A;  2K5F A;  2X4X A;  1BK2 A;  4DA4 A;  2R5A A;  4HCK A;  2BKD N;  2O9V A;  4XAX B;  1OQK A;  2RQR A;  3RNJ A;  3OMC A;  3V7S A;  3UF4 A;  3VS0 A;  4BI4 A;  1QLY A;  1UGQ B;  2O88 A;  1WJR A;  1RLQ C;  3AT1 B;  4OGC A;  1M3A A;  1YJ9 A;  2DXC A;  3CCU Q;  2EAY A;  2DL5 A;  1MMN A;  2J7I A;  5GAM d;  2RD1 A;  3NMZ C;  5KCH A;  5KYU B;  1NJI U;  3KUF A;  2HQX A;  1TUD A;  1TWB A;  4C8Q B;  1WFW A;  1D1C A;  2FB7 A;  4A4F A;  1WZO A;  1K73 C;  5KYW A;  1MUZ A;  1YFN A;  2RB6 A;  1WXU A;  2CSI A;  2RNA A;  4J9D A;  5LL6 S;  3A5Z B;  3EFO B;  4C0D C;  2DIQ A;  3VS7 A;  2L8D A;  4Y91 A;  4RMO A;  2BE9 B;  2QA4 A;  2NUZ A;  1N8R C;  3M9Q A;  3EH1 A;  5GMK h;  2E3H A;  4FL6 A;  4OVA A;  2JXB A;  3G7Z A;  1UFF A;  1VQN A;  2E4H A;  1E6H A;  5GAO q;  1T3S A;  5CQX A;  4N4I A;  3CCV Q;  3OS1 A;  1FX7 A;  2YXY A;  1RAB B;  4OB1 B;  3A98 A;  4O5V A;  5A2Q E;  5FU6 B;  2K6D A;  3O8V A;  3JB9 J;  3HPW A;  4IUP A;  4A4E A;  5LJ3 f;  3TVT A;  1X2K A;  1I4K 1;  2WAC A;  4ZN1 A;  1PKT A;  2GNC A;  2HEQ A;  1ARK A;  2IVW A;  4M75 B;  1WI7 A;  3FDR A;  3IQL A;  1VQ7 T;  3CCE Q;  1QVP A;  4LNP A;  1W2B A;  4IIM A;  2YT6 A;  4FT2 A;  1NEG A;  3EGX A;  2MF2 A;  2X4Y A;  1O9S A;  1JXM A;  2ZPF B;  1RUW A;  5LJ5 g;  2SRC A;  5C0M A;  1NLO C;  4LD6 A;  5I2M A;  2QTX A;  4N4G A;  1WNL A;  3E2U A;  3VS5 A;  2DXB A;  4JRQ A;  5CCA A;  2P84 A;  2QK0 A;  1VQP Q;  1KQ2 A;  1VQL T;  1NM7 A;  3H8Z A;  2LNH B;  4AMC A;  1RAH B;  4C0G A;  3V7C A;  5DLQ E;  2X4W A;  1YIT Q;  2KRS A;  2MK5 A;  3OYG A;  4XTU A;  3G4S T;  5LJ3 h;  4XU2 A;  2LRQ A;  2DL3 A;  2KI7 A;  2P0K A;  1Y71 A;  1NPR A;  2K79 A;  1EIF A;  2YUN A;  3CCJ T;  3WXM B;  3LLR A;  1KHI A;  3L2R A;  2PZ1 A;  4E7L A;  1E6G A;  3HSB A;  2I2L A;  5FRM A;  3EG0 A;  4BI8 B;  2D0Q B;  3F70 A;  1BCM A;  1RAA B;  1M1F A;  2EYW A;  4M7A G;  1SHG A;  3VUZ A;  2JM8 A;  2CUB A;  2KEA A;  3GNF B;  2QI2 A;  3VV0 A;  2DL7 A;  2DA9 A;  2AZV A;  3MP6 A;  3V8L A;  3FC3 A;  9ATC B;  2ROL A;  1K73 U;  1M2V A;  3CXC P;  2DBM A;  2JMA A;  4RTT A;  2ZPI B;  4M75 D;  3CD6 Q;  2YRV A;  1WHG A;  4PLI A;  2LJ1 A;  3AHU A;  2DJQ A;  2KT1 A;  1GCQ A;  2LJ3 A;  2GCX A;  2GFU A;  5CKF A;  1EZZ B;  1N8R U;  2C0O A;  2VB6 A;  3OYB A;  3QUI A;  1ZSZ B;  1X6B A;  1K9M R;  1WXT A;  3OQ5 A;  2YHT A;  3L1A A;  1PNJ A;  2EQJ A;  4C92 E;  3PMI A;  1TU0 B;  