2GU5A

E. coli methionine aminopeptidase in complex with nlep, 1: 1, di-metalated
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 88
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gu5A00
4U76A 2EVCA 2BHAA 2BWVA 3RVAA 2B3KA 4FLIA 4RGZ1 2NQ7A 3CB6A 1C27A 4RZZA 2V3YA 2OAZA 1YVMA 2V3ZA 3MX6A 1W2MA 2HOWA 2EVMA 2GU5A 4IKRA 4R60A 2GU7A 1PV9A 2G6PA 2P98A 3IU9A 4QR8A 5FCHA 2B3HA 4A6VA 2BWWA 1QXYA 2EVOA 3Q6DA 1WN1A 2BWXA 1YW8A 4FLKA 2P99A 2GZ5A 2GU6A 4IECA 5CDVA 2MATA 4OOKA 1JAWA 4MATA 3PKCA 3FM3A 1QXWA 4U6WA 1MATA 4ZWUA 3MATA 1B59A 3L24A 2GTXA 4U6EA 4ZWPA 1XGOA 5CE6A 2Q8KA 1KQ0A 4PNCA 4ZWOA 2GA2A 3PKBA 4IKSA 4JUQA 5CDEA 1YW7A 5JFRA 4FUKA 1YJ3A 3S6BA 2Q95A 4S01A 2GG9A 5CDLA 1XGNA 2Q92A 2IW2A 3FMQA 3CB5A 3FMRA 1WL6A 2BB7A 3IG4A 2V6CA 4IKTA 4A6WA 3MR1A 4IU6A 1KQ9A 1N51A 2GG8A 2ADUA 2BWYA 2GG7A 2Q96A 3PKDA 4U6ZA 5CLSA 5FCFA 4U75A 2GG2A 3PKAA 4EGEA 2GGBA 1QZYA 2GGCA 1C23A 2Q94A 1BN5A 5D6EA 4U1BA 1O0XA 1WL9A 4RZYA 4U69A 1WKMA 1R5HA 5JHUA 1QXZA 4S00A 1C24A 2BN7A 4IDYA 4KM3A 2BHCA 2BHDA 2GG0A 1B6AA 1C21A 2GU4A 1W7VA 4S2RP 4U6JA 2BWUA 4FO7A 3BITA 3D27A 5CNXA 2EA2A 2GG5A 2DFIA 4ZNGA 1KP0A 2NQ6A 2V3XA 3BIPA 4IF7A 2OKNA 2B3LA 1C22A 3PKEA 4U71A 5E5BA 1WLRA 1YW9A 1R58A 2ZSGA 4PV4A 4FLLA 2Q93A 1CHMA 2BWTA 3IU7A 5D6FA 3TB5A 2BHBA 4U70A 1R5GA 2GG3A 4FKCA 1WBQA 2EA4A 2BH3A 3IU8A 4FO8A 4FLJA 1M35A 4HXXA 3CTZA 4U73A 4Z7MA 1XGSA 2BWSA 3L7GA 4IPAA 1XGMA 1Y1NA 1BOAA 3TAVA 1WY2A 2P9AA 4S2TP 4IKUA 3RORA 5JI6A 4B28A 5CIKA 1A16A 1XNZA 4U6CA 3BIQA
chains in the Genus database with same CATH superfamily
4U76A 2EVCA 2BHAA 2BWVA 3RVAA 2B3KA 4FLIA 4RGZ1 2NQ7A 3CB6A 1C27A 4RZZA 2V3YA 2OAZA 1YVMA 2V3ZA 3MX6A 1W2MA 2HOWA 2EVMA 2GU5A 4IKRA 4R60A 2GU7A 1PV9A 2G6PA 2P98A 3IU9A 4QR8A 5FCHA 2B3HA 4A6VA 2BWWA 1QXYA 2EVOA 3Q6DA 1WN1A 2BWXA 1YW8A 4FLKA 2P99A 2GZ5A 2GU6A 4IECA 5CDVA 2MATA 4OOKA 1JAWA 4MATA 3PKCA 3FM3A 1QXWA 4U6WA 1MATA 4ZWUA 3MATA 1B59A 3L24A 2GTXA 4U6EA 4ZWPA 1XGOA 5CE6A 2Q8KA 1KQ0A 4PNCA 4ZWOA 2GA2A 3PKBA 4IKSA 4JUQA 5CDEA 1YW7A 5JFRA 4FUKA 1YJ3A 3S6BA 2Q95A 4S01A 