2GU5A

E. coli methionine aminopeptidase in complex with nlep, 1: 1, di-metalated
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gu5A00
5JHUA 2EVCA 1WN1A 1WLRA 4R60A 2BHCA 2GGCA 5CNXA 2GG8A 2BWVA 2NQ6A 1YW8A 4OOKA 2V3XA 2V3YA 5FCHA 4Z7MA 1XGNA 2Q96A 2V6CA 4QR8A 5CLSA 1XGSA 3BIPA 2MATA 4FO7A 2GG5A 2GTXA 1M35A 2GG7A 2EVOA 2GG3A 3RORA 4A6WA 4IKSA 2GG9A 4U6EA 5CDLA 3IG4A 1QXZA 4IKUA 4S2TP 1QZYA 1WL6A 2BN7A 4PNCA 1Y1NA 3FMRA 3MX6A 2GU4A 2GA2A 2B3KA 4IKTA 1B6AA 1MATA 3IU9A 3L24A 1C24A 3CB6A 3BIQA 5CIKA 4S2RP 1W7VA 2BB7A 4ZWPA 1WBQA 4IPAA 4U6CA 4U6JA 4U6WA 5CDEA 4JUQA 3PKCA 2ADUA 2NQ7A 1XGOA 4KM3A 4U73A 4B28A 1R5GA 1WKMA 1XGMA 2Q95A 1QXWA 4RZYA 4S01A 1WY2A 4A6VA 1BN5A 2BH3A 2GU5A 2EA2A 3FMQA 5FCFA 1O0XA 3S6BA 4ZNGA 5D6FA 1N51A 2GG0A 1PV9A 2BWXA 3IU7A 2HOWA 4FKCA 3TAVA 4FLIA 2GU7A 3IU8A 1A16A 3BITA 1YVMA 4RGZ1 4FLJA 4ZWOA 3PKDA 1XNZA 3PKBA 4U6ZA 2P99A 4HXXA 4S00A 1C22A 1R5HA 2Q8KA 3Q6DA 4FO8A 2Q94A 2GZ5A 4FLLA 4IU6A 2GGBA 3PKEA 1QXYA 1JAWA 3L7GA 4IECA 2EA4A 1C27A 5CE6A 5JFRA 1CHMA 2BHBA 1B59A 4RZZA 5D6EA 5CDVA 4PV4A 2BWUA 4U71A 2BWSA 1YW7A 2P9AA 3MR1A 5E5BA 2GG2A 4U1BA 1KQ0A 1YW9A 2Q93A 3D27A 1R58A 2V3ZA 2OAZA 1KP0A 2B3HA 2ZSGA 4ZWUA 4U76A 5JI6A 2EVMA 4U69A 2BWTA 1W2MA 2BWYA 3MATA 4IF7A 4MATA 4FLKA 2Q92A 3CB5A 4IDYA 3FM3A 2P98A 1C21A 2G6PA 4U75A 2BHDA 2B3LA 2IW2A 4U70A 3TB5A 2BWWA 2OKNA 2GU6A 1KQ9A 2BHAA 4IKRA 3CTZA 1BOAA 3PKAA 1YJ3A 4FUKA 4EGEA 1C23A 1WL9A 2DFIA 3RVAA
chains in the Genus database with same CATH superfamily
5JHUA 2EVCA 1WN1A 1WLRA 4R60A 2BHCA 2GGCA 5CNXA 2GG8A 2BWVA 2NQ6A 1YW8A 4OOKA 2V3XA 2V3YA 5FCHA 4Z7MA 1XGNA 2Q96A 2V6CA 4QR8A 5CLSA 1XGSA 3BIPA 2MATA 4FO7A 2GG5A 2GTXA 1M35A 2GG7A 2EVOA 2GG3A 3RORA 4A6WA 4IKSA 2GG9A 4U6EA 5CDLA 3IG4A 1QXZA 4IKUA 4S2TP 1QZYA 1WL6A 2BN7A 4PNCA 1Y1NA 3FMRA 3MX6A 2GU4A 2GA2A 2B3KA 4IKTA 1B6AA 1MATA 3IU9A 3L24A 1C24A 3CB6A 3BIQA 5CIKA 4S2RP 1W7VA 2BB7A 4ZWPA 1WBQA 4IPAA 4U6CA 4U6JA 4U6WA 5CDEA 4JUQA 3PKCA 2ADUA 2NQ7A 1XGOA 4KM3A 4U73A 4B28A 1R5GA 1WKMA 1XGMA 2Q95A 1QXWA 4RZYA 4S01A 