2FZC B;  2ZPE B;  3CMA T;  4QT7 A;  4PJO A;  5I21 A;  5GAO p;  1UGR B;  4JRK A;  2QG9 B;  2CS7 A;  2KRN A;  3I9Q A;  4KBM B;  3MKD A;  4C5G A;  1SRM A;  1ZA1 B;  3QKJ A;  3Q1J A;  4PFZ A;  2O31 A;  1CKB A;  4LDW A;  4N0A A;  2LP5 A;  2BTT A;  3CCL Q;  2NUP B;  2DZ9 A;  1VIF A;  3S3M A;  3X25 B;  3CPW S;  2NYS A;  1KQ1 A;  4AG1 C;  3FJ5 A;  1ZSG A;  4ORZ A;  1ZQ1 A;  5HK0 A;  4M7A E;  1M5Q 1;  4RTY A;  1KFZ A;  4PJO C;  2CZ7 B;  1QKX A;  5FLX E;  2DTH A;  4C92 A;  1VQ4 Q;  3EG3 A;  5GAN g;  1VQ5 T;  2EYX A;  1D1B A;  1JO8 A;  1ZHI A;  1RAF B;  1QVF P;  3MET A;  2KXD A;  4PJO F;  1QCN A;  2DD4 A;  2RMO A;  2V8K A;  2AIR B;  1Y96 A;  5LJ3 d;  2FVU A;  1H92 A;  2WSE E;  1R0B G;  2J05 A;  3QJY A;  2BE7 D;  3PMT A;  2LNV A;  3CCQ T;  1RL2 A;  3A8M B;  1QKW A;  7AT1 B;  4IUQ A;  1I81 A;  3M59 A;  3JB9 D;  3QSU A;  3OBY A;  3G4S A;  1PM3 A;  1LVK A;  1W70 A;  3SWN C;  2DTO A;  2ATC B;  2ZGW A;  4M78 E;  3CCJ A;  3L2W A;  4OMO A;  3NHN A;  5LJ5 e;  5GMK m;  3E1S A;  5GAN 3;  1SEM A;  2O01 E;  1VQ7 Q;  2DEU A;  3JCM Q;  1N9S A;  2K3X A;  2K2V A;  4P5N A;  2DFU A;  4AFU C;  4OB2 B;  1H3H A;  4XU0 A;  3CCU T;  1Q7Y C;  2QAZ A;  3P8H A;  5GAN 8;  2JVV A;  1W4S A;  5M9O A;  4M7D E;  1OU8 A;  2KAF A;  2XG8 D;  2DYB A;  4NL3 A;  4R55 A;  1RAC B;  2I0N A;  3I56 A;  2K4Y A;  4J7I A;  1UGV A;  1G3Y A;  1JEG A;  1W2B P;  1PD0 A;  1VQL Q;  2P4R A;  1WDX A;  1GFC A;  2LJ0 A;  1G3W A;  3CPW A;  2OTL A;  1B07 A;  2JTM A;  1UGP B;  3GBQ A;  1SG5 A;  2CYZ B;  3CXC S;  2DVJ A;  3GOX A;  2G3R A;  1EFN A;  1ZLM A;  3TCJ A;  3CCR Q;  1BB9 A;  4M78 A;  2RPN A;  1YIJ Q;  2XDB A;  1WXB A;  3BY7 A;  2HL3 A;  2KT8 A;  2EJG A;  3CCV T;  1NLP C;  2CP7 A;  4J83 A;  3M0T A;  2CGH A;  4HVU A;  5CKH A;  2RJF A;  3UA6 A;  3RES A;  1Q86 C;  1BBZ A;  4KGZ B;  4HCC A;  1QP3 A;  2MWO A;  4M7D A;  1WQ7 A;  5FW9 A;  1WLP B;  2AKK A;  2HSE B;  1VQK Q;  3VYH B;  2CP2 A;  2V1Q A;  3CCE T;  2LQW A;  5GMK i;  2O9S A;  3REB B;  2QGG A;  1Y07 A;  4CC4 B;  3EHR A;  3HKS A;  3G71 Q;  3CCM A;  4QVC A;  2P0P A;  2J06 A;  2DX1 A;  3VS2 A;  1PWT A;  2YUQ A;  1VQO Q;  3PE0 A;  4MMK A;  4Q5W A;  5J26 A;  4KH1 B;  1A0N B;  4BE2 A;  4FIB A;  1YJN Q;  1D0X A;  1VQP T;  2BZX A;  2DF6 A;  1G83 A;  3L2U A;  3NTI A;  3X28 B;  4OMP A;  4B9W A;  2XD0 A;  4QQ6 A;  4AFZ C;  2KRO A;  1UHF A;  4KUD K;  4M7D C;  3QHS