2GTOA

Oxidized form of adap hsh3-n
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
96
Chain Sequence
EKKEQKEKEKKEQEIKKKFKLTGPIQVIHLAKACCDVKGGKNELSFKQGEQIEIIRITDNPEGKWLGRTARGSYGYIKTTAVEIDYDSLKLKKDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-Regulated Conformational Changes in an SH3 Domain
pubmed doi rcsb
molecule keywords FYN-binding protein
molecule tags Signaling protein
source organism Homo sapiens
total genus 18
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2gtoA01
1T0JA 1ZX6A 2JMAA 4JJDA 4DEYA 2EYXA 1ZSGA 2O2OA 3A98A 3U23A 4RTYA 2GQIA 1RLPC 2SRCA 2KRNA 4FSSA 1QLYA 4LN2A 1JXMA 3FJ5A 2FO0A 2K9GA 2K79A 2DVJA 2LQNA 2GNCA 2PZ1A 1UGVA 1X6BA 1X43A 1CKAA 5L23A 1H92A 2IIMA 2QDLA 1RI9A 4HVVA 1SSHA 1UFFA 2P4RA 2DF6A 4OMQA 2HEQA 1K0SA 1QWEA 2HDAA 4X1VA 2I0NA 1V1CA 1AOJA 2RN8A 1E6HA 2ABLA 2ECZA 3NHNA 2YSQA 2XMFA 1PNJA 1Y57A 2C0OA 1I1JA 1PWTA 2K6DA 1GBRA 1UG1A 2KBTA 2LNHB 4AG2C 2KR3A 3C0CA 2DMOA 1UUEA 4JJCA 1TUDA 2DBMA 2JXBA 2KRSA 1VA7A 4QT7A 4Y92A 2F2XA 1IO6A 1G83A 2EGEA 1PHTA 2D0NA 1UE9A 3H0IA 3REBB 2M0YA 1CSKA 1FMKA 1HD3A 1ABQA 1UTIA 2GGRA 3VS4A 1VYUA 1GBQA 2EBPA 2VVKA 3H41A 1K4US 3JV3A 5ECAA 1M27C 3NPFA 1YN8A 3M0SA 3EHQA 2J05A 1YWPA 2VWFA 2DL3A 4F16A 4K11A 1WXBA 3VS5A 3M0UA 4J9CA 5IXFA 2J6FA 2KROA 2NUZA 2DA9A 4J9FA 2K7AA 1E6GA 1X2KA 5GJWB 4JZ3A 2MCNA 4DEXA 2YDLA 2K2MA 1BB9A 2DILA 1JQQA 1U3OA 4RTTA 4ORZA 1UJ0A 3GBQA 2RQRA 2AKKA 2CUDA 1M3CA 1JXOA 1B3QA 2D1XA 2ESWA 4A63B 4RUGA 2LJ1A 2VKNA 2AK5A 4OMPA 1NM7A 1NLPC 3VS7A 2KNBB 3UATA 1T0HA 3EG1A 5EC7A 3IQLA 2X3XD 2YUPA 1PRMC 1K76A 2AKLA 1WXTA 2FRWA 2GTOA 2EYZA 3SHWA 1KIKA 1M8MA 4RTVA 1LCKA 2M51A 1OPKA 3PVQA 2RF0A 2L0AA 1YP5A 2BZYA 1Z9ZA 2O9SA 1YNZA 1WYXA 3VS3A 4J9BA 1GCPA 2JTEA 5IHKA 2RQTA 1X2QA 3R6NA 4CC3A 4AFQC 3PVLA 2MIOA 1H8KA 1AVZC 2F2VA 1M30A 3M0PA 1ZLMA 2EVRA 2CH4W 2CH4A 2LX7A 2RQVA 1JO8A 3SEMA 1AD5A 2O31A 2CREA 2G6FX 1I0CA 4AG1C 4HCKA 2OAWA 2JM8A 1Y0MA 4AFSC 2A08A 3QWYA 2CT4A 3H0HA 1MV0B 4CC7A 1NYFA 1SHGA 2O9VA 2CSQA 1GCQC 2DBKA 2KRMA 2LMJA 2FEIA 3EGUA 1T3LA 1W6XA 2GBQA 2BZXA 3RBBB 2DM1A 2V1QA 1WA7A 2RQUA 3EG3A 2FPDA 1WFWA 2EYYA 1AEYA 4R0KA 1X27A 3O5ZA 3EHRA 2ROLA 2J6OA 4KRTA 5GJVB 1NYGA 2DX1A 1MV3A 1OOTA 1SPKA 1UHCA 4HVUA 1QKWA 2O88A 3REAB 1JEGA 1K0XA 4CC2A 1X69A 1RLQC 5IXBA 2EGCA 4J9DA 4JZ4A 1UJYA 2EKHA 3M0RA 3TSZA 1AZGB 1HJDA 1WLPB 1N5ZA 4HVWA 4IIOA 2EQIA 1T3SA 3I5RA 2GTJA 3ULRB 1UDLA 3EG2A 2DYBA 1HSQA 1OPLA 2C0TA 4RTZA 1H3HA 1G2BA 1OEBA 4J9EA 2D8JA 4ZNXA 3H0FA 3UF4A 2CSIA 1U06A 1X6GA 1EFNA 1FYNA 3TVTA 1NEBA 1GRIA 1M3BA 1ARKA 3NGPA 1AZEA 2L3SA 4D8DA 1B07A 2L2PA 4GBQA 2DL7A 2OI3A 2BZ8A 1J3TA 2PNIA 1SRMA 1ABOA 1GFDA 2ED0A 4M4ZA 1E7OA 2YT6A 2HBWA 1YCSB 5IH2A 1PKSA 2BTTA 2NWMA 2CDTA 2KXDA 5HCKA 1BU1A 1AWOA 2J7IA 2FRYA 4ESRA 1GCQA 1SHFA 3KFVA 4WCIA 3I5SA 1I07A 1ZUKA 5FWCA 1GL5A 1Z9QA 1QCFA 1W1FA 1MUZA 2L3PA 1KFZA 4JPBW 3I9QA 2EGAA 4F14A 2J06A 1AWXA 1K1ZA 3VS0A 4E6RA 5I22A 2W0ZA 1VYTA 2RMOA 1SEMA 1NLOC 2C0IA 4IIMA 2DJQA 4Z89A 3QWXX 2OJ2A 1WDXA 1BK2A 2DL8A 2EW3A 1AWJA 1UHFA 2JS0A 4OMLA 1M3AA 1TUCA 2DL5A 2KE9A 1BBZA 2B86A 2DRKA 2YUQA 2F2WA 4LNPA 2A28A 4OMNA 1ZBJA 3UA7A 1VYVA 4CC4B 1CKBA 2LCSA 2CT3A 2KGTA 1S1NA 4EIKA 2K3BA 4AFZC 1YWOA 2LJ3A 2LZ6B 2A36A 3RNJA 1NG2A 2EYWA 1ZUUA 2JW4A 3VS6A 4OMMA 3UA6A 1W70A 2DRMA 1KJWA 3M0QA 4HXJA 3NMZC 2PTKA 2KT1A 2YUNA 1A0NB 4J9HA 2CUBA 3TSWA 2ROTA 1TG0A 2LQWA 2LJ0A 2KYMA 4LUDA 1AWWA 3EG0A 2KEAA 5IHNA 4JJBA 2L3QA 1WI7A 2SEMA 4OMOA 2W10A 2KT8A 5IHIA 3ZL7C 2JS2A 1UECA 2FG0A 1GFCA 1WIEA 3CQTA 2YUOA 4RTWA 3LH5A 1XOVA 2RQWA 2AZVA 5FW9A 2DE0X 1QKXA 4J9IA 1SRLA 2EPDA 2HSPA 3VRZA 1NEGA 2D8HA 5I11A 4RTXA 1WXUA 1QWFA 5FWBA 1PKTA 2AZSA 1K9AA 3VS1A 4D8KA 4J9GA 2JMCA 2H8HA 3PE0A 2KXCA 2RPNA 2A37A 2ED1A 2JM9A 3THKA 4AFUC 1JU5C 2DL4A 1PRLC 1ZUYA 2KYBA 4Z88A 2J6KA 2MOXA 2E5KA 4GLMA 2FPEA 4LE9A 2DLPA 2RNAA 1U5SA 1OV3A 1WX6A 1RUWA 2ENMA 2LP5A 2X3WD 2HCKA 3VRYA 3M0TA 3VS2A 2FPFA 2V1RA 4F17A 3I35A 1KSWA 4RTUA 2JT4A 4Z8AA 4LUEA 2DNUA
chains in the Genus database with same CATH superfamily
1ZX6A 2JMAA 3ME9A 2KVQG 2JUFA 4M7DB 1Y07A 4JJDA 4R56A 1VQ5Q 2LRQA 3CCMA 2HKNA 4MDWA 3AT1B 3OYAA 2DIGA 3HP9A 4LN2A 1Y96A 3FJ5A 2PUOB 1K8AC 4PJOB 2QQBA 2LQNA 2XK0A 2GNCA 1O9SA 3ER0A 4OP0A 4ZGEB 2QGGA 5GMKi 3CCEA 2IIMA 2QDLA 3INZA 1YI2A 2QA4T 3ZBDA 2X4JA 7AT1B 3A8GB 3SD4A 1K9MU 2BIVA 3MO8A 4PFOA 2QA4A 2I2LA 3QBYA 5GANh 5KYNA 2R5AA 2XMFA 3C4SA 2C0OA 4C92G 1I1JA 2YRDA 3MEUA 1BCMA 3QZ5B 2VASA 2LNHB 3LH0A 2YLCA 1WNLA 4X9DA 3VU3C 2RO0A 1W2BS 2V26A 4LDYA 5GAN4 1VQ9T 1JJ2A 5GAOm 2HKQB 1M2VA 2DBMA 2KRSA 4RCBA 2EWNA 3LWHA 5GMKe 1IO6A 2EGEA 3C94A 1FX7A 3M4GA 4J7IA 1VQ5A 2HL3A 5GAMg 1VQNT 3M53A 4E47A 4LDXA 5LJ3e 1FMKA 1WHKA 1HD3A 2GGRA 1FMWA 3L2ZA 3QXEB 4BUGA 2RB6A 3G71T 3X25B 3EH1A 2DO3A 2J05A 4MZMA 1YWPA 3JCMd 1F1BB 4F16A 4ELZC 3G71A 2JZ2A 3VS5A 4J9CA 3CCRQ 4F04B 1XJWB 2K7AA 4BB7A 4F7UF 4FW2A 4QQGA 4DEXA 4ATOA 4E2FB 1JQQA 3X20B 2EKOA 4ORZA 1UJ0A 1LNXA 3GBQA 5A0DA 4B9WA 4XTVA 1S72Q 1B34B 1M3CA 1JXOA 2LJ1A 2LT1A 2WSFE 4OMPA 1NM7A 4PL6A 3UATA 1T0HA 3CC4T 5EC7A 3D7SB 1N8RU 1Q86U 2IG0A 2E10A 2YUPA 1PRMC 4EMGA 2FRWA 3JB9I 1KIKA 2E3HA 4CRIA 3KBGA 2GQVA 4IUVA 3H9NA 2L0AA 1XQHA 2HL5C 2O9SA 1YNZA 1WYXA 2JTEA 1BYMA 1ZQ1A 1X2QA 2HSEB 3RMSA 3OYKA 1M4ZA 4BY6C 4LDUA 1AVZC 1ZLMA 2EVRA 2JTFA 4RCCA 3V8LA 3CCLQ 1BI3A 2RQVA 2M02A 1AD5A 2A3LA 2O31A 3UT1A 2CREA 5GAMj 4JS5A 2MYSA 1VIFA 4AG1C 3CBPA 2F5KA 2JM8A 2OAWA 3M54A 3OMCA 4KBMB 2NUPB 2DYIA 3QDRB 1S72A 2O9VA 2K3XA 3OA6A 1GCQC 5FRNA 2FEIA 4E7LA 2A7YA 4M75C 2ZPHB 2F1LA 3MKDA 2JNGA 2V1QA 2MWOA 3AHUA 3HRUA 1R0CB 3EG3A 3QKJA 1BI1A 3M5AA 5AYFA 4PJMA 2QQRA 1X27A 1M2OA 2EAYA 2ROLA 2J6OA 1G3YA 2FHDA 2L8DA 1MV3A 3NFCA 1OOTA 1SPKA 1D0YA 1JEGA 2E5QA 1K0XA 3CCLT 4JS4A 2AHJB 1M1KU 1QQJA 2DTHA 5GAN5 1K73R 1H641 1QCOA 3CCLA 2YXYA 1WLPB 3PNWC 2EQIA 5KH6A 1VIEA 2E41A 2DYBA 3L2VA 4XTWA 3LLRA 1VQ8Q 2ZZDA 2QK0A 1ZSZA 4FU6A 1RACB 1U1SA 4HKEA 4KULA 2DTOA 2QG9B 2DIQA 4FYVB 1QVGP 1U06A 1OU9A 1VQ7T 3TVTA 4JRKA 3QYGB 1GRIA 1KD1R 2JJ9A 3MP1A 2L2PA 3JCMW 2XDBA 3SWNB 4LDVA 2VB6A 1SRMA 4DBRA 1TU0B 4OB0B 1ABOA 5KYUB 3CPFA 4M4ZA 2HBWA 4JRPA 5LJ3d 2DPPB 5KCHA 