1WY2A 4A6VA 1BN5A 2BH3A 2GU5A 2EA2A 3FMQA 5FCFA 1O0XA 3S6BA 4ZNGA 5D6FA 1N51A 2GG0A 1PV9A 2BWXA 3IU7A 2HOWA 4FKCA 3TAVA 4FLIA 2GU7A 3IU8A 1A16A 3BITA 1YVMA 4RGZ1 4FLJA 4ZWOA 3PKDA 1XNZA 3PKBA 4U6ZA 2P99A 4HXXA 4S00A 1C22A 1R5HA 2Q8KA 3Q6DA 4FO8A 2Q94A 2GZ5A 4FLLA 4IU6A 2GGBA 3PKEA 1QXYA 1JAWA 3L7GA 4IECA 2EA4A 1C27A 5CE6A 5JFRA 1CHMA 2BHBA 1B59A 4RZZA 5D6EA 5CDVA 4PV4A 2BWUA 4U71A 2BWSA 1YW7A 2P9AA 3MR1A 5E5BA 2GG2A 4U1BA 1KQ0A 1YW9A 2Q93A 3D27A 1R58A 2V3ZA 2OAZA 1KP0A 2B3HA 2ZSGA 4ZWUA 4U76A 5JI6A 2EVMA 4U69A 2BWTA 1W2MA 2BWYA 3MATA 4IF7A 4MATA 4FLKA 2Q92A 3CB5A 4IDYA 3FM3A 2P98A 1C21A 2G6PA 4U75A 2BHDA 2B3LA 2IW2A 4U70A 3TB5A 2BWWA 2OKNA 2GU6A 1KQ9A 2BHAA 4IKRA 3CTZA 1BOAA 3PKAA 1YJ3A 4FUKA 4EGEA 1C23A 1WL9A 2DFIA 3RVAA
chains in the Genus database with same CATH topology
5JHUA 2EVCA 1WN1A 1WLRA 4R60A 2BHCA 2GGCA 5CNXA 2GG8A 2BWVA 2NQ6A 1YW8A 4OOKA 2V3XA 2V3YA 5FCHA 4Z7MA 1XGNA 2Q96A 2V6CA 4QR8A 5CLSA 1XGSA 3BIPA 2MATA 4FO7A 2GG5A 2GTXA 1M35A 2GG7A 2EVOA 2GG3A 3RORA 4A6WA 4IKSA 2GG9A 4U6EA 5CDLA 3IG4A 1QXZA 4IKUA 4S2TP 1QZYA 1WL6A 2BN7A 4PNCA 1Y1NA 3FMRA 3MX6A 2GU4A 2GA2A 2B3KA 4IKTA 1B6AA 1MATA 3IU9A 3L24A 1C24A 3CB6A 3BIQA 5CIKA 4S2RP 1W7VA 2BB7A 4ZWPA 1WBQA 4IPAA 4U6CA 4U6JA 4U6WA 5CDEA 4JUQA 3PKCA 2ADUA 2NQ7A 1XGOA 4KM3A 4U73A 4B28A 1R5GA 1WKMA 1XGMA 2Q95A 1QXWA 4RZYA 4S01A 1WY2A 4A6VA 1BN5A 2BH3A 2GU5A 2EA2A 3FMQA 5FCFA 1O0XA 3S6BA 4ZNGA 5D6FA 1N51A 2GG0A 1PV9A 2BWXA 3IU7A 2HOWA 4FKCA 3TAVA 4FLIA 2GU7A 3IU8A 1A16A 3BITA 1YVMA 4RGZ1 4FLJA 4ZWOA 3PKDA 1XNZA 3PKBA 4U6ZA 2P99A 4HXXA 4S00A 1C22A 1R5HA 2Q8KA 3Q6DA 4FO8A 2Q94A 2GZ5A 4FLLA 4IU6A 2GGBA 3PKEA 1QXYA 1JAWA 3L7GA 4IECA 2EA4A 1C27A 5CE6A 5JFRA 1CHMA 2BHBA 1B59A 4RZZA 5D6EA 5CDVA 4PV4A 2BWUA 4U71A 2BWSA 1YW7A 2P9AA 3MR1A 5E5BA 2GG2A 4U1BA 1KQ0A 1YW9A 2Q93A 3D27A 1R58A 2V3ZA 2OAZA 1KP0A 2B3HA 2ZSGA 4ZWUA 4U76A 5JI6A 2EVMA 4U69A 2BWTA 1W2MA 2BWYA 3MATA 4IF7A 4MATA 4FLKA 2Q92A 3CB5A 4IDYA 3FM3A 2P98A 1C21A 2G6PA 4U75A 2BHDA 2B3LA 2IW2A 4U70A 3TB5A 2BWWA 2OKNA 2GU6A 1KQ9A 2BHAA 