A;  1CKA A;  3RER A;  1TXQ A;  1YIT T;  2E6Z A;  1VQ8 A;  3M0P A;  2DD5 A;  3EGD B;  1FMK A;  4N4H A;  3QPH A;  2WSF E;  4FYX B;  3O5Z A;  4QQD A;  2KXC A;  1G5V A;  5FWB A;  4DOW A;  1G3T A;  4V2S A;  2EPD A;  2W10 A;  1WPY A;  4Z88 A;  5A0G A;  2VVK A;  1ZA2 B;  2QXF A;  1YNZ A;  4F16 A;  3CME A;  2RHZ A;  2D8H A;  1GRI A;  4J9G A;  3R6N A;  3UAT A;  2F2V A;  4JJN K;  1Q81 R;  3U23 A;  1YCY A;  4DBH A;  1QVF S;  2HQH A;  5C6S A;  2YRD A;  4C0Z A;  5LJ5 d;  1Q7Y U;  4ANJ A;  2EIF A;  1IGQ A;  2KR3 A;  3BFM A;  2KVQ G;  3CCQ A;  3H41 A;  4HVW A;  4EMK B;  2DER A;  3RKY A;  4CC2 A;  2ABL A;  3UT1 A;  4NS5 A;  2V8I A;  2JTF A;  5A0D A;  2X4J A;  5GAN e;  3MJX A;  1VUB A;  3RBB B;  3TRE A;  3M0U A;  1H64 1;  3SHW A;  4RTV A;  3QYG B;  2HSP A;  1X6G A;  2RI5 A;  2RN8 A;  3CPF A;  4J8O A;  3CD6 T;  2HBP A;  3D7S B;  4JJC A;  4JLI A;  2GQI A;  2A37 A;  1UHC A;  2M1H A;  2QEX Q;  3JSC A;  1AOJ A;  3LWH A;  2EYY A;  1UEB A;  2J6O A;  3HRU A;  1LOJ A;  4KGV B;  2V26 A;  2JZ2 A;  1AEY A;  1IZ6 A;  5AYF A;  3DLM A;  1B34 A;  2EKO A;  1Q86 U;  4XTW A;  3M0R A;  3M55 A;  4IIO A;  3CBO A;  3FJP A;  5FU7 C;  3HFO A;  1W2B S;  2CH4 A;  2VXF A;  2ED0 A;  1T3L A;  2RQU A;  2XK0 A;  2DXT A;  1UDL A;  4QVZ A;  1D3B B;  1BYM A;  5EC7 A;  3JCM V;  1MV3 A;  4NL2 A;  3NPF A;  1VIE A;  2G6F X;  4LD9 K;  2LQ8 A;  1UJ0 A;  4A4G A;  2EFI A;  1TUC A;  4X34 A;  3JB9 H;  4M7A B;  1OX9 A;  3M53 A;  3NFC A;  4E7S A;  5KYY B;  2F5K A;  4PLL A;  3RKX A;  3CCL T;  1XJW B;  2L2P A;  5KYX A;  4ZNX A;  2YLC A;  5IHK A;  1M3B A;  3C0C A;  3JCM b;  3J7A F;  4M77 A;  4RTX A;  5L23 A;  4ZGE B;  1QVF A;  2FZG B;  4EIK A;  1M30 A;  5J39 A;  2PQW A;  1GBQ A;  3CCE A;  1NYG A;  2GQV A;  4OGE A;  1KSW A;  2KGT A;  4RCB A;  2JNG A;  2JUF A;  1M90 R;  1VQ4 T;  2COW A;  2HBW A;  5CKE A;  1N9R A;  1NPP A;  4BI3 A;  1KHC A;  2O4X B;  1O75 A;  1RAG B;  3OW2 A;  1NG2 A;  1BI1 A;  4KUL A;  2AK5 A;  3H9N A;  2L3S A;  4PJO G;  1VQP A;  2OTJ A;  1HSQ A;  1SF9 A;  2VGM A;  2GTO A;  4A54 A;  1B7T A;  2KSS A;  1OZ2 A;  2VV5 A;  5GMK e;  3A8G B;  3CPW P;  1U5S A;  2QQA A;  2CT4 A;  4M77 C;  3QWY A;  3MEV A;  2VXE A;  5DM7 R;  3UPU A;  4ESR A;  4J9H A;  3LWI A;  4GLM A;  4M77 F;  1U3O A;  2RJC A;  3M57 A;  1MNE A;  1JJ2 S;  1WJS A;  3MP8 A;  2D1X A;  2YDL A;  5HCK A;  5GAN d;  3TU4 K;  3LX7 A;  4MZT