3RKYA 3QSUA 4ESRA 1BIBA 2F69A 1GCQA 1SHFA 3KFVA 3I5SA 2WSEE 4F7UA 5GANf 4M75A 1Q7YR 5GANe 3JAME 5KYWA 1JB0E 1AWXA 3CCQQ 1VYTA 5IN1A 3QIIA 6AT1B 3I56T 4Z89A 1YFNA 3QWXX 4JJNK 1WDXA 3L1AA 1VQ8A 1AWJA 1UHFA 1TUCA 2JOYA 2XD0A 2CZ1B 2B86A 2DRKA 3CMAT 5LJ5g 1VYVA 5CAIA 1CKBA 4E7HA 3CCJT 5KE3A 1N8RC 4AFZC 1YWOA 4IUPA 3CMAA 2LZ6B 2EYWA 4DBHA 1OZ3A 2RJDA 2NUTB 4QVDA 1WHHA 1W2BA 1U8RA 4C0GA 1VQ4Q 3NMZC 2MF2A 2CUBA 2KYMA 5HK3A 2CYZB 1G8XA 1YJ9Q 1WI7A 2SEMA 3SFMA 3MCAB 1QCNA 1UECA 1GFCA 4EDUA 1IHVA 2DZCA 2FZCB 3GLXA 1NZ9A 3OB9A 2RA2A 3CD6T 4XK8E 4BACA 1XOVA 4F7UG 4M75G 1YIJQ 5GMKh 4J9IA 2HSPA 4MMLA 3CD6A 2FL7A 4V2SA 5CKBA 4C5IA 1MMGA 5LJ3h 2BKDN 2Y4YA 1WQ7A 1QWFA 5FWBA 1PKTA 2AZSA 5CQYA 1K9AA 1OI1A 2D0QB 2JMCA 3PE0A 2KXCA 3JSCA 3E9FA 2ZCFB 2DEQA 5GAOp 1QVFP 2ED1A 3GPLA 2E6ZA 4OMFB 1M90R 2X35A 4NS5A 4IUUA 2E5KA 2FPEA 2RD1A 3M4YA 5GAOl 1NJIC 3JCMJ 4HA8A 3GIBA 2RNAA 3RIRA 1OV3A 1WX6A 2MWPA 4Q5WA 4QVCA 2X3WD 1N6AA 1HK9A 2E4HA 4BI3A 3QG1A 3M58A 2O01E 3S3NA 3L2UA 2E3IA 4F17A 1Q81U 5LJ5j 3CPWS 4C8QB 3EAEA 1KSWA 2JT4A 4GLKA 1M1KC 2RK1A 5DM7R 4XTXA 4XU0A 4J8OA 5FU7C 1M8VA 2EYXA 1ZHIA 2KK4A 3U23A 3OY9A 4M77F 2CP5A 2GQIA 3M59A 1RLPC 2RHXA 2SRCA 1PD1A 1QLYA 4ZTJA 3HRSA 3JB9D 4JDSA 2FO0A 3E9GA 1KQ1A 3JCMf 2PZ1A 1UGVA 3QPHA 4C5GA 1X43A 3JCMe 5L23A 3G7ZA 2R58A 3ASKA 1Q7YU 4P5NA 3FEOA 2DVEA 3OBYA 1UEBA 1UFFA 2DF6A 3V7SA 1K0SA 1QWEA 4X1VA 4O6JA 1V1CA 1NPRA 3LYIA 3E19A 1I8FA 1R77A 1C1AA 1E6HA 1IGQA 2LDMA 3NHNA 3OYDA 4RG8A 3J7AF 1P92A 1Y57A 5HK0A 1IRXA 4A53A 1VQ6T 2K2VA 2KBTA 3RUXA 5GAOr 5CO7A 1UUEA 5FU6B 3Q1JA 2MMPA 3MEAA 9ATCB 2RJEA 1IHWA 3LGFA 3L2QA 1VA7A 4Y92A 3VUBA 3CCVT 3CXCS 3EFRA 1G83A 2QAZA 2X9HA 3H0IA 4BDZA 1YJWT 3CCVA 3CEYA 2M0YA 1CSKA 4C92B 4E7SA 3VS4A 3UPUA 3PGGA 1YJWA 4PNOA 3JV3A 3DB4A 3JCMb 4KT0E 1M27C 3X24B 4DQ2A 2M1HA 2EJFA 4HCCA 2FB7A 2P0PA 1WXBA 4M77C 2QEXT 1OU8A 3DB3A 1D0ZA 3A8HB 3MP6A 4JRIA 4JZ3A 1UGPB 1WHMA 1QMCA 4L5GA 2DILA 1VOMA 1B3QA 2ESWA 2RJFA 4X34A 1NLPC 3VKIA 3VS7A 1PCXA 5KE2A 1Y96B 4FSXA 1KC8U 2BE7D 3CCMT 4EMKA 2EYZA 3RESA 3SHWA 5GAN2 1M8MA 4RTVA 2M51A 3SDZA 1OPKA 2MI6A 3DLLA 2BZYA 4J9BA 3M55A 1D1BA 3CC7T 4HCBA 2V8JA 4CC3A 3CCET 3PVLA 3CMEQ 1YI2T 2C06A 1VQLQ 1M30A 1R8OB 3CC7A 1OYXA 1RAFB 2CH4W 2OTLT 2EQJA 4N4GA 3OYBA 2CH4A 3QJ6A 2VGNA 4C8QD 2LVMA 2EQMA 2QI2A 4FYYB 2OTLA 3SB2A 4R55A 2G6FX 1I5OB 2D9TA 3QWYA 4D6WA 3FIFA 2CP7A 3H0HA 2HQXA 2QXFA 1NYFA 3RR6A 4C0DC 1RAAB 4OB2B 1VUBA 5C6SA 1QP2A 2LMJA 3V7RA 1Q81C 2DK3A 3EGUA 4Y28E 2GBQA 4M77A 5GMKl 1SSFA 2ATCB 2BUDA 2PVDB 5KCOA 3OYGA 1VQ5T 4ZN1A 3CCSQ 8ATCB 4XTYA 1RABB 4PK4A 2RQUA 4BE0A 1MHNA 2OTJQ 2FPDA 5LJ3f 5D6WA 4KH1B 4A4EA 4R0KA 1SG5A 3EHRA 2PQWA 1Q82R 2COWA 2GF7A 5GJVB 4N4IA 2DX1A 2PUKB 1NPPA 4HVUA 1TXQA 3CMEA 4LDWA 4CC2A 1VQLA 3PMTA 2EGCA 3GNGA 3G4SQ 4JZ4A 2EKHA 2DZ9A 3TSZA 1HJDA 3NTHA 1T3SA 3ULRB 1WZOA 4M75F 2X4WA 1M9SA 2P84A 1TWBA 2C0TA 1ZBXA 1H3HA 2HMAA 2YLBA 4C92D 4ZNXA 2CSIA 4XTZA 2G3RA 1EFNA 1NEBA 1YITQ 1LVKA 5GAOq 1ARKA 4JLIA 1RI0A 4HCZA 4D8DA 2BZ8A 4B6MA 3JRZA 5GAMe 3OYJA 2P4TA 3MHXA 3N5BB 2ED0A 2OTJA 1E7OA 4M77G 1YCSB 5IH2A 1TOVA 3CPWA 5HCKA 1ZSZC 4M7AF 3BFMA 4BDYA 4HT9A 3OYNA 3L2RA 4WCIA 1I07A 1OX8A 1M1FA 1ZUKA 3EGXB 1GL5A 3CCRT 3FLGA 2L3PA 4ME7A 3PIOA 1B34A 3G4SA 4A4HA 4JLGA 3P8BB 1QVFS 3CCRA 2ZPBB 4E6RA 5I22A 5I2MA 2RMOA 2C0IA 3A8MB 4M7DD 1TUGB 2OJ2A 4PJNA 1S72T 3C95A 3VYHB 2EW3A 1I5LA 2JS0A 2WSCE 1M3AA 2QTXA 2DL5A 2KE9A 1KK7A 4CC4B 3FDRA 3FC3A 1ZBJA 3UA7A 4PJOD 4FT2A 1S1NA 4AT1B 3JCMh 4KUDK 1KC8C 2LJ3A 1NG2A 1MNDA 3BDLA 1I81A 3G1JA 2LT4A 3VS6A 3PFSA 2DRMA 4MDXA 1Y7XA 3SWNC 1WQWA 2YUNA 4HT8A 3MP8A 2LQWA 2HD0A 2KEAA 3EGDA 4XQ3A 2GCXA 5CKHA 3OS1A 3CXCA 1RL2A 1R0BG 4JJBA 4M78F 2L3QA 4F7UE 4M75E 2W10A 2JS2A 3JCMP 1K9MC 2ZGWA 1BCOA 1XNIA 1WIEA 1X01A 3CQTA 5I21A 3LH5A 3S3OA 3CCUQ 4M7AC 1K8AR 1IXDA 2R5MA 2RI3A 2K3YA 2DXCA 2EPDA 1Q82U 2D8HA 2DETA 4QQDA 4TVRA 2CP2A 4RTXA 5CKFA 1MNEA 2DERA 5DLOA 1VQMQ 2RPNA 4JRQA 3C12A 5GANg 2JM9A 2KYBA 2CP3A 2J6KA 2QGFB 4LE9A 2DLPA 1B7TA 2CP0A 4F7UB 3QHSA 2CZ6B 2COZA 1RUWA 2O4XA 1VQOQ 3VS2A 2F5TX 3OYIA 3VUZA 2KMTA 4LUEA 1MMDA 1T0JA 2QTVA 4Y91A 1YHQQ 3KUFA 4BI4A 3A98A 4RTYA 4PJLA 4MZPA 5LL6S 2KRNA 1VQ8T 2Z0WA 1M5Q1 3CCUA 1JXMA 3JCMV 1W2BP 2K9GA 4M78C 3SWNA 2FZGB 1VQPQ 2RHUA 3P8HA 1CKAA 4CI0C 2OAUA 3FJPA 1RI9A 4HVVA 1NE8A 2P4RA 2HEQA 2HDAA 2I0NA 1KQ2A 4PFZA 2IPOB 1Q86C 1AOJA 2ABLA 5AT1B 5GAOn 5GAMd 2YSQA 4M7AA 2CP6A 5CCAA 1PWTA 2JTMA 2K6DA 4C0FA 2H3EB 5FLXE 1UG1A 4AG2C 3C0CA 2M16A 2HQHA 3QO3A 1WHJA 2M9UA 1D1AA 3LWIA 5GANj 5D7UA 3CCQT 2DKGA 2D0NA 1UGQB 4C8QC 3OYMA 2LC4A 3CCQA 4DOVA 1ABQA 4A4GA 1EIFA 1SF9A 2V8KA 3G6EQ 1VYUA 1GBQA 2VVKA 1FWZA 3HFOA 1K4US 1G3SA 3V7CA 4KGVB 5CKDA 1Q95G 1MMNA 1VQPA 2YWWA 3EHQA 3X26B 5LJ5e 4KH0B 4C5EA 2DL3A 2COYA 2E6NA 4K11A 2DD4A 2RHZA 2J6FA 3KXTA 2KROA 3OW2P 2NUZA 5J39A 5IT9E 2LCCA 1K73U 1E6GA 1X2KA 2XU8A 4XU3A 1KQSP 2K2MA 1BB9A 1YJNQ 1C0MA 2LTOA 4J7FA 1YBYA 2RQRA 3EG9A 1VQ4T 2AKKA 2CUDA 4M78A 2VXEA 4MZTA 3JCMg 4RUGA 1VQ4A 1N9SA 4RG2A 1N27A 4M7AG 1YJ9T 1KD1U 5GAN8 2V8IA 4FW1A 4M7DF 2KNBB 5A0GA 3EG1A 1OQKA 4J6XA 3ZEHA 2AKLA 1WXTA 1YJ9A 4NOYA 2VGMA 4OF1A 4C5HA 1LCKA 2JVVA 1YIJT 3PVQA 4QW2A 2E1HA 3HPWA 4BI8B 1Z9ZA 3VS3A 5GAMh 1TH7A 3JB9H 3G6EA 1JBMA 1YIJA 1TSFA 4AFQC 1WHLA 1OULA 1VQKQ 3OMGA 5KYXB 2F2VA 3M0PA 2DFUA 1D3BB 3CC2Q 4C92C 1QVFA 1EZZB 4QKUA 4A4FA 2VV5A 5KYYB 2A0FB 3OS2A 5HY6A 2QQSA 4EMKC 4C8QA 1AT1B 1I0CA 4EMHA 3RDVA 1Y0MA 2K5IA 2A08A 2CT4A 1MV0B 1V29B 1YJNA 3TCJA 1SHGA 3NTIA 3I55Q 1PM3A 5A0LA 3T9NA 2KRMA 2HQEA 2X4YA 2X4XA 1T3LA 2QASA 4FYWB 2BZXA 5A2QE 4M78G 1DJ7B 2DM1A 2CGHA 1BKBA 3TREA 1WFWA 1OZ2A 3O5ZA 2LCLA 4M7DC 5CK9A 2Y90A 1NYGA 3HTRA 1QKWA 1WJQA 1PSEA 4J83A 1D09B 3CC2A 2P0KA 3H6ZA 4AMCA 4PJOC 2RH2A 3PIPA 1N5ZA 4HVWA 4IIOA 5J3BA 2AIRB 2KSSA 3I5RA 4FT4A 3FB9A 2ZPFB 1UDLA 4DOWA 3EG2A 4MMKA 3J80E 2ZPGB 5I2SA 1MMAA 3HHTB 3S3MA 2KI7A 2D8JA 4DBQA 4N4HA 3H0FA 5DY9A 3EFOA 3I55A 3RKXA 4C92A 2QA4Q 4ZTFA 2GFAA 2CZ7B 1N8RR 1AZEA 4M77E 2WACA 3WXMB 2DTIA 1M90U 3RMQA 4EPCA 2QQAA 1QW1A 1SKUB 3F70A 2YT6A 1PKSA 4LXCA 5GAN6 2CDTA 2KXDA 3A8OB 1BU1A 1AWOA 2J7IA 3DLMA 2LNVA 1PG5B 2E70A 2LX9A 1VQ9Q 