4IKRA 3CTZA 1BOAA 3PKAA 1YJ3A 4FUKA 4EGEA 1C23A 1WL9A 2DFIA 3RVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JHU A;  2EVC A;  1WN1 A;  1WLR A;  4R60 A;  2BHC A;  2GGC A;  5CNX A;  2GG8 A;  2BWV A;  2NQ6 A;  1YW8 A;  4OOK A;  2V3X A;  2V3Y A;  5FCH A;  4Z7M A;  1XGN A;  2Q96 A;  2V6C A;  4QR8 A;  5CLS A;  1XGS A;  3BIP A;  2MAT A;  4FO7 A;  2GG5 A;  2GTX A;  1M35 A;  2GG7 A;  2EVO A;  2GG3 A;  3ROR A;  4A6W A;  4IKS A;  2GG9 A;  4U6E A;  5CDL A;  3IG4 A;  1QXZ A;  4IKU A;  4S2T P;  1QZY A;  1WL6 A;  2BN7 A;  4PNC A;  1Y1N A;  3FMR A;  3MX6 A;  2GU4 A;  2GA2 A;  2B3K A;  4IKT A;  1B6A A;  1MAT A;  3IU9 A;  3L24 A;  1C24 A;  3CB6 A;  3BIQ A;  5CIK A;  4S2R P;  1W7V A;  2BB7 A;  4ZWP A;  1WBQ A;  4IPA A;  4U6C A;  4U6J A;  4U6W A;  5CDE A;  4JUQ A;  3PKC A;  2ADU A;  2NQ7 A;  1XGO A;  4KM3 A;  4U73 A;  4B28 A;  1R5G A;  1WKM A;  1XGM A;  2Q95 A;  1QXW A;  4RZY A;  4S01 A;  1WY2 A;  4A6V A;  1BN5 A;  2BH3 A;  2GU5 A;  2EA2 A;  3FMQ A;  5FCF A;  1O0X A;  3S6B A;  4ZNG A;  5D6F A;  1N51 A;  2GG0 A;  1PV9 A;  2BWX A;  3IU7 A;  2HOW A;  4FKC A;  3TAV A;  4FLI A;  2GU7 A;  3IU8 A;  1A16 A;  3BIT A;  1YVM A;  4RGZ 1;  4FLJ A;  4ZWO A;  3PKD A;  1XNZ A;  3PKB A;  4U6Z A;  2P99 A;  4HXX A;  4S00 A;  1C22 A;  1R5H A;  2Q8K A;  3Q6D A;  4FO8 A;  2Q94 A;  2GZ5 A;  4FLL A;  4IU6 A;  2GGB A;  3PKE A;  1QXY A;  1JAW A;  3L7G A;  4IEC A;  2EA4 A;  1C27 A;  5CE6 A;  5JFR A;  1CHM A;  2BHB A;  1B59 A;  4RZZ A;  5D6E A;  5CDV A;  4PV4 A;  2BWU A;  4U71 A;  2BWS A;  1YW7 A;  2P9A A;  3MR1 A;  5E5B A;  2GG2 A;  4U1B A;  1KQ0 A;  1YW9 A;  2Q93 A;  3D27 A;  1R58 A;  2V3Z A;  2OAZ A;  1KP0 A;  2B3H A;  2ZSG A;  4ZWU A;  4U76 A;  5JI6 A;  2EVM A;  4U69 A;  2BWT A;  1W2M A;  2BWY A;  3MAT A;  4IF7 A;  4MAT A;  4FLK A;  2Q92 A;  3CB5 A;  4IDY A;  3FM3 A;  2P98 A;  1C21 A;  2G6P A;  4U75 A;  2BHD A;  2B3L A;  2IW2 A;  4U70 A;  3TB5 A;  2BWW A;  2OKN A;  2GU6 A;  1KQ9 A;  2BHA A;  4IKR A;  3CTZ A;  1BOA A;  3PKA A;  1YJ3 A;  4FUK A;  4EGE A;  1C23 A;  1WL9 A;  2DFI A;  3RVA A; 