A;  1QWF A;  3EGU A;  5GJW B;  3A8H B;  4TVR A;  2D8J A;  3EAE A;  3TSZ A;  2MCN A;  5GMK l;  5IHI A;  2IIM A;  3RMS A;  4C92 G;  1K9M C;  3TSW A;  3P8D A;  1W1F A;  4XTY A;  1JB0 E;  4LDX A;  2A0F B;  4L6V 5;  3CC2 T;  3FIF A;  2OAU A;  4F7U A;  2GGR A;  3I55 Q;  3R6O A;  1Y7X A;  2JM9 A;  1D09 B;  2KYB A;  4C8Q D;  1UG1 A;  1X75 C;  4BB7 A;  4BE0 A;  4BDY A;  5FRO A;  4ZGD B;  1B3Q A;  2X3W D;  1OX8 A;  2JN0 A;  4QW2 A;  3CC7 Q;  2ESW A;  3ZL7 C;  5LJ3 e;  2J6K A;  2NUT A;  3CCR T;  1OUL A;  3THK A;  3VYG A;  1YIJ T;  1KC8 R;  3MO8 A;  1WHM A;  1RAE B;  2H3E B;  4CRI A;  2ZAE A;  2MYS A;  3M0Q A;  4BY6 C;  1YJW Q;  2YSQ A;  1GL5 A;  3HTR A;  2COZ A;  4FYV B;  1SPK A;  4FM4 B;  3G6E A;  3OYA A;  5IAY A;  4EMG A;  3KBG A;  4PJO E;  5FRN A;  1GXI E;  1VQK T;  3TQ7 P;  4BDZ A;  1ABO A;  3A8O B;  2E65 A;  1X43 A;  2FHD A;  2FPE A;  1SSF A;  2DIL A;  2A08 A;  4F7U F;  1PRL C;  4C0F A;  3QDF A;  3QDR B;  2DTI A;  2OJ2 A;  3OYH A;  3G71 T;  3G1J A;  2EGE A;  3M0S A;  2DNU A;  1YBY A;  4E6R A;  1VQO T;  2EWN A;  4HA8 A;  4MZP A;  2PNI A;  2MIO A;  3OSS C;  5GAN 4;  1JJ2 A;  4B6M A;  1YJN T;  5DY9 A;  2HNI A;  1MHN A;  4FCY A;  2OAW A;  3OYD A;  3BE3 A;  1V76 A;  2BZY A;  4KUI A;  4RCC A;  1AZE A;  4J9F A;  3OS5 A;  1JRI A;  1PG5 B;  1Y0M A;  3JCM f;  4M78 G;  1X69 A;  3OYJ A;  2LMJ A;  5KH6 A;  3CC4 Q;  1U06 A;  1E7O A;  2OX7 A;  5D6W A;  1AWX A;  1QQJ A;  4KH0 B;  4OB0 B;  3EG9 A;  2SEM A;  3FB9 A;  2LCL A;  4J5Y A;  2LQN A;  3JV3 A;  2ZPG B;  2MAM A;  3OBW A;  2EQI A;  4M7D G;  4A53 A;  2YWW A;  1BI3 A;  5CK9 A;  5HK3 A;  4FU6 A;  3VUB A;  4C0D B;  2YLB A;  1OI1 A;  3GLX A;  2E5Q A;  3P8B B;  2LCS A;  2RI3 A;  1WHJ A;  3M4G A;  4L5G A;  2M9U A;  2BUD A;  1C6V X;  3A1P A;  1K9M U;  1HXD A;  3OYC A;  4Z89 A;  2HKN A;  1S72 Q;  3SDZ A;  1TUG B;  3C94 A;  3JCM h;  1IHV A;  3L2Q A;  2QTV A;  1KK7 A;  3OYI A;  1VQ7 A;  2AT1 B;  2QGF B;  4D8K A;  5GAM j;  3S3O A;  1ZBJ A;  3SWN A;  5KYW B;  4E7K A;  4DBF A;  1I07 A;  4XU1 A;  2QEX T;  1M4Z A;  2A36 A;  2O2O A;  1I8F A;  2RJD A;  3QO3 A;  1C1A A;  2ZCF B;  2DL8 A;  4JJD A;  5KCO A;  2KMT A;  4Y92 A;  1VQL A;  4OP0 A;  2R58 A;  2QQ9 A;  3OS2 A;  1KD1 R;  3EH2 A;  3JRZ A;  4ZN3 A;  2B8A A;  2L3Q A;  3LH0 A;  3REA B;  2DPP B;  2L3P A;  8AT1 B;  3OW2 P;  3RMQ A;  2EYZ A;  4MML A;  3A8L B;  2DRM A;  1PRM C;  