2GU5A

E. coli methionine aminopeptidase in complex with nlep, 1: 1, di-metalated
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
b'SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gu5A00
1W7VA 1M35A 3BITA 2BWTA 2BHDA 2NQ7A 2NQ6A 4MATA 2GG8A 4PV4A 4U76A 5CNXA 1O0XA 1YW7A 2B3HA 4B28A 4S00A 2V3ZA 2BWVA 4R60A 4ZWPA 1KQ9A 2GG9A 3TB5A 1N51A 3BIQA 3PKEA 2V3XA 5D6EA 3L7GA 4Z7MA 2EVMA 1MATA 3PKCA 4A6WA 4FO8A 2DFIA 3FMQA 2GA2A 2GG3A 1PV9A 2P99A 2GZ5A 1WKMA 2MATA 1XNZA 2BHAA 5CDVA 5CDLA 4S2TP 1R5GA 4U69A 1KP0A 4IF7A 1C24A 4U6ZA 2B3KA 4OOKA 1Y1NA 1XGNA 1C21A 1YVMA 2BWUA 2GG5A 2GGCA 1JAWA 5D6FA 3RVAA 4U71A 5CIKA 2BWXA 2Q92A 4PNCA 4U75A 2OAZA 2Q95A 2BWYA 3FM3A 2GU6A 1R58A 3PKBA 2ADUA 5JFRA 4ZNGA 2BB7A 1QZYA 2GTXA 3MX6A 3CTZA 1YW8A 1B59A 3PKAA 4FUKA 4KM3A 1XGOA 2V6CA 1QXZA 4ZWUA 2BH3A 1YW9A 4U6WA 4FLLA 3TAVA 1CHMA 1WL6A 4U6EA 4A6VA 4FLKA 1A16A 1QXYA 1XGMA 4IDYA 1WBQA 3L24A 2Q96A 5FCFA 1B6AA 1WL9A 4IKRA 2HOWA 3IU8A 2GU4A 3IU7A 1C23A 2BHCA 1C22A 3CB6A 4FLJA 3RORA 5E5BA 4IKTA 5CLSA 2GU5A 2GG7A 4EGEA 2EA2A 4RZYA 2BHBA 1R5HA 4S01A 2IW2A 1BN5A 1WN1A 2GG0A 2BN7A 2GU7A 4U1BA 4FLIA 5FCHA 4U73A 4IPAA 3IG4A 1QXWA 2GGBA 3MR1A 4U70A 3D27A 5JI6A 2GG2A 4HXXA 4RZZA 2BWWA 4QR8A 4U6CA 4FO7A 1BOAA 3CB5A 2EA4A 3S6BA 1C27A 3MATA 1KQ0A 4IKSA 5JHUA 2B3LA 1WLRA 2P9AA 1YJ3A 2Q8KA 2V3YA 4ZWOA 4RGZ1 4JUQA 4S2RP 3IU9A 2Q93A 5CDEA 2G6PA 3PKDA 3Q6DA 2OKNA 4U6JA 2P98A 3BIPA 4FKCA 4IECA 1W2MA 3FMRA 4IU6A 2BWSA 2EVOA 2ZSGA 4IKUA 1XGSA 1WY2A 2Q94A 5CE6A 2EVCA
chains in the Genus database with same CATH superfamily
1W7VA 1M35A 3BITA 2BWTA 2BHDA 2NQ7A 2NQ6A 4MATA 2GG8A 4PV4A 4U76A 5CNXA 1O0XA 1YW7A 2B3HA 4B28A 4S00A 2V3ZA 2BWVA 4R60A 4ZWPA 1KQ9A 2GG9A 3TB5A 1N51A 3BIQA 3PKEA 2V3XA 5D6EA 3L7GA 4Z7MA 2EVMA 1MATA 3PKCA 4A6WA 4FO8A 2DFIA 3FMQA 2GA2A 2GG3A 1PV9A 2P99A 2GZ5A 1WKMA 2MATA 1XNZA 2BHAA 5CDVA 5CDLA 4S2TP 1R5GA 4U69A 1KP0A 4IF7A 1C24A 4U6ZA 2B3KA 4OOKA 1Y1NA 1XGNA 1C21A 1YVMA 2BWUA 2GG5A 2GGCA 1JAWA 5D6FA 3RVAA 4U71A 5CIKA 2BWXA 2Q92A 4PNCA 4U75A 2OAZA 2Q95A 2BWYA 3FM3A 2GU6A 