2GG9A 5CDLA 1XGNA 2Q92A 2IW2A 3FMQA 3CB5A 3FMRA 1WL6A 2BB7A 3IG4A 2V6CA 4IKTA 4A6WA 3MR1A 4IU6A 1KQ9A 1N51A 2GG8A 2ADUA 2BWYA 2GG7A 2Q96A 3PKDA 4U6ZA 5CLSA 5FCFA 4U75A 2GG2A 3PKAA 4EGEA 2GGBA 1QZYA 2GGCA 1C23A 2Q94A 1BN5A 5D6EA 4U1BA 1O0XA 1WL9A 4RZYA 4U69A 1WKMA 1R5HA 5JHUA 1QXZA 4S00A 1C24A 2BN7A 4IDYA 4KM3A 2BHCA 2BHDA 2GG0A 1B6AA 1C21A 2GU4A 1W7VA 4S2RP 4U6JA 2BWUA 4FO7A 3BITA 3D27A 5CNXA 2EA2A 2GG5A 2DFIA 4ZNGA 1KP0A 2NQ6A 2V3XA 3BIPA 4IF7A 2OKNA 2B3LA 1C22A 3PKEA 4U71A 5E5BA 1WLRA 1YW9A 1R58A 2ZSGA 4PV4A 4FLLA 2Q93A 1CHMA 2BWTA 3IU7A 5D6FA 3TB5A 2BHBA 4U70A 1R5GA 2GG3A 4FKCA 1WBQA 2EA4A 2BH3A 3IU8A 4FO8A 4FLJA 1M35A 4HXXA 3CTZA 4U73A 4Z7MA 1XGSA 2BWSA 3L7GA 4IPAA 1XGMA 1Y1NA 1BOAA 3TAVA 1WY2A 2P9AA 4S2TP 4IKUA 3RORA 5JI6A 4B28A 5CIKA 1A16A 1XNZA 4U6CA 3BIQA
chains in the Genus database with same CATH topology
4U76A 2EVCA 2BHAA 2BWVA 3RVAA 2B3KA 4FLIA 4RGZ1 2NQ7A 3CB6A 1C27A 4RZZA 2V3YA 2OAZA 1YVMA 2V3ZA 3MX6A 1W2MA 2HOWA 2EVMA 2GU5A 4IKRA 4R60A 2GU7A 1PV9A 2G6PA 2P98A 3IU9A 4QR8A 5FCHA 2B3HA 4A6VA 2BWWA 1QXYA 2EVOA 3Q6DA 1WN1A 2BWXA 1YW8A 4FLKA 2P99A 2GZ5A 2GU6A 4IECA 5CDVA 2MATA 4OOKA 1JAWA 4MATA 3PKCA 3FM3A 1QXWA 4U6WA 1MATA 4ZWUA 3MATA 1B59A 3L24A 2GTXA 4U6EA 4ZWPA 1XGOA 5CE6A 2Q8KA 1KQ0A 4PNCA 4ZWOA 2GA2A 3PKBA 4IKSA 4JUQA 5CDEA 1YW7A 5JFRA 4FUKA 1YJ3A 3S6BA 2Q95A 4S01A 2GG9A 5CDLA 1XGNA 2Q92A 2IW2A 3FMQA 3CB5A 3FMRA 1WL6A 2BB7A 3IG4A 2V6CA 4IKTA 4A6WA 3MR1A 4IU6A 1KQ9A 1N51A 2GG8A 2ADUA 2BWYA 2GG7A 2Q96A 3PKDA 4U6ZA 5CLSA 5FCFA 4U75A 2GG2A 3PKAA 4EGEA 2GGBA 1QZYA 2GGCA 1C23A 2Q94A 1BN5A 5D6EA 4U1BA 1O0XA 1WL9A 4RZYA 4U69A 1WKMA 1R5HA 5JHUA 1QXZA 4S00A 1C24A 2BN7A 4IDYA 4KM3A 2BHCA 2BHDA 2GG0A 1B6AA 1C21A 2GU4A 1W7VA 4S2RP 4U6JA 2BWUA 4FO7A 3BITA 3D27A 5CNXA 2EA2A 2GG5A 2DFIA 4ZNGA 1KP0A 2NQ6A 2V3XA 3BIPA 4IF7A 2OKNA 2B3LA 1C22A 3PKEA 4U71A 5E5BA 1WLRA 1YW9A 1R58A 2ZSGA 4PV4A 4FLLA 2Q93A 1CHMA 2BWTA 3IU7A 5D6FA 3TB5A 2BHBA 4U70A 1R5GA 2GG3A 4FKCA 1WBQA 2EA4A 2BH3A 3IU8A 4FO8A 4FLJA 1M35A 4HXXA 3CTZA 4U73A 4Z7MA 1XGSA 2BWSA 3L7GA 