4JUVA 5FWCA 1QCFA 1W1FA 1QVGS 1JJ2P 5LJ5d 1BI2A 2LQ8A 4IUQA 1K73C 3H8ZA 4F14A 3VS0A 3FRNA 3HSBA 1SEMA 1VQNQ 2DJQA 5LJ3g 2EJGA 2L3RA 4M77B 1BK2A 2MK5A 4QQ6A 3J81E 1M2VB 2DL8A 4OGCA 2VYTA 4M7DA 4OMLA 3G71Q 1BBZA 5CQXA 2P0QA 2HAXA 3OYHA 2YUQA 4J5YA 1KD1C 2LCSA 2KGTA 4EIKA 4PJOA 4BD3A 5FROA 2JW4A 1NJIR 4A54A 3QDFA 4OMMA 3UA6A 3URGA 4VUBA 3TU4K 1W70A 1KJWA 3M0QA 5CIUA 4HXJA 3M57A 4IUTA 1RADB 3CMET 3TSWA 2ROTA 1TG0A 2IVWA 2LJ0A 1VQLT 1AWWA 3EG0A 2DXBA 4GY5A 1M1KR 2EQKA 1VQ9A 3CC4Q 1YCYA 3BW1A 5IHIA 1Q7YC 3ZL7C 5CVIA 2FG0A 2DXTA 3BE3A 3OYYA 2RK2A 2XIDA 1G3TA 4IURA 3GP8A 4RTWA 2YRCA 3OSVA 1VQNA 3BY7A 3E2UA 1UGRB 1SRLA 4DBFA 3VRZA 1NEGA 4RKUE 3CPWP 4YTLA 5I11A 2AT1B 3P8DA 1WXUA 5L8RE 4ZGJB 5EG2A 4D8KA 2HZYA 4J9GA 3QUIA 1H3ZA 2A37A 5D6XA 3CCST 4C0DB 4M7DG 2ZAEA 2DL4A 1PRLC 4Z88A 5GMKj 5GAMf 5LJ5h 3JB9F 3QJYA 1UB4A 2OTJT 3CCSA 5LJ3j 3V8JA 4FYXB 3GOXA 1MGQA 2E64A 4PJOG 2ENMA 2LP5A 2HCKA 3VRYA 4ELYC 2QQ9A 1KHCA 3M0TA 4II1A 3OYFA 3PTAA 2OX7A 2ZPEB 2E65A 2V1RA 2DAQA 4UC4A 4RTUA 2ZPIB 3A1PA 4NL3A 3G4ST 1ZA2B 2NYSA 3L2WA 1RAHB 2DNUA 3CC4A 1RAEB 3OW2S 4DEYA 4J6YA 1ZSGA 2O2OA 1XTDA 1TS9A 4E7ZA 1G5VA 3HFNA 4FSSA 4PFPA 1IB8A 1KQSS 3S6WA 3HL8A 2XDPA 1FMVA 2PVOB 2K79A 2DVJA 1X6OA 2XICA 1X6BA 2XG8D 1H92A 3CXCP 1YITT 4L6V5 1SSHA 3QZ9B 1UGSB 4NL2A 3TEEA 2FZKB 2EIFA 4OMQA 1YITA 2QYZA 2D6FA 2RN8A 4WF2A 2MPXC 1M90C 3EGDB 3EGXA 1ACMB 2ECZA 2CS7A 1PNJA 4ZN3A 1GBRA 4IKFA 1OX9A 3WVEB 2EFIA 2JN0A 3A5ZB 2KR3A 4M77D 2XI9A 2MAMA 1PSFA 2DMOA 1VQ7Q 4JJCA 2XDDA 1KG1A 1TUDA 3JCMQ 2JXBA 2NLUA 2NUPA 4QT7A 1V76A 2CKKA 2F2XA 2B8AA 1PHTA 1ZSZB 3O8VA 1UE9A 2RJCA 3REBB 1NJIU 2KQWA 4PKCC 1FXXA 3OYCA 4BY6B 3PT9A 3META 1UTIA 3CBMA 2EBPA 3H41A 5ECAA 5FRMA 3NPFA 1YN8A 3A8LB 3M0SA 2VWFA 4ANJA 5IXFA 3M0UA 3WVDB 2K57A 2O4XB 2DA9A 4J9FA 3BDUA 5CR2A 5C0MA 5GJWB 2MCNA 3R6OA 4Z02A 2YDLA 1TTHB 5J26A 4RTTA 4M7AE 1U3OA 3I56Q 1I4K1 1NBEB 2EJ9A 4DA4A 4M75B 1WPYA 1WGSA 3HKSA 2EYQA 5KYWB 1N9RA 2D1XA 4A63B 4C8QF 3V8KA 4ZGDB 1Q81R 3LW5E 2VKNA 2AK5A 3TQ7P 5M9OA 3M56A 1VQ7A 3CMAQ 4J6WA 3CCJQ 3IQLA 1LJOA 4OB3B 2X3XD 1K76A 3VYGA 4BE1A 2GTOA 1U1TA 3MJXA 2FVUA 3HRTA 4RMOA 3CCUT 3UDCA 5GMKm 2RF0A 1YP5A 2RHIA 4KGXB 5GAN3 1GCPA 5IHKA 2RQTA 3R6NA 1AHJB 2RM4A 1QVGA 2MIOA 1H8KA 1PC0A 1QP3A 1VQMT 2K4YA 2M0OA 5KYUA 4M7AB 2KY9A 4PLIA 1RAGB 4OGEA 2LX7A 1VQMA 1JO8A 3SEMA 4BE2A 2RI2A 3OBWA 2DJZA 3VV0A 2QDYB 3CD6Q 3QYHB 4HCKA 1WJSA 4AFSC 4WTOB 4CC7A 3I56A 1KHIA 3EH2A 2R57A 4M78E 4N0AC 3RERA 1QVPA 3CBOA 4L59A 2CSQA 4B9XA 1VQOT 3OYEA 5CKEA 2DBKA 2YRVA 1W6XA 1VQOA 4A4KA 4OB1B 3RBBB 3CCJA 1JJ2S 1PD0A 1YHQT 1WA7A 2L89A 1Y71A 4C92F 4XU1A 1M1GA 2HNIA 2EYYA 1AEYA 1YHQA 2XKOC 1RAIB 4E7KA 1VQPT 4KRTA 1WHGA 5IAYA 4E7IA 1C6VX 1UHCA 5LJ5f 2O88A 3REAB 4C0ZA 1D0XA 1X69A 1RLQC 2NUTA 5IXBA 4J9DA 2DXUA 1UJYA 3EG9B 3MPUB 3M0RA 4M78B 1AZGB 2GTJA 3DKMA 4C8QE 3JB9G 1HYOA 3EFSA 3M9QA 3JCMc 1HXDA 1HSQA 1OPLA 4RTZA 1K8AU 1G2BA 1OEBA 4J9EA 1IREB 4FM4B 3UF4A 2GFUA 1X6GA 1FYNA 2K5LA 1M3BA 2E12A 1BIAA 4XAXB 3OS0A 2VC8A 3NGPA 1KC8R 4KGZB 4FCYA 2L3SA 1B07A 4GBQA 5DLQE 4QVZA 2DL7A 2OI3A 1J3TA 1LPLA 2PNIA 3MEVA 3OYLA 5FU6C 1GFDA 2VUBA 3G6ET 4PJOF 2RHYA 1VQ6Q 2BTTA 2NWMA 2EQUA 4N0AA 1X75C 3ZFJA 2FYKA 1Q82C 4M75D 2FRYA 1ZA1B 3JCMX 3OSSC 3OW2A 1Z9QA 1MUZA 1KFZA 4KUIA 4JPBW 3E1SA 3I9QA 1BI0A 3X28B 2EGAA 1K9MR 3CCVQ 3JB9J 2J06A 1K1ZA 1KQSA 2W0ZA 1NLOC 1YJWQ 4IIMA 1WJRA 1YJNT 1IZ6A 3LX7A 2XHCA 3NTKA 4E7JA 4LD9K 3MEWA 2H3JA 2PU9B 4OMNA 2F2WA 4FL6A 2A28A 3LGLA 4LNPA 4C92E 2CT3A 2QEXQ 4M7AD 2K3BA 2BE9B 3UWNA 5HKCA 2A36A 3RNJA 5KYXA 1ZUUA 1D3BA 2KDSA 1GXIE 2X51A 5KYYA 3GNFB 2PTKA 2KT1A 4X9CA 3L42A 1VQKT 4J9HA 2DD5A 4OVAA 5FU7B 4PLLA 1A0NB 1VQ6A 1IGUA 4LUDA 4PJJA 8AT1B 5IHNA 3RKWA 3CC2T 1VQKA 4OMOA 2KT8A 2DEUA 5GANd 3CCMQ 3EFOB 4FIBA 2YUOA 4LD6A 4XU2A 2PVGB 2K5FA 2AZVA 2RQWA 2RI5A 5FW9A 2DE0X 1QKXA 2YHTA 1EX4A 3CC7Q 4M7DE 3I55T 2HBPA 3CCEQ 3GF5A 1YI2Q 4EMKB 2KAFA 3VS1A 1O75A 4C8QG 2VXFA 2H8HA 2OTLQ 1W4SA 3THKA 4AFUC 1Q86R 1JU5C 4PJOE 1ZUYA 1JRIA 3VJPA 2QEXA 2MOXA 2Y4XA 4M78D 4GLMA 1G3WA 1U5SA 2LQKA 4O5VA 4XTUA 3PMIA 1D1CA 5D6YA 2FPFA 5GAN7 2L5QA 3I35A 3OS5A 4Z8AA 1LOJA 3OQ5A 2CZ0B
chains in the Genus database with same CATH topology
1T0JA 1ZX6A 2JMAA 4JJDA 4DEYA 2EYXA 1ZSGA 2O2OA 3A98A 3U23A 4RTYA 2GQIA 1RLPC 2SRCA 2KRNA 4FSSA 1QLYA 4LN2A 1JXMA 3FJ5A 2FO0A 2K9GA 2K79A 2DVJA 2LQNA 2GNCA 2PZ1A 1UGVA 1X6BA 1X43A 1CKAA 5L23A 1H92A 2IIMA 2QDLA 1RI9A 4HVVA 1SSHA 1UFFA 2P4RA 2DF6A 4OMQA 2HEQA 1K0SA 1QWEA 2HDAA 4X1VA 2I0NA 1V1CA 1AOJA 2RN8A 1E6HA 2ABLA 2ECZA 3NHNA 2YSQA 2XMFA 1PNJA 1Y57A 2C0OA 1I1JA 1PWTA 2K6DA 1GBRA 1UG1A 2KBTA 2LNHB 4AG2C 2KR3A 3C0CA 2DMOA 1UUEA 4JJCA 1TUDA 2DBMA 2JXBA 2KRSA 1VA7A 4QT7A 4Y92A 2F2XA 1IO6A 1G83A 2EGEA 1PHTA 2D0NA 1UE9A 3H0IA 3REBB 2M0YA 1CSKA 1FMKA 1HD3A 1ABQA 1UTIA 2GGRA 3VS4A 1VYUA 1GBQA 2EBPA 2VVKA 3H41A 1K4US 3JV3A 5ECAA 1M27C 3NPFA 1YN8A 3M0SA 3EHQA 2J05A 1YWPA 2VWFA 2DL3A 4F16A 4K11A 1WXBA 3VS5A 3M0UA 4J9CA 5IXFA 2J6FA 2KROA 2NUZA 2DA9A 4J9FA 2K7AA 1E6GA 1X2KA 5GJWB 4JZ3A 2MCNA 4DEXA 2YDLA 2K2MA 1BB9A 2DILA 1JQQA 1U3OA 4RTTA 4ORZA 1UJ0A 3GBQA 2RQRA 2AKKA 2CUDA 1M3CA 1JXOA 1B3QA 2D1XA 2ESWA 4A63B 4RUGA 2LJ1A 2VKNA 2AK5A 4OMPA 1NM7A 1NLPC 3VS7A 2KNBB 3UATA 1T0HA 3EG1A 5EC7A 3IQLA 2X3XD 2YUPA 1PRMC 1K76A 2AKLA 1WXTA 2FRWA 2GTOA 2EYZA 3SHWA 1KIKA 1M8MA 4RTVA 1LCKA 2M51A 1OPKA 3PVQA 2RF0A 2L0AA 1YP5A 2BZYA 1Z9ZA 2O9SA 1YNZA 1WYXA 3VS3A 4J9BA 1GCPA 2JTEA 5IHKA 2RQTA 1X2QA 3R6NA 4CC3A 4AFQC 3PVLA 2MIOA 1H8KA 1AVZC 2F2VA 1M30A 3M0PA 1ZLMA 2EVRA 2CH4W 2CH4A 2LX7A 2RQVA 1JO8A 3SEMA 1AD5A 2O31A 2CREA 2G6FX 1I0CA 4AG1C 4HCKA 2OAWA 2JM8A 1Y0MA 4AFSC 2A08A 3QWYA 2CT4A 3H0HA 1MV0B 4CC7A 1NYFA 1SHGA 2O9VA 2CSQA 1GCQC 2DBKA 2KRMA 2LMJA 2FEIA 3EGUA 1T3LA 1W6XA 2GBQA 2BZXA 3RBBB 2DM1A 2V1QA 1WA7A 2RQUA 3EG3A 2FPDA 1WFWA 2EYYA 1AEYA 4R0KA 1X27A 3O5ZA 3EHRA 2ROLA 2J6OA 4KRTA 5GJVB 1NYGA 2DX1A 1MV3A 1OOTA 1SPKA 1UHCA 4HVUA 1QKWA 2O88A 3REAB 1JEGA 1K0XA 4CC2A 1X69A 1RLQC 5IXBA 2EGCA 4J9DA 4JZ4A 1UJYA 2EKHA 3M0RA 3TSZA 1AZGB 1HJDA 1WLPB 1N5ZA 4HVWA 4IIOA 2EQIA 1T3SA 3I5RA 2GTJA 3ULRB 1UDLA 3EG2A 2DYBA 1HSQA 1OPLA 2C0TA 4RTZA 