1R58A 3PKBA 2ADUA 5JFRA 4ZNGA 2BB7A 1QZYA 2GTXA 3MX6A 3CTZA 1YW8A 1B59A 3PKAA 4FUKA 4KM3A 1XGOA 2V6CA 1QXZA 4ZWUA 2BH3A 1YW9A 4U6WA 4FLLA 3TAVA 1CHMA 1WL6A 4U6EA 4A6VA 4FLKA 1A16A 1QXYA 1XGMA 4IDYA 1WBQA 3L24A 2Q96A 5FCFA 1B6AA 1WL9A 4IKRA 2HOWA 3IU8A 2GU4A 3IU7A 1C23A 2BHCA 1C22A 3CB6A 4FLJA 3RORA 5E5BA 4IKTA 5CLSA 2GU5A 2GG7A 4EGEA 2EA2A 4RZYA 2BHBA 1R5HA 4S01A 2IW2A 1BN5A 1WN1A 2GG0A 2BN7A 2GU7A 4U1BA 4FLIA 5FCHA 4U73A 4IPAA 3IG4A 1QXWA 2GGBA 3MR1A 4U70A 3D27A 5JI6A 2GG2A 4HXXA 4RZZA 2BWWA 4QR8A 4U6CA 4FO7A 1BOAA 3CB5A 2EA4A 3S6BA 1C27A 3MATA 1KQ0A 4IKSA 5JHUA 2B3LA 1WLRA 2P9AA 1YJ3A 2Q8KA 2V3YA 4ZWOA 4RGZ1 4JUQA 4S2RP 3IU9A 2Q93A 5CDEA 2G6PA 3PKDA 3Q6DA 2OKNA 4U6JA 2P98A 3BIPA 4FKCA 4IECA 1W2MA 3FMRA 4IU6A 2BWSA 2EVOA 2ZSGA 4IKUA 1XGSA 1WY2A 2Q94A 5CE6A 2EVCA
chains in the Genus database with same CATH topology
1W7VA 1M35A 3BITA 2BWTA 2BHDA 2NQ7A 2NQ6A 4MATA 2GG8A 4PV4A 4U76A 5CNXA 1O0XA 1YW7A 2B3HA 4B28A 4S00A 2V3ZA 2BWVA 4R60A 4ZWPA 1KQ9A 2GG9A 3TB5A 1N51A 3BIQA 3PKEA 2V3XA 5D6EA 3L7GA 4Z7MA 2EVMA 1MATA 3PKCA 4A6WA 4FO8A 2DFIA 3FMQA 2GA2A 2GG3A 1PV9A 2P99A 2GZ5A 1WKMA 2MATA 1XNZA 2BHAA 5CDVA 5CDLA 4S2TP 1R5GA 4U69A 1KP0A 4IF7A 1C24A 4U6ZA 2B3KA 4OOKA 1Y1NA 1XGNA 1C21A 1YVMA 2BWUA 2GG5A 2GGCA 1JAWA 5D6FA 3RVAA 4U71A 5CIKA 2BWXA 2Q92A 4PNCA 4U75A 2OAZA 2Q95A 2BWYA 3FM3A 2GU6A 1R58A 3PKBA 2ADUA 5JFRA 4ZNGA 2BB7A 1QZYA 2GTXA 3MX6A 3CTZA 1YW8A 1B59A 3PKAA 4FUKA 4KM3A 1XGOA 2V6CA 1QXZA 4ZWUA 2BH3A 1YW9A 4U6WA 4FLLA 3TAVA 1CHMA 1WL6A 4U6EA 4A6VA 4FLKA 1A16A 1QXYA 1XGMA 4IDYA 1WBQA 3L24A 2Q96A 5FCFA 1B6AA 1WL9A 4IKRA 2HOWA 3IU8A 2GU4A 3IU7A 1C23A 2BHCA 1C22A 3CB6A 4FLJA 3RORA 5E5BA 4IKTA 5CLSA 2GU5A 2GG7A 4EGEA 2EA2A 4RZYA 2BHBA 1R5HA 4S01A 2IW2A 1BN5A 1WN1A 2GG0A 2BN7A 2GU7A 4U1BA 4FLIA 5FCHA 4U73A 4IPAA 3IG4A 1QXWA 2GGBA 3MR1A 4U70A 3D27A 5JI6A 2GG2A 4HXXA 4RZZA 2BWWA 4QR8A 4U6CA 4FO7A 1BOAA 3CB5A 2EA4A 3S6BA 1C27A 3MATA 1KQ0A 4IKSA 5JHUA 2B3LA 1WLRA 2P9AA 1YJ3A 2Q8KA 2V3YA 4ZWOA 4RGZ1 4JUQA 4S2RP 3IU9A 2Q93A 5CDEA 2G6PA 3PKDA 3Q6DA 2OKNA 