3OA6 A;  3CCR A;  2R57 A;  5EG2 A;  2FL7 A;  2OI3 A;  1QVG A;  3QZ9 B;  4FYW B;  2EW3 A;  3DB3 A;  3DB4 A;  3N5B B;  1YHQ Q;  3M5A A;  3HFN A;  2K9G A;  2NLU A;  2CZ0 B;  3ASK A;  4VUB A;  5D6X A;  2FO0 A;  3EGX B;  2BIV A;  1VOM A;  3ZBD A;  1YWO A;  2QQR A;  4XQ3 A;  1UJY A;  1K0S A;  3H0H A;  1VQM Q;  3CC2 Q;  1KIK A;  2XID A;  1G2B A;  1HD3 A;  1WHH A;  3OS0 A;  3G71 A;  2FEI A;  2V1R A;  1T0J A;  4C8Q A;  4FYY B;  1Q81 C;  1R77 A;  2RQW A;  3BDU A;  1D0Y A;  3L42 A;  2F2W A;  3V8J A;  3J80 E;  4UC4 A;  1YJN A;  1EX4 A;  1XOV A;  2JMC A;  1RI9 A;  2DK3 A;  3EFO A;  2FYK A;  3QZ5 B;  5GAM f;  1N6A A;  2IPO B;  2PVD B;  2V8J A;  1DJ7 B;  4EMH A;  1X27 A;  4YTL A;  1VQ6 Q;  2RM4 A;  2JW4 A;  4J7F A;  3OYM A;  1ZX6 A;  1AWW A;  1K8A R;  4J9E A;  2CP0 A;  4E7Z A;  3MEW A;  1PSE A;  3X26 B;  2PU9 B;  2RH2 A;  3CMA A;  1NZ9 A;  3C95 A;  2Y4Y A;  4IUR A;  4IKF A;  2K57 A;  5IN1 A;  2F2X A;  2D6F A;  4M77 G;  1OOT A;  1FMW A;  4C8Q C;  4ZGJ B;  4JS4 A;  3S6W A;  2M16 A;  1WQW A;  4FW1 A;  4JDS A;  1LJO A;  2KY9 A;  1M2V B;  2X35 A;  3LW5 E;  2VAS A;  1M27 C;  1UUE A;  4AG2 C;  5HKC A;  4M75 A;  4C8Q F;  3ZFJ A;  4XU3 A;  2LQK A;  3I56 Q;  2HKQ B;  2RHI A;  4E7H A;  5D6Y A;  3C12 A;  2DO3 A;  3I55 T;  3CCS Q;  4C5I A;  2OTL Q;  1KQS A;  4HT9 A;  2ENM A;  2LCC A;  1ABQ A;  4CC7 A;  1ACM B;  2RQV A;  4MDW A;  2ZPH B;  3M4Y A;  4RTZ A;  1BIB A;  3CC7 T;  1JJ2 P;  4Z8A A;  2QEX A;  1VQ5 A;  1SRL A;  4J6X A;  3EG9 B;  5FU6 C;  1AHJ B;  1IRX A;  4KRT A;  3I5S A;  1VQN T;  2VC8 A;  1RAD B;  4J9C A;  2Y4X A;  2QDY B;  4PJO B;  3OSV A;  1YJW T;  4M75 C;  3FLG A;  1JU5 C;  4FSS A;  4F14 A;  2CH4 W;  2D0N A;  2HMA A;  1Q82 R;  1M1K R;  2C0T A;  1VQ9 Q;  5GAO m;  5CO7 A;  2QQS A;  3JCM c;  4AFQ C;  2XMF A;  1YI2 Q;  2CT3 A;  4PFO A;  4M75 F;  2E6N A;  1TOV A;  4ZTF A;  3PT9 A;  5GJV B;  5KE3 A;  1M90 C;  3OW2 S;  2KBT A;  2RI2 A;  4II1 A;  2HDA A;  4BD3 A;  1M3C A;  2FPD A;  3CCM Q;  4F7U G;  2K3Y A;  1T0H A;  3CCU A;  2RHX A;  2C06 A;  5J3B A;  1Q81 U;  4ELY C;  4C92 B;  5KYN A;  3KFV A;  4M77 E;  1GFD A;  2PUO B;  4RTW A;  2P4T A;  1OV3 A;  3LGF A;  4D6W A;  2GTJ A;  3OYN A;  3VS3 A;  3JCM P;  3CC4 T;  3H0F A;  2KNB B;  1BIA A;  1Y96 B;  4K11 A;  2L5Q A;  4XTX A;  1ZSZ A;  2CZ6 B;  4JJB A;  1BKB A;  2LT4 A;  1UB4 A;  3CME Q;  1TH7 A;  5LJ3 j;  1JBM A;  2L0A