#chains in the Genus database with same CATH topology
 5JHU A;  2EVC A;  1WN1 A;  1WLR A;  4R60 A;  2BHC A;  2GGC A;  5CNX A;  2GG8 A;  2BWV A;  2NQ6 A;  1YW8 A;  4OOK A;  2V3X A;  2V3Y A;  5FCH A;  4Z7M A;  1XGN A;  2Q96 A;  2V6C A;  4QR8 A;  5CLS A;  1XGS A;  3BIP A;  2MAT A;  4FO7 A;  2GG5 A;  2GTX A;  1M35 A;  2GG7 A;  2EVO A;  2GG3 A;  3ROR A;  4A6W A;  4IKS A;  2GG9 A;  4U6E A;  5CDL A;  3IG4 A;  1QXZ A;  4IKU A;  4S2T P;  1QZY A;  1WL6 A;  2BN7 A;  4PNC A;  1Y1N A;  3FMR A;  3MX6 A;  2GU4 A;  2GA2 A;  2B3K A;  4IKT A;  1B6A A;  1MAT A;  3IU9 A;  3L24 A;  1C24 A;  3CB6 A;  3BIQ A;  5CIK A;  4S2R P;  1W7V A;  2BB7 A;  4ZWP A;  1WBQ A;  4IPA A;  4U6C A;  4U6J A;  4U6W A;  5CDE A;  4JUQ A;  3PKC A;  2ADU A;  2NQ7 A;  1XGO A;  4KM3 A;  4U73 A;  4B28 A;  1R5G A;  1WKM A;  1XGM A;  2Q95 A;  1QXW A;  4RZY A;  4S01 A;  1WY2 A;  4A6V A;  1BN5 A;  2BH3 A;  2GU5 A;  2EA2 A;  3FMQ A;  5FCF A;  1O0X A;  3S6B A;  4ZNG A;  5D6F A;  1N51 A;  2GG0 A;  1PV9 A;  2BWX A;  3IU7 A;  2HOW A;  4FKC A;  3TAV A;  4FLI A;  2GU7 A;  3IU8 A;  1A16 A;  3BIT A;  1YVM A;  4RGZ 1;  4FLJ A;  4ZWO A;  3PKD A;  1XNZ A;  3PKB A;  4U6Z A;  2P99 A;  4HXX A;  4S00 A;  1C22 A;  1R5H A;  2Q8K A;  3Q6D A;  4FO8 A;  2Q94 A;  2GZ5 A;  4FLL A;  4IU6 A;  2GGB A;  3PKE A;  1QXY A;  1JAW A;  3L7G A;  4IEC A;  2EA4 A;  1C27 A;  5CE6 A;  5JFR A;  1CHM A;  2BHB A;  1B59 A;  4RZZ A;  5D6E A;  5CDV A;  4PV4 A;  2BWU A;  4U71 A;  2BWS A;  1YW7 A;  2P9A A;  3MR1 A;  5E5B A;  2GG2 A;  4U1B A;  1KQ0 A;  1YW9 A;  2Q93 A;  3D27 A;  1R58 A;  2V3Z A;  2OAZ A;  1KP0 A;  2B3H A;  2ZSG A;  4ZWU A;  4U76 A;  5JI6 A;  2EVM A;  4U69 A;  2BWT A;  1W2M A;  2BWY A;  3MAT A;  4IF7 A;  4MAT A;  4FLK A;  2Q92 A;  3CB5 A;  4IDY A;  3FM3 A;  2P98 A;  1C21 A;  2G6P A;  4U75 A;  2BHD A;  2B3L A;  2IW2 A;  4U70 A;  3TB5 A;  2BWW A;  2OKN A;  2GU6 A;  1KQ9 A;  2BHA A;  4IKR A;  3CTZ A;  1BOA A;  3PKA A;  1YJ3 A;  4FUK A;  4EGE A;  1C23 A;  1WL9 A;  2DFI A;  3RVA A; 