4U6JA 2P98A 3BIPA 4FKCA 4IECA 1W2MA 3FMRA 4IU6A 2BWSA 2EVOA 2ZSGA 4IKUA 1XGSA 1WY2A 2Q94A 5CE6A 2EVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W7V A;  1M35 A;  3BIT A;  2BWT A;  2BHD A;  2NQ7 A;  2NQ6 A;  4MAT A;  2GG8 A;  4PV4 A;  4U76 A;  5CNX A;  1O0X A;  1YW7 A;  2B3H A;  4B28 A;  4S00 A;  2V3Z A;  2BWV A;  4R60 A;  4ZWP A;  1KQ9 A;  2GG9 A;  3TB5 A;  1N51 A;  3BIQ A;  3PKE A;  2V3X A;  5D6E A;  3L7G A;  4Z7M A;  2EVM A;  1MAT A;  3PKC A;  4A6W A;  4FO8 A;  2DFI A;  3FMQ A;  2GA2 A;  2GG3 A;  1PV9 A;  2P99 A;  2GZ5 A;  1WKM A;  2MAT A;  1XNZ A;  2BHA A;  5CDV A;  5CDL A;  4S2T P;  1R5G A;  4U69 A;  1KP0 A;  4IF7 A;  1C24 A;  4U6Z A;  2B3K A;  4OOK A;  1Y1N A;  1XGN A;  1C21 A;  1YVM A;  2BWU A;  2GG5 A;  2GGC A;  1JAW A;  5D6F A;  3RVA A;  4U71 A;  5CIK A;  2BWX A;  2Q92 A;  4PNC A;  4U75 A;  2OAZ A;  2Q95 A;  2BWY A;  3FM3 A;  2GU6 A;  1R58 A;  3PKB A;  2ADU A;  5JFR A;  4ZNG A;  2BB7 A;  1QZY A;  2GTX A;  3MX6 A;  3CTZ A;  1YW8 A;  1B59 A;  3PKA A;  4FUK A;  4KM3 A;  1XGO A;  2V6C A;  1QXZ A;  4ZWU A;  2BH3 A;  1YW9 A;  4U6W A;  4FLL A;  3TAV A;  1CHM A;  1WL6 A;  4U6E A;  4A6V A;  4FLK A;  1A16 A;  1QXY A;  1XGM A;  4IDY A;  1WBQ A;  3L24 A;  2Q96 A;  5FCF A;  1B6A A;  1WL9 A;  4IKR A;  2HOW A;  3IU8 A;  2GU4 A;  3IU7 A;  1C23 A;  2BHC A;  1C22 A;  3CB6 A;  4FLJ A;  3ROR A;  5E5B A;  4IKT A;  5CLS A;  2GU5 A;  2GG7 A;  4EGE A;  2EA2 A;  4RZY A;  2BHB A;  1R5H A;  4S01 A;  2IW2 A;  1BN5 A;  1WN1 A;  2GG0 A;  2BN7 A;  2GU7 A;  4U1B A;  4FLI A;  5FCH A;  4U73 A;  4IPA A;  3IG4 A;  1QXW A;  2GGB A;  3MR1 A;  4U70 A;  3D27 A;  5JI6 A;  2GG2 A;  4HXX A;  4RZZ A;  2BWW A;  4QR8 A;  4U6C A;  4FO7 A;  1BOA A;  3CB5 A;  2EA4 A;  3S6B A;  1C27 A;  3MAT A;  1KQ0 A;  4IKS A;  5JHU A;  2B3L A;  1WLR A;  2P9A A;  1YJ3 A;  2Q8K A;  2V3Y A;  4ZWO A;  4RGZ 1;  4JUQ A;  4S2R P;  3IU9 A;  2Q93 A;  5CDE A;  2G6P A;  3PKD A;  3Q6D A;  2OKN A;  4U6J A;  2P98 A;  3BIP A;  4FKC A;  4IEC A;  1W2M A;  3FMR A;  4IU6 A;  2BWS A;  2EVO A;  2ZSG A;  4IKU A;  1XGS A;  1WY2 A;  2Q94 A;  5CE6 A;  2EVC A; 