A;  1I1J A;  5GAN 5;  4ME7 A;  1NJI R;  1UE9 A;  2K2M A;  2M02 A;  3OB9 A;  1PSF A;  4PKC C;  4OMM A;  1GBR A;  5GAO r;  3HRS A;  4PJO D;  3OYF A;  2C0I A;  3CCV A;  1TG0 A;  2PVO B;  4IUU A;  2X3X D;  3NTH A;  2E10 A;  4M4Z A;  5GAN 6;  2RK2 A;  3DKM A;  1U1S A;  1M9S A;  2A7Y A;  1S72 T;  8ATC B;  3CBM A;  4R56 A;  4JRI A;  4FW2 A;  4LXC A;  3VJP A;  1QVG P;  2LT1 A;  2M0O A;  1ZSZ C;  4ZTJ A;  2DE0 X;  4LN2 A;  2CP6 A;  2NUP A;  1MV0 B;  2EJF A;  1IHW A;  1UEC A;  2K5L A;  3SB2 A;  1KC8 C;  3FRN A;  3QBY A;  3L2V A;  2J6F A;  2HQE A;  1ZBX A;  2E41 A;  3JCM g;  5CKD A;  3CBP A;  4BE1 A;  5ECA A;  5L8R E;  3JB9 F;  3ZEH A;  3OYK A;  4C92 D;  3PVL A;  2D9T A;  2YUP A;  4F7U E;  4M78 B;  3I55 A;  1FYN A;  2L89 A;  1ZUK A;  2PVG B;  1YIT A;  4WF2 A;  4DEY A;  1BU1 A;  3CC7 A;  1UTI A;  3MP1 A;  2LC4 A;  2CZ1 B;  2KK4 A;  1TS9 A;  2RF0 A;  1NYF A;  1U8R A;  1M90 U;  4M7D B;  3UDC A;  3GIB A;  1QMC A;  1YJW A;  1WA7 A;  1YHQ T;  2KDS A;  1YJ9 Q;  2K5I A;  2RO0 A;  2DAQ A;  4C5E A;  3RDV A;  2QQB A;  3S3N A;  4GLK A;  2LVM A;  1ZUY A;  3VRZ A;  1D1A A;  4JZ3 A;  3BDL A;  3GNG A;  4M7A D;  1SSH A;  1NEB A;  3M54 A;  2JT4 A;  3HHT B;  4JLG A;  2FZK B;  4OF1 A;  3H0I A;  1IRE B;  1VQM T;  2VGN A;  1PHT A;  2XIC A;  3NTK A;  1VA7 A;  4HT8 A;  1V29 B;  3E19 A;  3CD6 A;  2QYZ A;  2EBP A;  3OYL A;  2DBK A;  3GF5 A;  2ECZ A;  3GP8 A;  1LNX A;  3E9F A;  2QA4 Q;  2EVR A;  4OMN A;  1HK9 A;  3PVQ A;  2OTJ Q;  3RIR A;  3HP9 A;  1K1Z A;  3QII A;  1MMD A;  2KE9 A;  1VQN Q;  4Y28 E;  2XDP A;  1KQS P;  2DL4 A;  2FRY A;  4HXJ A;  2CRE A;  4BAC A;  2Y90 A;  3CC4 A;  1VQ6 T;  1BI0 A;  1K0X A;  4EDU A;  5HY6 A;  1V1C A;  1K73 R;  4LDV A;  3TEE A;  3V7R A;  4M78 D;  4KGX B;  5IHN A;  2RK1 A;  1XTD A;  1X2Q A;  2FPF A;  2VUB A;  1PC0 A;  5I11 A;  3ULR B;  2HAX A;  1U1T A;  2DIG A;  3OY9 A;  1M8V A;  5GAO n; 
#chains in the Genus database with same CATH homology
 2DF6 A;  1G83 A;  2J7I A;  2L3Q A;  3NMZ C;  4OMP A;  3REA B;  2L3P A;  4AFZ C;  2KRO A;  1UHF A;  2EYZ A;  1I0C A;  1TUD A;  1CKA A;  2NWM A;  1OEB A;  3I35 A;  2DRM A;  1PRM C;  2M0Y A;  2HCK A;  4J9B A;  4RTU A;  1WFW A;  3M0P A;  1FMK A;  2OI3 A;  1MUZ A;  3O5Z A;  2KXC A;  5FWB A;  1WXU A;  2CSI A;  2EPD A;  2RNA A;  2W10 A;  2EW3 A;  4J9D A;  4Z88 A;  2VVK A;  1YNZ A;  2K9G A;  1SHF A;  4F16 A;  2D8H