1H3HA 1G2BA 1OEBA 4J9EA 2D8JA 4ZNXA 3H0FA 3UF4A 2CSIA 1U06A 1X6GA 1EFNA 1FYNA 3TVTA 1NEBA 1GRIA 1M3BA 1ARKA 3NGPA 1AZEA 2L3SA 4D8DA 1B07A 2L2PA 4GBQA 2DL7A 2OI3A 2BZ8A 1J3TA 2PNIA 1SRMA 1ABOA 1GFDA 2ED0A 4M4ZA 1E7OA 2YT6A 2HBWA 1YCSB 5IH2A 1PKSA 2BTTA 2NWMA 2CDTA 2KXDA 5HCKA 1BU1A 1AWOA 2J7IA 2FRYA 4ESRA 1GCQA 1SHFA 3KFVA 4WCIA 3I5SA 1I07A 1ZUKA 5FWCA 1GL5A 1Z9QA 1QCFA 1W1FA 1MUZA 2L3PA 1KFZA 4JPBW 3I9QA 2EGAA 4F14A 2J06A 1AWXA 1K1ZA 3VS0A 4E6RA 5I22A 2W0ZA 1VYTA 2RMOA 1SEMA 1NLOC 2C0IA 4IIMA 2DJQA 4Z89A 3QWXX 2OJ2A 1WDXA 1BK2A 2DL8A 2EW3A 1AWJA 1UHFA 2JS0A 4OMLA 1M3AA 1TUCA 2DL5A 2KE9A 1BBZA 2B86A 2DRKA 2YUQA 2F2WA 4LNPA 2A28A 4OMNA 1ZBJA 3UA7A 1VYVA 4CC4B 1CKBA 2LCSA 2CT3A 2KGTA 1S1NA 4EIKA 2K3BA 4AFZC 1YWOA 2LJ3A 2LZ6B 2A36A 3RNJA 1NG2A 2EYWA 1ZUUA 2JW4A 3VS6A 4OMMA 3UA6A 1W70A 2DRMA 1KJWA 3M0QA 4HXJA 3NMZC 2PTKA 2KT1A 2YUNA 1A0NB 4J9HA 2CUBA 3TSWA 2ROTA 1TG0A 2LQWA 2LJ0A 2KYMA 4LUDA 1AWWA 3EG0A 2KEAA 5IHNA 4JJBA 2L3QA 1WI7A 2SEMA 4OMOA 2W10A 2KT8A 5IHIA 3ZL7C 2JS2A 1UECA 2FG0A 1GFCA 1WIEA 3CQTA 2YUOA 4RTWA 3LH5A 1XOVA 2RQWA 2AZVA 5FW9A 2DE0X 1QKXA 4J9IA 1SRLA 2EPDA 2HSPA 3VRZA 1NEGA 2D8HA 5I11A 4RTXA 1WXUA 1QWFA 5FWBA 1PKTA 2AZSA 1K9AA 3VS1A 4D8KA 4J9GA 2JMCA 2H8HA 3PE0A 2KXCA 2RPNA 2A37A 2ED1A 2JM9A 3THKA 4AFUC 1JU5C 2DL4A 1PRLC 1ZUYA 2KYBA 4Z88A 2J6KA 2MOXA 2E5KA 4GLMA 2FPEA 4LE9A 2DLPA 2RNAA 1U5SA 1OV3A 1WX6A 1RUWA 2ENMA 2LP5A 2X3WD 2HCKA 3VRYA 3M0TA 3VS2A 2FPFA 2V1RA 4F17A 3I35A 1KSWA 4RTUA 2JT4A 4Z8AA 4LUEA 2DNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0J A;  1ZX6 A;  2JMA A;  4JJD A;  4DEY A;  2EYX A;  1ZSG A;  2O2O A;  3A98 A;  3U23 A;  4RTY A;  2GQI A;  1RLP C;  2SRC A;  2KRN A;  4FSS A;  1QLY A;  4LN2 A;  1JXM A;  3FJ5 A;  2FO0 A;  2K9G A;  2K79 A;  2DVJ A;  2LQN A;  2GNC A;  2PZ1 A;  1UGV A;  1X6B A;  1X43 A;  1CKA A;  5L23 A;  1H92 A;  2IIM A;  2QDL A;  1RI9 A;  4HVV A;  1SSH A;  1UFF A;  2P4R A;  2DF6 A;  4OMQ A;  2HEQ A;  1K0S A;  1QWE A;  2HDA A;  4X1V A;  2I0N A;  1V1C A;  1AOJ A;  2RN8 A;  1E6H A;  2ABL A;  2ECZ A;  3NHN A;  2YSQ A;  2XMF A;  1PNJ A;  1Y57 A;  2C0O A;  1I1J A;  1PWT A;  2K6D A;  1GBR A;  1UG1 A;  2KBT A;  2LNH B;  4AG2 C;  2KR3 A;  3C0C A;  2DMO A;  1UUE A;  4JJC A;  1TUD A;  2DBM A;  2JXB A;  2KRS A;  1VA7 A;  4QT7 A;  4Y92 A;  2F2X A;  1IO6 A;  1G83 A;  2EGE A;  1PHT A;  2D0N A;  1UE9 A;  3H0I A;  3REB B;  2M0Y A;  1CSK A;  1FMK A;  1HD3 A;  1ABQ A;  1UTI A;  2GGR A;  3VS4 A;  1VYU A;  1GBQ A;  2EBP A;  2VVK A;  3H41 A;  1K4U S;  3JV3 A;  5ECA A;  1M27 C;  3NPF A;  1YN8 A;  3M0S A;  3EHQ A;  2J05 A;  1YWP A;  2VWF A;  2DL3 A;  4F16 A;  4K11 A;  1WXB A;  3VS5 A;  3M0U A;  4J9C A;  5IXF A;  2J6F A;  2KRO A;  2NUZ A;  2DA9 A;  4J9F A;  2K7A A;  1E6G A;  1X2K A;  5GJW B;  4JZ3 A;  2MCN A;  4DEX A;  2YDL A;  2K2M A;  1BB9 A;  2DIL A;  1JQQ A;  1U3O A;  4RTT A;  4ORZ A;  1UJ0 A;  3GBQ A;  2RQR A;  2AKK A;  2CUD A;  1M3C A;  1JXO A;  1B3Q A;  2D1X A;  2ESW A;  4A63 B;  4RUG A;  2LJ1 A;  2VKN A;  2AK5 A;  4OMP A;  1NM7 A;  1NLP C;  3VS7 A;  2KNB B;  3UAT A;  1T0H A;  3EG1 A;  5EC7 A;  3IQL A;  2X3X D;  2YUP A;  1PRM C;  1K76 A;  2AKL A;  1WXT A;  2FRW A;  2GTO A;  2EYZ A;  3SHW A;  1KIK A;  1M8M A;  4RTV A;  1LCK A;  2M51 A;  1OPK A;  3PVQ A;  2RF0 A;  2L0A A;  1YP5 A;  2BZY A;  1Z9Z A;  2O9S A;  1YNZ A;  1WYX A;  3VS3 A;  4J9B A;  1GCP A;  2JTE A;  5IHK A;  2RQT A;  1X2Q A;  3R6N A;  4CC3 A;  4AFQ C;  3PVL A;  2MIO A;  1H8K A;  1AVZ C;  2F2V A;  1M30 A;  3M0P A;  1ZLM A;  2EVR A;  2CH4 W;  2CH4 A;  2LX7 A;  2RQV A;  1JO8 A;  3SEM A;  1AD5 A;  2O31 A;  2CRE A;  2G6F X;  1I0C A;  4AG1 C;  4HCK A;  2OAW A;  2JM8 A;  1Y0M A;  4AFS C;  2A08 A;  3QWY A;  2CT4 A;  3H0H A;  1MV0 B;  4CC7 A;  1NYF A;  1SHG A;  2O9V A;  2CSQ A;  1GCQ C;  2DBK A;  2KRM A;  2LMJ A;  2FEI A;  3EGU A;  1T3L A;  1W6X A;  2GBQ A;  2BZX A;  3RBB B;  2DM1 A;  2V1Q A;  1WA7 A;  2RQU A;  3EG3 A;  2FPD A;  1WFW A;  2EYY A;  1AEY A;  4R0K A;  1X27 A;  3O5Z A;  3EHR A;  2ROL A;  2J6O A;  4KRT A;  5GJV B;  1NYG A;  2DX1 A;  1MV3 A;  1OOT A;  1SPK A;  1UHC A;  4HVU A;  1QKW A;  2O88 A;  3REA B;  1JEG A;  1K0X A;  4CC2 A;  1X69 A;  1RLQ C;  5IXB A;  2EGC A;  4J9D A;  4JZ4 A;  1UJY A;  2EKH A;  3M0R A;  3TSZ A;  1AZG B;  1HJD A;  1WLP B;  1N5Z A;  4HVW A;  4IIO A;  2EQI A;  1T3S A;  3I5R A;  2GTJ A;  3ULR B;  1UDL A;  3EG2 A;  2DYB A;  1HSQ A;  1OPL A;  2C0T A;  4RTZ A;  1H3H A;  1G2B A;  1OEB A;  4J9E A;  2D8J A;  4ZNX A;  3H0F A;  3UF4 A;  2CSI A;  1U06 A;  1X6G A;  1EFN A;  1FYN A;  3TVT A;  1NEB A;  1GRI A;  1M3B A;  1ARK A;  3NGP A;  1AZE A;  2L3S A;  4D8D A;  1B07 A;  2L2P A;  4GBQ A;  2DL7 A;  2OI3 A;  2BZ8 A;  1J3T A;  2PNI A;  1SRM A;  1ABO A;  1GFD A;  2ED0 A;  4M4Z A;  1E7O A;  2YT6 A;  2HBW A;  1YCS B;  5IH2 A;  1PKS A;  2BTT A;  2NWM A;  2CDT A;  2KXD A;  5HCK A;  1BU1 A;  1AWO A;  2J7I A;  2FRY A;  4ESR A;  1GCQ A;  1SHF A;  3KFV A;  4WCI A;  3I5S A;  1I07 A;  1ZUK A;  5FWC A;  1GL5 A;  1Z9Q A;  1QCF A;  1W1F A;  1MUZ A;  2L3P A;  1KFZ A;  4JPB W;  3I9Q A;  2EGA A;  4F14 A;  2J06 A;  1AWX A;  1K1Z A;  3VS0 A;  4E6R A;  5I22 A;  2W0Z A;  1VYT A;  2RMO A;  1SEM A;  1NLO C;  2C0I A;  4IIM A;  2DJQ A;  4Z89 A;  3QWX X;  2OJ2 A;  1WDX A;  1BK2 A;  2DL8 A;  2EW3 A;  1AWJ A;  1UHF A;  2JS0 A;  4OML A;  1M3A A;  1TUC A;  2DL5 A;  2KE9 A;  1BBZ A;  2B86 A;  2DRK A;  2YUQ A;  2F2W A;  4LNP A;  2A28 A;  4OMN A;  1ZBJ A;  3UA7 A;  1VYV A;  4CC4 B;  1CKB A;  2LCS A;  2CT3 A;  2KGT A;  1S1N A;  4EIK A;  2K3B A;  4AFZ C;  1YWO A;  2LJ3 A;  2LZ6 B;  2A36 A;  3RNJ A;  1NG2 A;  2EYW A;  1ZUU A;  2JW4 A;  3VS6 A;  4OMM A;  3UA6 A;  1W70 A;  2DRM A;  1KJW A;  3M0Q A;  4HXJ A;  3NMZ C;  2PTK A;  2KT1 A;  2YUN A;  1A0N B;  4J9H A;  2CUB A;  3TSW A;  2ROT A;  1TG0 A;  2LQW A;  2LJ0 A;  2KYM A;  4LUD A;  1AWW A;  3EG0 A;  2KEA A;  5IHN A;  4JJB A;  2L3Q A;  1WI7 A;  2SEM A;  4OMO A;  2W10 A;  2KT8 A;  5IHI A;  3ZL7 C;  2JS2 A;  1UEC A;  2FG0 A;  1GFC A;  1WIE A;  3CQT A;  2YUO A;  4RTW A;  3LH5 A;  1XOV A;  2RQW A;  2AZV A;  5FW9 A;  2DE0 X;  1QKX A;  4J9I A;  1SRL A;  2EPD A;  2HSP A;  3VRZ A;  1NEG A;  2D8H A;  5I11 A;  4RTX A;  1WXU A;  1QWF A;  5FWB A;  1PKT A;  2AZS A;  1K9A A;  3VS1 A;  4D8K A;  4J9G A;  2JMC A;  2H8H A;  3PE0 A;  2KXC A;  2RPN A;  2A37 A;  2ED1 A;  2JM9 A;  3THK A;  4AFU C;  1JU5 C;  2DL4 A;  1PRL C;  1ZUY A;  2KYB A;  4Z88 A;  2J6K A;  2MOX A;  2E5K A;  4GLM A;  2FPE A;  4LE9 A;  2DLP A;  2RNA A;  1U5S A;  1OV3 A;  1WX6 A;  1RUW A;  2ENM A;  2LP5 A;  2X3W D;  2HCK A;  3VRY A;  3M0T A;  3VS2 A;  2FPF A;  2V1R A;  4F17 A;  3I35 A;  1KSW A;  4RTU A;  2JT4 A;  4Z8A A;  4LUE A;  2DNU A; 