#chains in the Genus database with same CATH topology
 1W7V A;  1M35 A;  3BIT A;  2BWT A;  2BHD A;  2NQ7 A;  2NQ6 A;  4MAT A;  2GG8 A;  4PV4 A;  4U76 A;  5CNX A;  1O0X A;  1YW7 A;  2B3H A;  4B28 A;  4S00 A;  2V3Z A;  2BWV A;  4R60 A;  4ZWP A;  1KQ9 A;  2GG9 A;  3TB5 A;  1N51 A;  3BIQ A;  3PKE A;  2V3X A;  5D6E A;  3L7G A;  4Z7M A;  2EVM A;  1MAT A;  3PKC A;  4A6W A;  4FO8 A;  2DFI A;  3FMQ A;  2GA2 A;  2GG3 A;  1PV9 A;  2P99 A;  2GZ5 A;  1WKM A;  2MAT A;  1XNZ A;  2BHA A;  5CDV A;  5CDL A;  4S2T P;  1R5G A;  4U69 A;  1KP0 A;  4IF7 A;  1C24 A;  4U6Z A;  2B3K A;  4OOK A;  1Y1N A;  1XGN A;  1C21 A;  1YVM A;  2BWU A;  2GG5 A;  2GGC A;  1JAW A;  5D6F A;  3RVA A;  4U71 A;  5CIK A;  2BWX A;  2Q92 A;  4PNC A;  4U75 A;  2OAZ A;  2Q95 A;  2BWY A;  3FM3 A;  2GU6 A;  1R58 A;  3PKB A;  2ADU A;  5JFR A;  4ZNG A;  2BB7 A;  1QZY A;  2GTX A;  3MX6 A;  3CTZ A;  1YW8 A;  1B59 A;  3PKA A;  4FUK A;  4KM3 A;  1XGO A;  2V6C A;  1QXZ A;  4ZWU A;  2BH3 A;  1YW9 A;  4U6W A;  4FLL A;  3TAV A;  1CHM A;  1WL6 A;  4U6E A;  4A6V A;  4FLK A;  1A16 A;  1QXY A;  1XGM A;  4IDY A;  1WBQ A;  3L24 A;  2Q96 A;  5FCF A;  1B6A A;  1WL9 A;  4IKR A;  2HOW A;  3IU8 A;  2GU4 A;  3IU7 A;  1C23 A;  2BHC A;  1C22 A;  3CB6 A;  4FLJ A;  3ROR A;  5E5B A;  4IKT A;  5CLS A;  2GU5 A;  2GG7 A;  4EGE A;  2EA2 A;  4RZY A;  2BHB A;  1R5H A;  4S01 A;  2IW2 A;  1BN5 A;  1WN1 A;  2GG0 A;  2BN7 A;  2GU7 A;  4U1B A;  4FLI A;  5FCH A;  4U73 A;  4IPA A;  3IG4 A;  1QXW A;  2GGB A;  3MR1 A;  4U70 A;  3D27 A;  5JI6 A;  2GG2 A;  4HXX A;  4RZZ A;  2BWW A;  4QR8 A;  4U6C A;  4FO7 A;  1BOA A;  3CB5 A;  2EA4 A;  3S6B A;  1C27 A;  3MAT A;  1KQ0 A;  4IKS A;  5JHU A;  2B3L A;  1WLR A;  2P9A A;  1YJ3 A;  2Q8K A;  2V3Y A;  4ZWO A;  4RGZ 1;  4JUQ A;  4S2R P;  3IU9 A;  2Q93 A;  5CDE A;  2G6P A;  3PKD A;  3Q6D A;  2OKN A;  4U6J A;  2P98 A;  3BIP A;  4FKC A;  4IEC A;  1W2M A;  3FMR A;  4IU6 A;  2BWS A;  2EVO A;  2ZSG A;  4IKU A;  1XGS A;  1WY2 A;  2Q94 A;  5CE6 A;  2EVC A; 