#chains in the Genus database with same CATH homology
 5JHU A;  2EVC A;  1WN1 A;  1WLR A;  4R60 A;  2BHC A;  2GGC A;  5CNX A;  2GG8 A;  2BWV A;  2NQ6 A;  1YW8 A;  4OOK A;  2V3X A;  2V3Y A;  5FCH A;  4Z7M A;  1XGN A;  2Q96 A;  2V6C A;  4QR8 A;  5CLS A;  1XGS A;  3BIP A;  2MAT A;  4FO7 A;  2GG5 A;  2GTX A;  1M35 A;  2GG7 A;  2EVO A;  2GG3 A;  3ROR A;  4A6W A;  4IKS A;  2GG9 A;  4U6E A;  5CDL A;  3IG4 A;  1QXZ A;  4IKU A;  4S2T P;  1QZY A;  1WL6 A;  2BN7 A;  4PNC A;  1Y1N A;  3FMR A;  3MX6 A;  2GU4 A;  2GA2 A;  2B3K A;  4IKT A;  1B6A A;  1MAT A;  3IU9 A;  3L24 A;  1C24 A;  3CB6 A;  3BIQ A;  5CIK A;  4S2R P;  1W7V A;  2BB7 A;  4ZWP A;  1WBQ A;  4IPA A;  4U6C A;  4U6J A;  4U6W A;  5CDE A;  4JUQ A;  3PKC A;  2ADU A;  2NQ7 A;  1XGO A;  4KM3 A;  4U73 A;  4B28 A;  1R5G A;  1WKM A;  1XGM A;  2Q95 A;  1QXW A;  4RZY A;  4S01 A;  1WY2 A;  4A6V A;  1BN5 A;  2BH3 A;  2GU5 A;  2EA2 A;  3FMQ A;  5FCF A;  1O0X A;  3S6B A;  4ZNG A;  5D6F A;  1N51 A;  2GG0 A;  1PV9 A;  2BWX A;  3IU7 A;  2HOW A;  4FKC A;  3TAV A;  4FLI A;  2GU7 A;  3IU8 A;  1A16 A;  3BIT A;  1YVM A;  4RGZ 1;  4FLJ A;  4ZWO A;  3PKD A;  1XNZ A;  3PKB A;  4U6Z A;  2P99 A;  4HXX A;  4S00 A;  1C22 A;  1R5H A;  2Q8K A;  3Q6D A;  4FO8 A;  2Q94 A;  2GZ5 A;  4FLL A;  4IU6 A;  2GGB A;  3PKE A;  1QXY A;  1JAW A;  3L7G A;  4IEC A;  2EA4 A;  1C27 A;  5CE6 A;  5JFR A;  1CHM A;  2BHB A;  1B59 A;  4RZZ A;  5D6E A;  5CDV A;  4PV4 A;  2BWU A;  4U71 A;  2BWS A;  1YW7 A;  2P9A A;  3MR1 A;  5E5B A;  2GG2 A;  4U1B A;  1KQ0 A;  1YW9 A;  2Q93 A;  3D27 A;  1R58 A;  2V3Z A;  2OAZ A;  1KP0 A;  2B3H A;  2ZSG A;  4ZWU A;  4U76 A;  5JI6 A;  2EVM A;  4U69 A;  2BWT A;  1W2M A;  2BWY A;  3MAT A;  4IF7 A;  4MAT A;  4FLK A;  2Q92 A;  3CB5 A;  4IDY A;  3FM3 A;  2P98 A;  1C21 A;  2G6P A;  4U75 A;  2BHD A;  2B3L A;  2IW2 A;  4U70 A;  3TB5 A;  2BWW A;  2OKN A;  2GU6 A;  1KQ9 A;  2BHA A;  4IKR A;  3CTZ A;  1BOA A;  3PKA A;  1YJ3 A;  4FUK A;  4EGE A;  1C23 A;  1WL9 A;  2DFI A;  3RVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...