#chains in the Genus database with same CATH topology
 1ZX6 A;  2JMA A;  3ME9 A;  2KVQ G;  2JUF A;  4M7D B;  1Y07 A;  4JJD A;  4R56 A;  1VQ5 Q;  2LRQ A;  3CCM A;  2HKN A;  4MDW A;  3AT1 B;  3OYA A;  2DIG A;  3HP9 A;  4LN2 A;  1Y96 A;  3FJ5 A;  2PUO B;  1K8A C;  4PJO B;  2QQB A;  2LQN A;  2XK0 A;  2GNC A;  1O9S A;  3ER0 A;  4OP0 A;  4ZGE B;  2QGG A;  5GMK i;  3CCE A;  2IIM A;  2QDL A;  3INZ A;  1YI2 A;  2QA4 T;  3ZBD A;  2X4J A;  7AT1 B;  3A8G B;  3SD4 A;  1K9M U;  2BIV A;  3MO8 A;  4PFO A;  2QA4 A;  2I2L A;  3QBY A;  5GAN h;  5KYN A;  2R5A A;  2XMF A;  3C4S A;  2C0O A;  4C92 G;  1I1J A;  2YRD A;  3MEU A;  1BCM A;  3QZ5 B;  2VAS A;  2LNH B;  3LH0 A;  2YLC A;  1WNL A;  4X9D A;  3VU3 C;  2RO0 A;  1W2B S;  2V26 A;  4LDY A;  5GAN 4;  1VQ9 T;  1JJ2 A;  5GAO m;  2HKQ B;  1M2V A;  2DBM A;  2KRS A;  4RCB A;  2EWN A;  3LWH A;  5GMK e;  1IO6 A;  2EGE A;  3C94 A;  1FX7 A;  3M4G A;  4J7I A;  1VQ5 A;  2HL3 A;  5GAM g;  1VQN T;  3M53 A;  4E47 A;  4LDX A;  5LJ3 e;  1FMK A;  1WHK A;  1HD3 A;  2GGR A;  1FMW A;  3L2Z A;  3QXE B;  4BUG A;  2RB6 A;  3G71 T;  3X25 B;  3EH1 A;  2DO3 A;  2J05 A;  4MZM A;  1YWP A;  3JCM d;  1F1B B;  4F16 A;  4ELZ C;  3G71 A;  2JZ2 A;  3VS5 A;  4J9C A;  3CCR Q;  4F04 B;  1XJW B;  2K7A A;  4BB7 A;  4F7U F;  4FW2 A;  4QQG A;  4DEX A;  4ATO A;  4E2F B;  1JQQ A;  3X20 B;  2EKO A;  4ORZ A;  1UJ0 A;  1LNX A;  3GBQ A;  5A0D A;  4B9W A;  4XTV A;  1S72 Q;  1B34 B;  1M3C A;  1JXO A;  2LJ1 A;  2LT1 A;  2WSF E;  4OMP A;  1NM7 A;  4PL6 A;  3UAT A;  1T0H A;  3CC4 T;  5EC7 A;  3D7S B;  1N8R U;  1Q86 U;  2IG0 A;  2E10 A;  2YUP A;  1PRM C;  4EMG A;  2FRW A;  3JB9 I;  1KIK A;  2E3H A;  4CRI A;  3KBG A;  2GQV A;  4IUV A;  3H9N A;  2L0A A;  1XQH A;  2HL5 C;  2O9S A;  1YNZ A;  1WYX A;  2JTE A;  1BYM A;  1ZQ1 A;  1X2Q A;  2HSE B;  3RMS A;  3OYK A;  1M4Z A;  4BY6 C;  4LDU A;  1AVZ C;  1ZLM A;  2EVR A;  2JTF A;  4RCC A;  3V8L A;  3CCL Q;  1BI3 A;  2RQV A;  2M02 A;  1AD5 A;  2A3L A;  2O31 A;  3UT1 A;  2CRE A;  5GAM j;  4JS5 A;  2MYS A;  1VIF A;  4AG1 C;  3CBP A;  2F5K A;  2JM8 A;  2OAW A;  3M54 A;  3OMC A;  4KBM B;  2NUP B;  2DYI A;  3QDR B;  1S72 A;  2O9V A;  2K3X A;  3OA6 A;  1GCQ C;  5FRN A;  2FEI A;  4E7L A;  2A7Y A;  4M75 C;  2ZPH B;  2F1L A;  3MKD A;  2JNG A;  2V1Q A;  2MWO A;  3AHU A;  3HRU A;  1R0C B;  3EG3 A;  3QKJ A;  1BI1 A;  3M5A A;  5AYF A;  4PJM A;  2QQR A;  1X27 A;  1M2O A;  2EAY A;  2ROL A;  2J6O A;  1G3Y A;  2FHD A;  2L8D A;  1MV3 A;  3NFC A;  1OOT A;  1SPK A;  1D0Y A;  1JEG A;  2E5Q A;  1K0X A;  3CCL T;  4JS4 A;  2AHJ B;  1M1K U;  1QQJ A;  2DTH A;  5GAN 5;  1K73 R;  1H64 1;  1QCO A;  3CCL A;  2YXY A;  1WLP B;  3PNW C;  2EQI A;  5KH6 A;  1VIE A;  2E41 A;  2DYB A;  3L2V A;  4XTW A;  3LLR A;  1VQ8 Q;  2ZZD A;  2QK0 A;  1ZSZ A;  4FU6 A;  1RAC B;  1U1S A;  4HKE A;  4KUL A;  2DTO A;  2QG9 B;  2DIQ A;  4FYV B;  1QVG P;  1U06 A;  1OU9 A;  1VQ7 T;  3TVT A;  4JRK A;  3QYG B;  1GRI A;  1KD1 R;  2JJ9 A;  3MP1 A;  2L2P A;  3JCM W;  2XDB A;  3SWN B;  4LDV A;  2VB6 A;  1SRM A;  4DBR A;  1TU0 B;  4OB0 B;  1ABO A;  5KYU B;  3CPF A;  4M4Z A;  2HBW A;  4JRP A;  5LJ3 d;  2DPP B;  5KCH A;  3RKY A;  3QSU A;  4ESR A;  1BIB A;  2F69 A;  1GCQ A;  1SHF A;  3KFV A;  3I5S A;  2WSE E;  4F7U A;  5GAN f;  4M75 A;  1Q7Y R;  5GAN e;  3JAM E;  5KYW A;  1JB0 E;  1AWX A;  3CCQ Q;  1VYT A;  5IN1 A;  3QII A;  6AT1 B;  3I56 T;  4Z89 A;  1YFN A;  3QWX X;  4JJN K;  1WDX A;  3L1A A;  1VQ8 A;  1AWJ A;  1UHF A;  1TUC A;  2JOY A;  2XD0 A;  2CZ1 B;  2B86 A;  2DRK A;  3CMA T;  5LJ5 g;  1VYV A;  5CAI A;  1CKB A;  4E7H A;  3CCJ T;  5KE3 A;  1N8R C;  4AFZ C;  1YWO A;  4IUP A;  3CMA A;  2LZ6 B;  2EYW A;  4DBH A;  1OZ3 A;  2RJD A;  2NUT B;  4QVD A;  1WHH A;  1W2B A;  1U8R A;  4C0G A;  1VQ4 Q;  3NMZ C;  2MF2 A;  2CUB A;  2KYM A;  5HK3 A;  2CYZ B;  1G8X A;  1YJ9 Q;  1WI7 A;  2SEM A;  3SFM A;  3MCA B;  1QCN A;  1UEC A;  1GFC A;  4EDU A;  1IHV A;  2DZC A;  2FZC B;  3GLX A;  1NZ9 A;  3OB9 A;  2RA2 A;  3CD6 T;  4XK8 E;  4BAC A;  1XOV A;  4F7U G;  4M75 G;  1YIJ Q;  5GMK h;  4J9I A;  2HSP A;  4MML A;  3CD6 A;  2FL7 A;  4V2S A;  5CKB A;  4C5I A;  1MMG A;  5LJ3 h;  2BKD N;  2Y4Y A;  1WQ7 A;  1QWF A;  5FWB A;  1PKT A;  2AZS A;  5CQY A;  1K9A A;  1OI1 A;  2D0Q B;  2JMC A;  3PE0 A;  2KXC A;  3JSC A;  3E9F A;  2ZCF B;  2DEQ A;  5GAO p;  1QVF P;  2ED1 A;  3GPL A;  2E6Z A;  4OMF B;  1M90 R;  2X35 A;  4NS5 A;  4IUU A;  2E5K A;  2FPE A;  2RD1 A;  3M4Y A;  5GAO l;  1NJI C;  3JCM J;  4HA8 A;  3GIB A;  2RNA A;  3RIR A;  1OV3 A;  1WX6 A;  2MWP A;  4Q5W A;  4QVC A;  2X3W D;  1N6A A;  1HK9 A;  2E4H A;  4BI3 A;  3QG1 A;  3M58 A;  2O01 E;  3S3N A;  3L2U A;  2E3I A;  4F17 A;  1Q81 U;  5LJ5 j;  3CPW S;  4C8Q B;  3EAE A;  1KSW A;  2JT4 A;  4GLK A;  1M1K C;  2RK1 A;  5DM7 R;  4XTX A;  4XU0 A;  4J8O A;  5FU7 C;  1M8V A;  2EYX A;  1ZHI A;  2KK4 A;  3U23 A;  3OY9 A;  4M77 F;  2CP5 A;  2GQI A;  3M59 A;  1RLP C;  2RHX A;  2SRC A;  1PD1 A;  1QLY A;  4ZTJ A;  3HRS A;  3JB9 D;  4JDS A;  2FO0 A;  3E9G A;  1KQ1 A;  3JCM f;  2PZ1 A;  1UGV A;  3QPH A;  4C5G A;  1X43 A;  3JCM e;  5L23 A;  3G7Z A;  2R58 A;  3ASK A;  1Q7Y U;  4P5N A;  3FEO A;  2DVE A;  3OBY A;  1UEB A;  1UFF A;  2DF6 A;  3V7S A;  1K0S A;  1QWE A;  4X1V A;  4O6J A;  1V1C A;  1NPR A;  3LYI A;  3E19 A;  1I8F A;  1R77 A;  1C1A A;  1E6H A;  1IGQ A;  2LDM A;  3NHN A;  3OYD A;  4RG8 A;  3J7A F;  1P92 A;  1Y57 A;  5HK0 A;  1IRX A;  4A53 A;  1VQ6 T;  