A;  5I22 A;  1GRI A;  2KRM A;  4J9G A;  3VS7 A;  3R6N A;  3UAT A;  2F2V A;  3U23 A;  2FO0 A;  4A63 B;  2NUZ A;  1YWO A;  2KR3 A;  1VYV A;  1JQQ A;  3H41 A;  3EHQ A;  4F17 A;  2JXB A;  4HVW A;  1UJY A;  1UFF A;  4RUG A;  4CC2 A;  2ABL A;  1E6H A;  1K0S A;  3H0H A;  1T3S A;  1KIK A;  1G2B A;  1WIE A;  1HD3 A;  2LZ6 B;  3RBB B;  3M0U A;  3SHW A;  4RTV A;  1HJD A;  3A98 A;  2FEI A;  4DEX A;  2V1R A;  1T0J A;  2HSP A;  2K6D A;  1X6G A;  2QDL A;  4LE9 A;  2RN8 A;  3TVT A;  2RQW A;  1X2K A;  1Z9Z A;  4JJC A;  2F2W A;  2JMC A;  1PKT A;  2HEQ A;  2GNC A;  2GQI A;  1XOV A;  1RI9 A;  2A37 A;  1ARK A;  1WI7 A;  1UHC A;  3IQL A;  4LNP A;  4IIM A;  2YT6 A;  1AOJ A;  1QWE A;  2DMO A;  2EYY A;  1X27 A;  2J6O A;  1NEG A;  2JW4 A;  5FWC A;  1AEY A;  1JXM A;  1ZX6 A;  1AWW A;  1GCQ C;  1RUW A;  4J9E A;  2SRC A;  1NLO C;  3VS5 A;  2W0Z A;  2F2X A;  3M0R A;  2H8H A;  4IIO A;  2CH4 A;  1NM7 A;  2ED0 A;  1T3L A;  1OOT A;  2RQU A;  2LNH B;  1UDL A;  4WCI A;  2K7A A;  1K4U S;  5EC7 A;  1MV3 A;  3NPF A;  2KRS A;  1ZUU A;  1M27 C;  2G6F X;  1UUE A;  4AG2 C;  1UJ0 A;  2DL3 A;  2K79 A;  1QCF A;  2YUN A;  2PZ1 A;  1TUC A;  1E6G A;  2MOX A;  2PTK A;  1Y57 A;  3EG0 A;  2L2P A;  4ZNX A;  3QWX X;  5IHK A;  1JXO A;  1M3B A;  3C0C A;  2FG0 A;  4RTX A;  2EYW A;  2ENM A;  5L23 A;  1SHG A;  2JM8 A;  4EIK A;  1ABQ A;  4CC7 A;  1M30 A;  2CUB A;  2RQV A;  3I5R A;  2CDT A;  2KEA A;  1GBQ A;  4RTZ A;  2DL7 A;  4Z8A A;  1NYG A;  1SRL A;  2DA9 A;  2AZV A;  1KSW A;  2KGT A;  4KRT A;  3I5S A;  4R0K A;  2HBW A;  4CC3 A;  4J9C A;  2ROL A;  2CUD A;  1J3T A;  1YP5 A;  2JS0 A;  3LH5 A;  2DBM A;  1NG2 A;  2JMA A;  1JU5 C;  4FSS A;  2FRW A;  4RTT A;  2CH4 W;  2D0N A;  4F14 A;  3UA7 A;  2AK5 A;  2C0T A;  1GCP A;  2L3S A;  1CSK A;  2LJ1 A;  1HSQ A;  2DJQ A;  2KT1 A;  2EGC A;  1GCQ A;  2LJ3 A;  2GTO A;  4AFQ C;  2XMF A;  2CT3 A;  2A28 A;  2C0O A;  1U5S A;  2CT4 A;  3VS1 A;  3QWY A;  4HVV A;  1X6B A;  5GJV B;  1WXT A;  1YN8 A;  1PKS A;  4ESR A;  4J9H A;  2KBT A;  2DM1 A;  1IO6 A;  2HDA A;  1M3C A;  2E5K A;  2FPD A;  2GBQ A;  4GLM A;  1LCK A;  1PNJ A;  1U3O A;  1T0H A;  3VRY A;  4QT7 A;  2D1X A;  2YDL A;  5HCK A;  3KFV A;  1QWF A;  2B86 A;  2K3B A;  1GFD A;  3EGU A;  5GJW B;  4RTW A;  4D8D A;  2D8J A;  1RLP C;  2CSQ A;  3TSZ A;  1OV3 A;  2MCN A;  2KRN A;  3I9Q A;  5IHI A;  2GTJ A;  1Z9Q A;  1AZG B;  