4IPAA 1XGMA 1Y1NA 1BOAA 3TAVA 1WY2A 2P9AA 4S2TP 4IKUA 3RORA 5JI6A 4B28A 5CIKA 1A16A 1XNZA 4U6CA 3BIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U76 A;  2EVC A;  2BHA A;  2BWV A;  3RVA A;  2B3K A;  4FLI A;  4RGZ 1;  2NQ7 A;  3CB6 A;  1C27 A;  4RZZ A;  2V3Y A;  2OAZ A;  1YVM A;  2V3Z A;  3MX6 A;  1W2M A;  2HOW A;  2EVM A;  2GU5 A;  4IKR A;  4R60 A;  2GU7 A;  1PV9 A;  2G6P A;  2P98 A;  3IU9 A;  4QR8 A;  5FCH A;  2B3H A;  4A6V A;  2BWW A;  1QXY A;  2EVO A;  3Q6D A;  1WN1 A;  2BWX A;  1YW8 A;  4FLK A;  2P99 A;  2GZ5 A;  2GU6 A;  4IEC A;  5CDV A;  2MAT A;  4OOK A;  1JAW A;  4MAT A;  3PKC A;  3FM3 A;  1QXW A;  4U6W A;  1MAT A;  4ZWU A;  3MAT A;  1B59 A;  3L24 A;  2GTX A;  4U6E A;  4ZWP A;  1XGO A;  5CE6 A;  2Q8K A;  1KQ0 A;  4PNC A;  4ZWO A;  2GA2 A;  3PKB A;  4IKS A;  4JUQ A;  5CDE A;  1YW7 A;  5JFR A;  4FUK A;  1YJ3 A;  3S6B A;  2Q95 A;  4S01 A;  2GG9 A;  5CDL A;  1XGN A;  2Q92 A;  2IW2 A;  3FMQ A;  3CB5 A;  3FMR A;  1WL6 A;  2BB7 A;  3IG4 A;  2V6C A;  4IKT A;  4A6W A;  3MR1 A;  4IU6 A;  1KQ9 A;  1N51 A;  2GG8 A;  2ADU A;  2BWY A;  2GG7 A;  2Q96 A;  3PKD A;  4U6Z A;  5CLS A;  5FCF A;  4U75 A;  2GG2 A;  3PKA A;  4EGE A;  2GGB A;  1QZY A;  2GGC A;  1C23 A;  2Q94 A;  1BN5 A;  5D6E A;  4U1B A;  1O0X A;  1WL9 A;  4RZY A;  4U69 A;  1WKM A;  1R5H A;  5JHU A;  1QXZ A;  4S00 A;  1C24 A;  2BN7 A;  4IDY A;  4KM3 A;  2BHC A;  2BHD A;  2GG0 A;  1B6A A;  1C21 A;  2GU4 A;  1W7V A;  4S2R P;  4U6J A;  2BWU A;  4FO7 A;  3BIT A;  3D27 A;  5CNX A;  2EA2 A;  2GG5 A;  2DFI A;  4ZNG A;  1KP0 A;  2NQ6 A;  2V3X A;  3BIP A;  4IF7 A;  2OKN A;  2B3L A;  1C22 A;  3PKE A;  4U71 A;  5E5B A;  1WLR A;  1YW9 A;  1R58 A;  2ZSG A;  4PV4 A;  4FLL A;  2Q93 A;  1CHM A;  2BWT A;  3IU7 A;  5D6F A;  3TB5 A;  2BHB A;  4U70 A;  1R5G A;  2GG3 A;  4FKC A;  1WBQ A;  2EA4 A;  2BH3 A;  3IU8 A;  4FO8 A;  4FLJ A;  1M35 A;  4HXX A;  3CTZ A;  4U73 A;  4Z7M A;  1XGS A;  2BWS A;  3L7G A;  4IPA A;  1XGM A;  1Y1N A;  1BOA A;  3TAV A;  1WY2 A;  2P9A A;  4S2T P;  4IKU A;  3ROR A;  5JI6 A;  4B28 A;  5CIK A;  1A16 A;  1XNZ A;  4U6C A;  3BIQ A; 