2K2V A;  2KBT A;  3RUX A;  5GAO r;  5CO7 A;  1UUE A;  5FU6 B;  3Q1J A;  2MMP A;  3MEA A;  9ATC B;  2RJE A;  1IHW A;  3LGF A;  3L2Q A;  1VA7 A;  4Y92 A;  3VUB A;  3CCV T;  3CXC S;  3EFR A;  1G83 A;  2QAZ A;  2X9H A;  3H0I A;  4BDZ A;  1YJW T;  3CCV A;  3CEY A;  2M0Y A;  1CSK A;  4C92 B;  4E7S A;  3VS4 A;  3UPU A;  3PGG A;  1YJW A;  4PNO A;  3JV3 A;  3DB4 A;  3JCM b;  4KT0 E;  1M27 C;  3X24 B;  4DQ2 A;  2M1H A;  2EJF A;  4HCC A;  2FB7 A;  2P0P A;  1WXB A;  4M77 C;  2QEX T;  1OU8 A;  3DB3 A;  1D0Z A;  3A8H B;  3MP6 A;  4JRI A;  4JZ3 A;  1UGP B;  1WHM A;  1QMC A;  4L5G A;  2DIL A;  1VOM A;  1B3Q A;  2ESW A;  2RJF A;  4X34 A;  1NLP C;  3VKI A;  3VS7 A;  1PCX A;  5KE2 A;  1Y96 B;  4FSX A;  1KC8 U;  2BE7 D;  3CCM T;  4EMK A;  2EYZ A;  3RES A;  3SHW A;  5GAN 2;  1M8M A;  4RTV A;  2M51 A;  3SDZ A;  1OPK A;  2MI6 A;  3DLL A;  2BZY A;  4J9B A;  3M55 A;  1D1B A;  3CC7 T;  4HCB A;  2V8J A;  4CC3 A;  3CCE T;  3PVL A;  3CME Q;  1YI2 T;  2C06 A;  1VQL Q;  1M30 A;  1R8O B;  3CC7 A;  1OYX A;  1RAF B;  2CH4 W;  2OTL T;  2EQJ A;  4N4G A;  3OYB A;  2CH4 A;  3QJ6 A;  2VGN A;  4C8Q D;  2LVM A;  2EQM A;  2QI2 A;  4FYY B;  2OTL A;  3SB2 A;  4R55 A;  2G6F X;  1I5O B;  2D9T A;  3QWY A;  4D6W A;  3FIF A;  2CP7 A;  3H0H A;  2HQX A;  2QXF A;  1NYF A;  3RR6 A;  4C0D C;  1RAA B;  4OB2 B;  1VUB A;  5C6S A;  1QP2 A;  2LMJ A;  3V7R A;  1Q81 C;  2DK3 A;  3EGU A;  4Y28 E;  2GBQ A;  4M77 A;  5GMK l;  1SSF A;  2ATC B;  2BUD A;  2PVD B;  5KCO A;  3OYG A;  1VQ5 T;  4ZN1 A;  3CCS Q;  8ATC B;  4XTY A;  1RAB B;  4PK4 A;  2RQU A;  4BE0 A;  1MHN A;  2OTJ Q;  2FPD A;  5LJ3 f;  5D6W A;  4KH1 B;  4A4E A;  4R0K A;  1SG5 A;  3EHR A;  2PQW A;  1Q82 R;  2COW A;  2GF7 A;  5GJV B;  4N4I A;  2DX1 A;  2PUK B;  1NPP A;  4HVU A;  1TXQ A;  3CME A;  4LDW A;  4CC2 A;  1VQL A;  3PMT A;  2EGC A;  3GNG A;  3G4S Q;  4JZ4 A;  2EKH A;  2DZ9 A;  3TSZ A;  1HJD A;  3NTH A;  1T3S A;  3ULR B;  1WZO A;  4M75 F;  2X4W A;  1M9S A;  2P84 A;  1TWB A;  2C0T A;  1ZBX A;  1H3H A;  2HMA A;  2YLB A;  4C92 D;  4ZNX A;  2CSI A;  4XTZ A;  2G3R A;  1EFN A;  1NEB A;  1YIT Q;  1LVK A;  5GAO q;  1ARK A;  4JLI A;  1RI0 A;  4HCZ A;  4D8D A;  2BZ8 A;  4B6M A;  3JRZ A;  5GAM e;  3OYJ A;  2P4T A;  3MHX A;  3N5B B;  2ED0 A;  2OTJ A;  1E7O A;  4M77 G;  1YCS B;  5IH2 A;  1TOV A;  3CPW A;  5HCK A;  1ZSZ C;  4M7A F;  3BFM A;  4BDY A;  4HT9 A;  3OYN A;  3L2R A;  4WCI A;  1I07 A;  1OX8 A;  1M1F A;  1ZUK A;  3EGX B;  1GL5 A;  3CCR T;  3FLG A;  2L3P A;  4ME7 A;  3PIO A;  1B34 A;  3G4S A;  4A4H A;  4JLG A;  3P8B B;  1QVF S;  3CCR A;  2ZPB B;  4E6R A;  5I22 A;  5I2M A;  2RMO A;  2C0I A;  3A8M B;  4M7D D;  1TUG B;  2OJ2 A;  4PJN A;  1S72 T;  3C95 A;  3VYH B;  2EW3 A;  1I5L A;  2JS0 A;  2WSC E;  1M3A A;  2QTX A;  2DL5 A;  2KE9 A;  1KK7 A;  4CC4 B;  3FDR A;  3FC3 A;  1ZBJ A;  3UA7 A;  4PJO D;  4FT2 A;  1S1N A;  4AT1 B;  3JCM h;  4KUD K;  1KC8 C;  2LJ3 A;  1NG2 A;  1MND A;  3BDL A;  1I81 A;  3G1J A;  2LT4 A;  3VS6 A;  3PFS A;  2DRM A;  4MDX A;  1Y7X A;  3SWN C;  1WQW A;  2YUN A;  4HT8 A;  3MP8 A;  2LQW A;  2HD0 A;  2KEA A;  3EGD A;  4XQ3 A;  2GCX A;  5CKH A;  3OS1 A;  3CXC A;  1RL2 A;  1R0B G;  4JJB A;  4M78 F;  2L3Q A;  4F7U E;  4M75 E;  2W10 A;  2JS2 A;  3JCM P;  1K9M C;  2ZGW A;  1BCO A;  1XNI A;  1WIE A;  1X01 A;  3CQT A;  5I21 A;  3LH5 A;  3S3O A;  3CCU Q;  4M7A C;  1K8A R;  1IXD A;  2R5M A;  2RI3 A;  2K3Y A;  2DXC A;  2EPD A;  1Q82 U;  2D8H A;  2DET A;  4QQD A;  4TVR A;  2CP2 A;  4RTX A;  5CKF A;  1MNE A;  2DER A;  5DLO A;  1VQM Q;  2RPN A;  4JRQ A;  3C12 A;  5GAN g;  2JM9 A;  2KYB A;  2CP3 A;  2J6K A;  2QGF B;  4LE9 A;  2DLP A;  1B7T A;  2CP0 A;  4F7U B;  3QHS A;  2CZ6 B;  2COZ A;  1RUW A;  2O4X A;  1VQO Q;  3VS2 A;  2F5T X;  3OYI A;  3VUZ A;  2KMT A;  4LUE A;  1MMD A;  1T0J A;  2QTV A;  4Y91 A;  1YHQ Q;  3KUF A;  4BI4 A;  3A98 A;  4RTY A;  4PJL A;  4MZP A;  5LL6 S;  2KRN A;  1VQ8 T;  2Z0W A;  1M5Q 1;  3CCU A;  1JXM A;  3JCM V;  1W2B P;  2K9G A;  4M78 C;  3SWN A;  2FZG B;  1VQP Q;  2RHU A;  3P8H A;  1CKA A;  4CI0 C;  2OAU A;  3FJP A;  1RI9 A;  4HVV A;  1NE8 A;  2P4R A;  2HEQ A;  2HDA A;  2I0N A;  1KQ2 A;  4PFZ A;  2IPO B;  1Q86 C;  1AOJ A;  2ABL A;  5AT1 B;  5GAO n;  5GAM d;  2YSQ A;  4M7A A;  2CP6 A;  5CCA A;  1PWT A;  2JTM A;  2K6D A;  4C0F A;  2H3E B;  5FLX E;  1UG1 A;  4AG2 C;  3C0C A;  2M16 A;  2HQH A;  3QO3 A;  1WHJ A;  2M9U A;  1D1A A;  3LWI A;  5GAN j;  5D7U A;  3CCQ T;  2DKG A;  2D0N A;  1UGQ B;  4C8Q C;  3OYM A;  2LC4 A;  3CCQ A;  4DOV A;  1ABQ A;  4A4G A;  1EIF A;  1SF9 A;  2V8K A;  3G6E Q;  1VYU A;  1GBQ A;  2VVK A;  1FWZ A;  3HFO A;  1K4U S;  1G3S A;  3V7C A;  4KGV B;  5CKD A;  1Q95 G;  1MMN A;  1VQP A;  2YWW A;  3EHQ A;  3X26 B;  5LJ5 e;  4KH0 B;  4C5E A;  2DL3 A;  2COY A;  2E6N A;  4K11 A;  2DD4 A;  2RHZ A;  2J6F A;  3KXT A;  2KRO A;  3OW2 P;  2NUZ A;  5J39 A;  5IT9 E;  2LCC A;  1K73 U;  1E6G A;  1X2K A;  2XU8 A;  4XU3 A;  1KQS P;  2K2M A;  1BB9 A;  1YJN Q;  1C0M A;  2LTO A;  4J7F A;  1YBY A;  2RQR A;  3EG9 A;  1VQ4 T;  2AKK A;  2CUD A;  4M78 A;  2VXE A;  4MZT A;  3JCM g;  4RUG A;  1VQ4 A;  1N9S A;  4RG2 A;  1N27 A;  4M7A G;  1YJ9 T;  1KD1 U;  5GAN 8;  2V8I A;  4FW1 A;  4M7D F;  2KNB B;  5A0G A;  3EG1 A;  1OQK A;  4J6X A;  3ZEH A;  2AKL A;  1WXT A;  1YJ9 A;  4NOY A;  2VGM A;  4OF1 A;  4C5H A;  1LCK A;  2JVV A;  1YIJ T;  3PVQ A;  4QW2 A;  2E1H A;  3HPW A;  4BI8 B;  1Z9Z A;  3VS3 A;  5GAM h;  1TH7 A;  3JB9 H;  3G6E A;  1JBM A;  1YIJ A;  1TSF A;  4AFQ C;  1WHL A;  1OUL A;  1VQK Q;  3OMG A;  5KYX B;  2F2V A;  3M0P A;  2DFU A;  1D3B B;  3CC2 Q;  4C92 C;  1QVF A;  1EZZ B;  4QKU A;  4A4F A;  2VV5 A;  5KYY B;  2A0F B;  3OS2 A;  5HY6 A;  2QQS A;  4EMK C;  4C8Q A;  1AT1 B;  1I0C A;  4EMH A;  3RDV A;  1Y0M A;  2K5I A;  2A08 A;  2CT4 A;  1MV0 B;  1V29 B;  1YJN A;  3TCJ A;  1SHG A;  3NTI A;  3I55 Q;  1PM3 A;  5A0L A;  3T9N A;  2KRM A;  2HQE A;  2X4Y A;  2X4X A;  1T3L A;  2QAS A;  4FYW B;  2BZX A;  5A2Q E;  4M78 G;  1DJ7 B;  2DM1 A;  2CGH A;  1BKB A;  3TRE A;  1WFW A;  1OZ2 A;  3O5Z A;  2LCL A;  4M7D C;  