2IIM A;  3VS3 A;  3EG2 A;  2EKH A;  1SRM A;  3H0F A;  2JS2 A;  2KNB B;  3TSW A;  2DRK A;  2O31 A;  1CKB A;  1W1F A;  1AD5 A;  4K11 A;  2LP5 A;  2BTT A;  2RQT A;  2ED1 A;  2JTE A;  4JJB A;  2GGR A;  2EGA A;  2JM9 A;  2KYB A;  1M8M A;  4AG1 C;  1UG1 A;  2L0A A;  3FJ5 A;  1I1J A;  4OML A;  1ZSG A;  3VS6 A;  1UE9 A;  2K2M A;  4ORZ A;  4JZ4 A;  1B3Q A;  2X3W D;  4OMM A;  2ESW A;  3ZL7 C;  4RTY A;  1GBR A;  1KFZ A;  1QKX A;  2J6K A;  5IXB A;  2C0I A;  2DLP A;  1TG0 A;  3THK A;  3EG3 A;  4J9I A;  2EYX A;  1OPL A;  1JO8 A;  2X3X D;  3M0Q A;  4M4Z A;  2YUO A;  2KXD A;  2YSQ A;  5IH2 A;  1GL5 A;  2RMO A;  1W6X A;  4LUD A;  1YCS B;  1SPK A;  1OPK A;  1H92 A;  2DE0 X;  4LN2 A;  2J05 A;  1MV0 B;  4AFS C;  1KJW A;  1ABO A;  1UEC A;  3CQT A;  1N5Z A;  1QKW A;  1X43 A;  2FPE A;  2DIL A;  2A08 A;  2J6F A;  1PRL C;  2VKN A;  1W70 A;  2OJ2 A;  2AKL A;  4OMO A;  3NHN A;  5ECA A;  2EGE A;  1AVZ C;  1SEM A;  3M0S A;  2DNU A;  3PVL A;  4E6R A;  5IXF A;  2YUP A;  2PNI A;  2M51 A;  4X1V A;  2MIO A;  4AFU C;  1FYN A;  1H3H A;  2OAW A;  2BZY A;  1ZUK A;  1AZE A;  4J9F A;  1Y0M A;  1X69 A;  4DEY A;  1BU1 A;  2LMJ A;  1UTI A;  1VYT A;  4LUE A;  2DYB A;  2LX7 A;  1YWP A;  1U06 A;  1E7O A;  1WX6 A;  3VS4 A;  2RF0 A;  2I0N A;  1AWX A;  1K9A A;  1UGV A;  1JEG A;  1NYF A;  1VYU A;  2AZS A;  2SEM A;  2VWF A;  2LQN A;  2P4R A;  3JV3 A;  1WDX A;  1WA7 A;  1GFC A;  2LJ0 A;  2EQI A;  4JPB W;  3SEM A;  1B07 A;  3GBQ A;  3EG1 A;  1ZUY A;  3VRZ A;  1S1N A;  2DVJ A;  4JZ3 A;  1EFN A;  1K76 A;  1ZLM A;  4OMQ A;  1SSH A;  1NEB A;  2LCS A;  1BB9 A;  2JT4 A;  2RPN A;  2ROT A;  1WXB A;  2BZ8 A;  3H0I A;  1H8K A;  1AWO A;  2KT8 A;  1PHT A;  4GBQ A;  1NLP C;  4Z89 A;  1VA7 A;  3M0T A;  4HVU A;  3UA6 A;  2EBP A;  1BBZ A;  2DBK A;  2ECZ A;  2KYM A;  1WYX A;  4D8K A;  1AWJ A;  1WLP B;  5FW9 A;  2AKK A;  2EVR A;  3NGP A;  4OMN A;  1ZBJ A;  3PVQ A;  2V1Q A;  1K1Z A;  2KE9 A;  2LQW A;  1I07 A;  2A36 A;  2O2O A;  2O9S A;  3REB B;  2DL4 A;  2FRY A;  4HXJ A;  1BK2 A;  4CC4 B;  2CRE A;  4HCK A;  1K0X A;  2O9V A;  3EHR A;  1V1C A;  2DL8 A;  4JJD A;  2J06 A;  2RQR A;  5IHN A;  3RNJ A;  2DX1 A;  3VS2 A;  1PWT A;  2YUQ A;  3UF4 A;  4Y92 A;  3VS0 A;  3PE0 A;  1X2Q A;  2FPF A;  5I11 A;  1QLY A;  2O88 A;  3ULR B;  1RLQ C;  1A0N B;  1M3A A;  2BZX A;  2DL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...