#chains in the Genus database with same CATH topology
 4U76 A;  2EVC A;  2BHA A;  2BWV A;  3RVA A;  2B3K A;  4FLI A;  4RGZ 1;  2NQ7 A;  3CB6 A;  1C27 A;  4RZZ A;  2V3Y A;  2OAZ A;  1YVM A;  2V3Z A;  3MX6 A;  1W2M A;  2HOW A;  2EVM A;  2GU5 A;  4IKR A;  4R60 A;  2GU7 A;  1PV9 A;  2G6P A;  2P98 A;  3IU9 A;  4QR8 A;  5FCH A;  2B3H A;  4A6V A;  2BWW A;  1QXY A;  2EVO A;  3Q6D A;  1WN1 A;  2BWX A;  1YW8 A;  4FLK A;  2P99 A;  2GZ5 A;  2GU6 A;  4IEC A;  5CDV A;  2MAT A;  4OOK A;  1JAW A;  4MAT A;  3PKC A;  3FM3 A;  1QXW A;  4U6W A;  1MAT A;  4ZWU A;  3MAT A;  1B59 A;  3L24 A;  2GTX A;  4U6E A;  4ZWP A;  1XGO A;  5CE6 A;  2Q8K A;  1KQ0 A;  4PNC A;  4ZWO A;  2GA2 A;  3PKB A;  4IKS A;  4JUQ A;  5CDE A;  1YW7 A;  5JFR A;  4FUK A;  1YJ3 A;  3S6B A;  2Q95 A;  4S01 A;  2GG9 A;  5CDL A;  1XGN A;  2Q92 A;  2IW2 A;  3FMQ A;  3CB5 A;  3FMR A;  1WL6 A;  2BB7 A;  3IG4 A;  2V6C A;  4IKT A;  4A6W A;  3MR1 A;  4IU6 A;  1KQ9 A;  1N51 A;  2GG8 A;  2ADU A;  2BWY A;  2GG7 A;  2Q96 A;  3PKD A;  4U6Z A;  5CLS A;  5FCF A;  4U75 A;  2GG2 A;  3PKA A;  4EGE A;  2GGB A;  1QZY A;  2GGC A;  1C23 A;  2Q94 A;  1BN5 A;  5D6E A;  4U1B A;  1O0X A;  1WL9 A;  4RZY A;  4U69 A;  1WKM A;  1R5H A;  5JHU A;  1QXZ A;  4S00 A;  1C24 A;  2BN7 A;  4IDY A;  4KM3 A;  2BHC A;  2BHD A;  2GG0 A;  1B6A A;  1C21 A;  2GU4 A;  1W7V A;  4S2R P;  4U6J A;  2BWU A;  4FO7 A;  3BIT A;  3D27 A;  5CNX A;  2EA2 A;  2GG5 A;  2DFI A;  4ZNG A;  1KP0 A;  2NQ6 A;  2V3X A;  3BIP A;  4IF7 A;  2OKN A;  2B3L A;  1C22 A;  3PKE A;  4U71 A;  5E5B A;  1WLR A;  1YW9 A;  1R58 A;  2ZSG A;  4PV4 A;  4FLL A;  2Q93 A;  1CHM A;  2BWT A;  3IU7 A;  5D6F A;  3TB5 A;  2BHB A;  4U70 A;  1R5G A;  2GG3 A;  4FKC A;  1WBQ A;  2EA4 A;  2BH3 A;  3IU8 A;  4FO8 A;  4FLJ A;  1M35 A;  4HXX A;  3CTZ A;  4U73 A;  4Z7M A;  1XGS A;  2BWS A;  3L7G A;  4IPA A;  1XGM A;  1Y1N A;  1BOA A;  3TAV A;  1WY2 A;  2P9A A;  4S2T P;  4IKU A;  3ROR A;  5JI6 A;  4B28 A;  5CIK A;  1A16 A;  1XNZ A;  4U6C A;  3BIQ A; 