5CK9 A;  2Y90 A;  1NYG A;  3HTR A;  1QKW A;  1WJQ A;  1PSE A;  4J83 A;  1D09 B;  3CC2 A;  2P0K A;  3H6Z A;  4AMC A;  4PJO C;  2RH2 A;  3PIP A;  1N5Z A;  4HVW A;  4IIO A;  5J3B A;  2AIR B;  2KSS A;  3I5R A;  4FT4 A;  3FB9 A;  2ZPF B;  1UDL A;  4DOW A;  3EG2 A;  4MMK A;  3J80 E;  2ZPG B;  5I2S A;  1MMA A;  3HHT B;  3S3M A;  2KI7 A;  2D8J A;  4DBQ A;  4N4H A;  3H0F A;  5DY9 A;  3EFO A;  3I55 A;  3RKX A;  4C92 A;  2QA4 Q;  4ZTF A;  2GFA A;  2CZ7 B;  1N8R R;  1AZE A;  4M77 E;  2WAC A;  3WXM B;  2DTI A;  1M90 U;  3RMQ A;  4EPC A;  2QQA A;  1QW1 A;  1SKU B;  3F70 A;  2YT6 A;  1PKS A;  4LXC A;  5GAN 6;  2CDT A;  2KXD A;  3A8O B;  1BU1 A;  1AWO A;  2J7I A;  3DLM A;  2LNV A;  1PG5 B;  2E70 A;  2LX9 A;  1VQ9 Q;  4JUV A;  5FWC A;  1QCF A;  1W1F A;  1QVG S;  1JJ2 P;  5LJ5 d;  1BI2 A;  2LQ8 A;  4IUQ A;  1K73 C;  3H8Z A;  4F14 A;  3VS0 A;  3FRN A;  3HSB A;  1SEM A;  1VQN Q;  2DJQ A;  5LJ3 g;  2EJG A;  2L3R A;  4M77 B;  1BK2 A;  2MK5 A;  4QQ6 A;  3J81 E;  1M2V B;  2DL8 A;  4OGC A;  2VYT A;  4M7D A;  4OML A;  3G71 Q;  1BBZ A;  5CQX A;  2P0Q A;  2HAX A;  3OYH A;  2YUQ A;  4J5Y A;  1KD1 C;  2LCS A;  2KGT A;  4EIK A;  4PJO A;  4BD3 A;  5FRO A;  2JW4 A;  1NJI R;  4A54 A;  3QDF A;  4OMM A;  3UA6 A;  3URG A;  4VUB A;  3TU4 K;  1W70 A;  1KJW A;  3M0Q A;  5CIU A;  4HXJ A;  3M57 A;  4IUT A;  1RAD B;  3CME T;  3TSW A;  2ROT A;  1TG0 A;  2IVW A;  2LJ0 A;  1VQL T;  1AWW A;  3EG0 A;  2DXB A;  4GY5 A;  1M1K R;  2EQK A;  1VQ9 A;  3CC4 Q;  1YCY A;  3BW1 A;  5IHI A;  1Q7Y C;  3ZL7 C;  5CVI A;  2FG0 A;  2DXT A;  3BE3 A;  3OYY A;  2RK2 A;  2XID A;  1G3T A;  4IUR A;  3GP8 A;  4RTW A;  2YRC A;  3OSV A;  1VQN A;  3BY7 A;  3E2U A;  1UGR B;  1SRL A;  4DBF A;  3VRZ A;  1NEG A;  4RKU E;  3CPW P;  4YTL A;  5I11 A;  2AT1 B;  3P8D A;  1WXU A;  5L8R E;  4ZGJ B;  5EG2 A;  4D8K A;  2HZY A;  4J9G A;  3QUI A;  1H3Z A;  2A37 A;  5D6X A;  3CCS T;  4C0D B;  4M7D G;  2ZAE A;  2DL4 A;  1PRL C;  4Z88 A;  5GMK j;  5GAM f;  5LJ5 h;  3JB9 F;  3QJY A;  1UB4 A;  2OTJ T;  3CCS A;  5LJ3 j;  3V8J A;  4FYX B;  3GOX A;  1MGQ A;  2E64 A;  4PJO G;  2ENM A;  2LP5 A;  2HCK A;  3VRY A;  4ELY C;  2QQ9 A;  1KHC A;  3M0T A;  4II1 A;  3OYF A;  3PTA A;  2OX7 A;  2ZPE B;  2E65 A;  2V1R A;  2DAQ A;  4UC4 A;  4RTU A;  2ZPI B;  3A1P A;  4NL3 A;  3G4S T;  1ZA2 B;  2NYS A;  3L2W A;  1RAH B;  2DNU A;  3CC4 A;  1RAE B;  3OW2 S;  4DEY A;  4J6Y A;  1ZSG A;  2O2O A;  1XTD A;  1TS9 A;  4E7Z A;  1G5V A;  3HFN A;  4FSS A;  4PFP A;  1IB8 A;  1KQS S;  3S6W A;  3HL8 A;  2XDP A;  1FMV A;  2PVO B;  2K79 A;  2DVJ A;  1X6O A;  2XIC A;  1X6B A;  2XG8 D;  1H92 A;  3CXC P;  1YIT T;  4L6V 5;  1SSH A;  3QZ9 B;  1UGS B;  4NL2 A;  3TEE A;  2FZK B;  2EIF A;  4OMQ A;  1YIT A;  2QYZ A;  2D6F A;  2RN8 A;  4WF2 A;  2MPX C;  1M90 C;  3EGD B;  3EGX A;  1ACM B;  2ECZ A;  2CS7 A;  1PNJ A;  4ZN3 A;  1GBR A;  4IKF A;  1OX9 A;  3WVE B;  2EFI A;  2JN0 A;  3A5Z B;  2KR3 A;  4M77 D;  2XI9 A;  2MAM A;  1PSF A;  2DMO A;  1VQ7 Q;  4JJC A;  2XDD A;  1KG1 A;  1TUD A;  3JCM Q;  2JXB A;  2NLU A;  2NUP A;  4QT7 A;  1V76 A;  2CKK A;  2F2X A;  2B8A A;  1PHT A;  1ZSZ B;  3O8V A;  1UE9 A;  2RJC A;  3REB B;  1NJI U;  2KQW A;  4PKC C;  1FXX A;  3OYC A;  4BY6 B;  3PT9 A;  3MET A;  1UTI A;  3CBM A;  2EBP A;  3H41 A;  5ECA A;  5FRM A;  3NPF A;  1YN8 A;  3A8L B;  3M0S A;  2VWF A;  4ANJ A;  5IXF A;  3M0U A;  3WVD B;  2K57 A;  2O4X B;  2DA9 A;  4J9F A;  3BDU A;  5CR2 A;  5C0M A;  5GJW B;  2MCN A;  3R6O A;  4Z02 A;  2YDL A;  1TTH B;  5J26 A;  4RTT A;  4M7A E;  1U3O A;  3I56 Q;  1I4K 1;  1NBE B;  2EJ9 A;  4DA4 A;  4M75 B;  1WPY A;  1WGS A;  3HKS A;  2EYQ A;  5KYW B;  1N9R A;  2D1X A;  4A63 B;  4C8Q F;  3V8K A;  4ZGD B;  1Q81 R;  3LW5 E;  2VKN A;  2AK5 A;  3TQ7 P;  5M9O A;  3M56 A;  1VQ7 A;  3CMA Q;  4J6W A;  3CCJ Q;  3IQL A;  1LJO A;  4OB3 B;  2X3X D;  1K76 A;  3VYG A;  4BE1 A;  2GTO A;  1U1T A;  3MJX A;  2FVU A;  3HRT A;  4RMO A;  3CCU T;  3UDC A;  5GMK m;  2RF0 A;  1YP5 A;  2RHI A;  4KGX B;  5GAN 3;  1GCP A;  5IHK A;  2RQT A;  3R6N A;  1AHJ B;  2RM4 A;  1QVG A;  2MIO A;  1H8K A;  1PC0 A;  1QP3 A;  1VQM T;  2K4Y A;  2M0O A;  5KYU A;  4M7A B;  2KY9 A;  4PLI A;  1RAG B;  4OGE A;  2LX7 A;  1VQM A;  1JO8 A;  3SEM A;  4BE2 A;  2RI2 A;  3OBW A;  2DJZ A;  3VV0 A;  2QDY B;  3CD6 Q;  3QYH B;  4HCK A;  1WJS A;  4AFS C;  4WTO B;  4CC7 A;  3I56 A;  1KHI A;  3EH2 A;  2R57 A;  4M78 E;  4N0A C;  3RER A;  1QVP A;  3CBO A;  4L59 A;  2CSQ A;  4B9X A;  1VQO T;  3OYE A;  5CKE A;  2DBK A;  2YRV A;  1W6X A;  1VQO A;  4A4K A;  4OB1 B;  3RBB B;  3CCJ A;  1JJ2 S;  1PD0 A;  1YHQ T;  1WA7 A;  2L89 A;  1Y71 A;  4C92 F;  4XU1 A;  1M1G A;  2HNI A;  2EYY A;  1AEY A;  1YHQ A;  2XKO C;  1RAI B;  4E7K A;  1VQP T;  4KRT A;  1WHG A;  5IAY A;  4E7I A;  1C6V X;  1UHC A;  5LJ5 f;  2O88 A;  3REA B;  4C0Z A;  1D0X A;  1X69 A;  1RLQ C;  2NUT A;  5IXB A;  4J9D A;  2DXU A;  1UJY A;  3EG9 B;  3MPU B;  3M0R A;  4M78 B;  1AZG B;  2GTJ A;  3DKM A;  4C8Q E;  3JB9 G;  1HYO A;  3EFS A;  3M9Q A;  3JCM c;  1HXD A;  1HSQ A;  1OPL A;  4RTZ A;  1K8A U;  1G2B A;  1OEB A;  4J9E A;  1IRE B;  4FM4 B;  3UF4 A;  2GFU A;  1X6G A;  1FYN A;  2K5L A;  1M3B A;  2E12 A;  1BIA A;  4XAX B;  3OS0 A;  2VC8 A;  3NGP A;  1KC8 R;  4KGZ B;  4FCY A;  2L3S A;  1B07 A;  4GBQ A;  5DLQ E;  4QVZ A;  2DL7 A;  2OI3 A;  1J3T A;  1LPL A;  2PNI A;  3MEV A;  3OYL A;  5FU6 C;  1GFD A;  2VUB A;  3G6E T;  4PJO F;  2RHY A;  1VQ6 Q;  2BTT A;  2NWM A;  2EQU A;  4N0A A;  1X75 C;  3ZFJ A;  2FYK A;  1Q82 C;  4M75 D;  2FRY A;  1ZA1 B;  3JCM X;  3OSS C;  3OW2 A;  1Z9Q A;  1MUZ A;  1KFZ A;  4KUI A;  4JPB W;  3E1S A;  3I9Q A;  1BI0 A;  3X28 B;  2EGA A;  1K9M R;  3CCV Q;  3JB9 J;  2J06 A;  1K1Z A;  1KQS A;  2W0Z A;  1NLO C;  1YJW Q;  4IIM A;  1WJR A;  1YJN T;  1IZ6 A;  3LX7 A;  2XHC A;  3NTK A;  4E7J A;  4LD9 K;  3MEW A;  2H3J A;  2PU9 B;  4OMN A;  2F2W A;  4FL6 A;  2A28 A;  3LGL A;  4LNP A;  4C92 E;  2CT3 A;  2QEX Q;  4M7A D;  2K3B A;  2BE9 B;  3UWN A;  5HKC A;  2A36 A;  3RNJ A;  5KYX A;  1ZUU A;  1D3B A;  2KDS A;  1GXI E;  2X51 A;  5KYY A;  3GNF B;  2PTK A;  2KT1 A;  4X9C A;  3L42 A;  1VQK T;  4J9H A;  2DD5 A;  4OVA A;  5FU7 B;  4PLL A;  1A0N B;  1VQ6 A;  1IGU A;  4LUD A;  4PJJ A;  8AT1 B;  5IHN A;  3RKW A;  3CC2 T;  1VQK A;  4OMO A;  2KT8 A;  2DEU A;  5GAN d;  3CCM Q;  3EFO B;  4FIB A;  2YUO A;  4LD6 A;  4XU2 A;  2PVG B;  2K5F A;  2AZV A;  2RQW A;  2RI5 A;  5FW9 A;  2DE0 X;  1QKX A;  2YHT A;  1EX4 A;  3CC7 Q;  4M7D E;  3I55 T;  2HBP A;  3CCE Q;  3GF5 A;  1YI2 Q;  4EMK B;  2KAF A;  3VS1 A;  1O75 A;  4C8Q G;  2VXF A;  2H8H A;  2OTL Q;  1W4S A;  3THK A;  4AFU C;  1Q86 R;  1JU5 C;  4PJO E;  1ZUY A;  1JRI A;  3VJP A;  2QEX A;  2MOX A;  2Y4X A;  4M78 D;  4GLM A;  1G3W A;  1U5S A;  2LQK A;  4O5V A;  4XTU A;  3PMI A;  1D1C A;  5D6Y A;  2FPF A;  5GAN 7;  2L5Q A;  3I35 A;  3OS5 A;  4Z8A A;  1LOJ A;  3OQ5 A;  2CZ0 B; 