#chains in the Genus database with same CATH homology
 1W7V A;  1M35 A;  3BIT A;  2BWT A;  2BHD A;  2NQ7 A;  2NQ6 A;  4MAT A;  2GG8 A;  4PV4 A;  4U76 A;  5CNX A;  1O0X A;  1YW7 A;  2B3H A;  4B28 A;  4S00 A;  2V3Z A;  2BWV A;  4R60 A;  4ZWP A;  1KQ9 A;  2GG9 A;  3TB5 A;  1N51 A;  3BIQ A;  3PKE A;  2V3X A;  5D6E A;  3L7G A;  4Z7M A;  2EVM A;  1MAT A;  3PKC A;  4A6W A;  4FO8 A;  2DFI A;  3FMQ A;  2GA2 A;  2GG3 A;  1PV9 A;  2P99 A;  2GZ5 A;  1WKM A;  2MAT A;  1XNZ A;  2BHA A;  5CDV A;  5CDL A;  4S2T P;  1R5G A;  4U69 A;  1KP0 A;  4IF7 A;  1C24 A;  4U6Z A;  2B3K A;  4OOK A;  1Y1N A;  1XGN A;  1C21 A;  1YVM A;  2BWU A;  2GG5 A;  2GGC A;  1JAW A;  5D6F A;  3RVA A;  4U71 A;  5CIK A;  2BWX A;  2Q92 A;  4PNC A;  4U75 A;  2OAZ A;  2Q95 A;  2BWY A;  3FM3 A;  2GU6 A;  1R58 A;  3PKB A;  2ADU A;  5JFR A;  4ZNG A;  2BB7 A;  1QZY A;  2GTX A;  3MX6 A;  3CTZ A;  1YW8 A;  1B59 A;  3PKA A;  4FUK A;  4KM3 A;  1XGO A;  2V6C A;  1QXZ A;  4ZWU A;  2BH3 A;  1YW9 A;  4U6W A;  4FLL A;  3TAV A;  1CHM A;  1WL6 A;  4U6E A;  4A6V A;  4FLK A;  1A16 A;  1QXY A;  1XGM A;  4IDY A;  1WBQ A;  3L24 A;  2Q96 A;  5FCF A;  1B6A A;  1WL9 A;  4IKR A;  2HOW A;  3IU8 A;  2GU4 A;  3IU7 A;  1C23 A;  2BHC A;  1C22 A;  3CB6 A;  4FLJ A;  3ROR A;  5E5B A;  4IKT A;  5CLS A;  2GU5 A;  2GG7 A;  4EGE A;  2EA2 A;  4RZY A;  2BHB A;  1R5H A;  4S01 A;  2IW2 A;  1BN5 A;  1WN1 A;  2GG0 A;  2BN7 A;  2GU7 A;  4U1B A;  4FLI A;  5FCH A;  4U73 A;  4IPA A;  3IG4 A;  1QXW A;  2GGB A;  3MR1 A;  4U70 A;  3D27 A;  5JI6 A;  2GG2 A;  4HXX A;  4RZZ A;  2BWW A;  4QR8 A;  4U6C A;  4FO7 A;  1BOA A;  3CB5 A;  2EA4 A;  3S6B A;  1C27 A;  3MAT A;  1KQ0 A;  4IKS A;  5JHU A;  2B3L A;  1WLR A;  2P9A A;  1YJ3 A;  2Q8K A;  2V3Y A;  4ZWO A;  4RGZ 1;  4JUQ A;  4S2R P;  3IU9 A;  2Q93 A;  5CDE A;  2G6P A;  3PKD A;  3Q6D A;  2OKN A;  4U6J A;  2P98 A;  3BIP A;  4FKC A;  4IEC A;  1W2M A;  3FMR A;  4IU6 A;  2BWS A;  2EVO A;  2ZSG A;  4IKU A;  1XGS A;  1WY2 A;  2Q94 A;  5CE6 A;  2EVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...