#chains in the Genus database with same CATH homology
 4U76 A;  2EVC A;  2BHA A;  2BWV A;  3RVA A;  2B3K A;  4FLI A;  4RGZ 1;  2NQ7 A;  3CB6 A;  1C27 A;  4RZZ A;  2V3Y A;  2OAZ A;  1YVM A;  2V3Z A;  3MX6 A;  1W2M A;  2HOW A;  2EVM A;  2GU5 A;  4IKR A;  4R60 A;  2GU7 A;  1PV9 A;  2G6P A;  2P98 A;  3IU9 A;  4QR8 A;  5FCH A;  2B3H A;  4A6V A;  2BWW A;  1QXY A;  2EVO A;  3Q6D A;  1WN1 A;  2BWX A;  1YW8 A;  4FLK A;  2P99 A;  2GZ5 A;  2GU6 A;  4IEC A;  5CDV A;  2MAT A;  4OOK A;  1JAW A;  4MAT A;  3PKC A;  3FM3 A;  1QXW A;  4U6W A;  1MAT A;  4ZWU A;  3MAT A;  1B59 A;  3L24 A;  2GTX A;  4U6E A;  4ZWP A;  1XGO A;  5CE6 A;  2Q8K A;  1KQ0 A;  4PNC A;  4ZWO A;  2GA2 A;  3PKB A;  4IKS A;  4JUQ A;  5CDE A;  1YW7 A;  5JFR A;  4FUK A;  1YJ3 A;  3S6B A;  2Q95 A;  4S01 A;  2GG9 A;  5CDL A;  1XGN A;  2Q92 A;  2IW2 A;  3FMQ A;  3CB5 A;  3FMR A;  1WL6 A;  2BB7 A;  3IG4 A;  2V6C A;  4IKT A;  4A6W A;  3MR1 A;  4IU6 A;  1KQ9 A;  1N51 A;  2GG8 A;  2ADU A;  2BWY A;  2GG7 A;  2Q96 A;  3PKD A;  4U6Z A;  5CLS A;  5FCF A;  4U75 A;  2GG2 A;  3PKA A;  4EGE A;  2GGB A;  1QZY A;  2GGC A;  1C23 A;  2Q94 A;  1BN5 A;  5D6E A;  4U1B A;  1O0X A;  1WL9 A;  4RZY A;  4U69 A;  1WKM A;  1R5H A;  5JHU A;  1QXZ A;  4S00 A;  1C24 A;  2BN7 A;  4IDY A;  4KM3 A;  2BHC A;  2BHD A;  2GG0 A;  1B6A A;  1C21 A;  2GU4 A;  1W7V A;  4S2R P;  4U6J A;  2BWU A;  4FO7 A;  3BIT A;  3D27 A;  5CNX A;  2EA2 A;  2GG5 A;  2DFI A;  4ZNG A;  1KP0 A;  2NQ6 A;  2V3X A;  3BIP A;  4IF7 A;  2OKN A;  2B3L A;  1C22 A;  3PKE A;  4U71 A;  5E5B A;  1WLR A;  1YW9 A;  1R58 A;  2ZSG A;  4PV4 A;  4FLL A;  2Q93 A;  1CHM A;  2BWT A;  3IU7 A;  5D6F A;  3TB5 A;  2BHB A;  4U70 A;  1R5G A;  2GG3 A;  4FKC A;  1WBQ A;  2EA4 A;  2BH3 A;  3IU8 A;  4FO8 A;  4FLJ A;  1M35 A;  4HXX A;  3CTZ A;  4U73 A;  4Z7M A;  1XGS A;  2BWS A;  3L7G A;  4IPA A;  1XGM A;  1Y1N A;  1BOA A;  3TAV A;  1WY2 A;  2P9A A;  4S2T P;  4IKU A;  3ROR A;  5JI6 A;  4B28 A;  5CIK A;  1A16 A;  1XNZ A;  4U6C A;  3BIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...