#chains in the Genus database with same CATH homology
 1T0J A;  1ZX6 A;  2JMA A;  4JJD A;  4DEY A;  2EYX A;  1ZSG A;  2O2O A;  3A98 A;  3U23 A;  4RTY A;  2GQI A;  1RLP C;  2SRC A;  2KRN A;  4FSS A;  1QLY A;  4LN2 A;  1JXM A;  3FJ5 A;  2FO0 A;  2K9G A;  2K79 A;  2DVJ A;  2LQN A;  2GNC A;  2PZ1 A;  1UGV A;  1X6B A;  1X43 A;  1CKA A;  5L23 A;  1H92 A;  2IIM A;  2QDL A;  1RI9 A;  4HVV A;  1SSH A;  1UFF A;  2P4R A;  2DF6 A;  4OMQ A;  2HEQ A;  1K0S A;  1QWE A;  2HDA A;  4X1V A;  2I0N A;  1V1C A;  1AOJ A;  2RN8 A;  1E6H A;  2ABL A;  2ECZ A;  3NHN A;  2YSQ A;  2XMF A;  1PNJ A;  1Y57 A;  2C0O A;  1I1J A;  1PWT A;  2K6D A;  1GBR A;  1UG1 A;  2KBT A;  2LNH B;  4AG2 C;  2KR3 A;  3C0C A;  2DMO A;  1UUE A;  4JJC A;  1TUD A;  2DBM A;  2JXB A;  2KRS A;  1VA7 A;  4QT7 A;  4Y92 A;  2F2X A;  1IO6 A;  1G83 A;  2EGE A;  1PHT A;  2D0N A;  1UE9 A;  3H0I A;  3REB B;  2M0Y A;  1CSK A;  1FMK A;  1HD3 A;  1ABQ A;  1UTI A;  2GGR A;  3VS4 A;  1VYU A;  1GBQ A;  2EBP A;  2VVK A;  3H41 A;  1K4U S;  3JV3 A;  5ECA A;  1M27 C;  3NPF A;  1YN8 A;  3M0S A;  3EHQ A;  2J05 A;  1YWP A;  2VWF A;  2DL3 A;  4F16 A;  4K11 A;  1WXB A;  3VS5 A;  3M0U A;  4J9C A;  5IXF A;  2J6F A;  2KRO A;  2NUZ A;  2DA9 A;  4J9F A;  2K7A A;  1E6G A;  1X2K A;  5GJW B;  4JZ3 A;  2MCN A;  4DEX A;  2YDL A;  2K2M A;  1BB9 A;  2DIL A;  1JQQ A;  1U3O A;  4RTT A;  4ORZ A;  1UJ0 A;  3GBQ A;  2RQR A;  2AKK A;  2CUD A;  1M3C A;  1JXO A;  1B3Q A;  2D1X A;  2ESW A;  4A63 B;  4RUG A;  2LJ1 A;  2VKN A;  2AK5 A;  4OMP A;  1NM7 A;  1NLP C;  3VS7 A;  2KNB B;  3UAT A;  1T0H A;  3EG1 A;  5EC7 A;  3IQL A;  2X3X D;  2YUP A;  1PRM C;  1K76 A;  2AKL A;  1WXT A;  2FRW A;  2GTO A;  2EYZ A;  3SHW A;  1KIK A;  1M8M A;  4RTV A;  1LCK A;  2M51 A;  1OPK A;  3PVQ A;  2RF0 A;  2L0A A;  1YP5 A;  2BZY A;  1Z9Z A;  2O9S A;  1YNZ A;  1WYX A;  3VS3 A;  4J9B A;  1GCP A;  2JTE A;  5IHK A;  2RQT A;  1X2Q A;  3R6N A;  4CC3 A;  4AFQ C;  3PVL A;  2MIO A;  1H8K A;  1AVZ C;  2F2V A;  1M30 A;  3M0P A;  1ZLM A;  2EVR A;  2CH4 W;  2CH4 A;  2LX7 A;  2RQV A;  1JO8 A;  3SEM A;  1AD5 A;  2O31 A;  2CRE A;  2G6F X;  1I0C A;  4AG1 C;  4HCK A;  2OAW A;  2JM8 A;  1Y0M A;  4AFS C;  2A08 A;  3QWY A;  2CT4 A;  3H0H A;  1MV0 B;  4CC7 A;  1NYF A;  1SHG A;  2O9V A;  2CSQ A;  1GCQ C;  2DBK A;  2KRM A;  2LMJ A;  2FEI A;  3EGU A;  1T3L A;  1W6X A;  2GBQ A;  2BZX A;  3RBB B;  2DM1 A;  2V1Q A;  1WA7 A;  2RQU A;  3EG3 A;  2FPD A;  1WFW A;  2EYY A;  1AEY A;  4R0K A;  1X27 A;  3O5Z A;  3EHR A;  2ROL A;  2J6O A;  4KRT A;  5GJV B;  1NYG A;  2DX1 A;  1MV3 A;  1OOT A;  1SPK A;  1UHC A;  4HVU A;  1QKW A;  2O88 A;  3REA B;  1JEG A;  1K0X A;  4CC2 A;  1X69 A;  1RLQ C;  5IXB A;  2EGC A;  4J9D A;  4JZ4 A;  1UJY A;  2EKH A;  3M0R A;  3TSZ A;  1AZG B;  1HJD A;  1WLP B;  1N5Z A;  4HVW A;  4IIO A;  2EQI A;  1T3S A;  3I5R A;  2GTJ A;  3ULR B;  1UDL A;  3EG2 A;  2DYB A;  1HSQ A;  1OPL A;  2C0T A;  4RTZ A;  1H3H A;  1G2B A;  1OEB A;  4J9E A;  2D8J A;  4ZNX A;  3H0F A;  3UF4 A;  2CSI A;  1U06 A;  1X6G A;  1EFN A;  1FYN A;  3TVT A;  1NEB A;  1GRI A;  1M3B A;  1ARK A;  3NGP A;  1AZE A;  2L3S A;  4D8D A;  1B07 A;  2L2P A;  4GBQ A;  2DL7 A;  2OI3 A;  2BZ8 A;  1J3T A;  2PNI A;  1SRM A;  1ABO A;  1GFD A;  2ED0 A;  4M4Z A;  1E7O A;  2YT6 A;  2HBW A;  1YCS B;  5IH2 A;  1PKS A;  2BTT A;  2NWM A;  2CDT A;  2KXD A;  5HCK A;  1BU1 A;  1AWO A;  2J7I A;  2FRY A;  4ESR A;  1GCQ A;  1SHF A;  3KFV A;  4WCI A;  3I5S A;  1I07 A;  1ZUK A;  5FWC A;  1GL5 A;  1Z9Q A;  1QCF A;  1W1F A;  1MUZ A;  2L3P A;  1KFZ A;  4JPB W;  3I9Q A;  2EGA A;  4F14 A;  2J06 A;  1AWX A;  1K1Z A;  3VS0 A;  4E6R A;  5I22 A;  2W0Z A;  1VYT A;  2RMO A;  1SEM A;  1NLO C;  2C0I A;  4IIM A;  2DJQ A;  4Z89 A;  3QWX X;  2OJ2 A;  1WDX A;  1BK2 A;  2DL8 A;  2EW3 A;  1AWJ A;  1UHF A;  2JS0 A;  4OML A;  1M3A A;  1TUC A;  2DL5 A;  2KE9 A;  1BBZ A;  2B86 A;  2DRK A;  2YUQ A;  2F2W A;  4LNP A;  2A28 A;  4OMN A;  1ZBJ A;  3UA7 A;  1VYV A;  4CC4 B;  1CKB A;  2LCS A;  2CT3 A;  2KGT A;  1S1N A;  4EIK A;  2K3B A;  4AFZ C;  1YWO A;  2LJ3 A;  2LZ6 B;  2A36 A;  3RNJ A;  1NG2 A;  2EYW A;  1ZUU A;  2JW4 A;  3VS6 A;  4OMM A;  3UA6 A;  1W70 A;  2DRM A;  1KJW A;  3M0Q A;  4HXJ A;  3NMZ C;  2PTK A;  2KT1 A;  2YUN A;  1A0N B;  4J9H A;  2CUB A;  3TSW A;  2ROT A;  1TG0 A;  2LQW A;  2LJ0 A;  2KYM A;  4LUD A;  1AWW A;  3EG0 A;  2KEA A;  5IHN A;  4JJB A;  2L3Q A;  1WI7 A;  2SEM A;  4OMO A;  2W10 A;  2KT8 A;  5IHI A;  3ZL7 C;  2JS2 A;  1UEC A;  2FG0 A;  1GFC A;  1WIE A;  3CQT A;  2YUO A;  4RTW A;  3LH5 A;  1XOV A;  2RQW A;  2AZV A;  5FW9 A;  2DE0 X;  1QKX A;  4J9I A;  1SRL A;  2EPD A;  2HSP A;  3VRZ A;  1NEG A;  2D8H A;  5I11 A;  4RTX A;  1WXU A;  1QWF A;  5FWB A;  1PKT A;  2AZS A;  1K9A A;  3VS1 A;  4D8K A;  4J9G A;  2JMC A;  2H8H A;  3PE0 A;  2KXC A;  2RPN A;  2A37 A;  2ED1 A;  2JM9 A;  3THK A;  4AFU C;  1JU5 C;  2DL4 A;  1PRL C;  1ZUY A;  2KYB A;  4Z88 A;  2J6K A;  2MOX A;  2E5K A;  4GLM A;  2FPE A;  4LE9 A;  2DLP A;  2RNA A;  1U5S A;  1OV3 A;  1WX6 A;  1RUW A;  2ENM A;  2LP5 A;  2X3W D;  2HCK A;  3VRY A;  3M0T A;  3VS2 A;  2FPF A;  2V1R A;  4F17 A;  3I35 A;  1KSW A;  4RTU A;  2JT4 A;  4Z8A A;  4LUE A;  2DNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...