2GU5A

E. coli methionine aminopeptidase in complex with nlep, 1: 1, di-metalated
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 88
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gu5A00
4U6JA 3BIPA 2BWWA 4FO7A 2BH3A 4S2TP 1C21A 4U6WA 5JHUA 1R58A 2GG7A 3CB6A 2Q96A 3L24A 1YW8A 1CHMA 3PKCA 2GTXA 2Q8KA 4FLLA 2Q95A 4HXXA 4IECA 2BB7A 4ZNGA 4IKSA 1C23A 2GG5A 4IDYA 1YVMA 5E5BA 1WN1A 2P9AA 2Q92A 4S2RP 1YJ3A 1C22A 2GU7A 3RORA 5JI6A 4IKUA 2GGCA 2HOWA 2NQ7A 3PKBA 1N51A 4JUQA 1WL6A 2B3HA 2V6CA 1WKMA 2EA4A 1O0XA 4R60A 3MX6A 5CIKA 3TB5A 3FM3A 3IU7A 1Y1NA 3BITA 2BWYA 3TAVA 3IU9A 2BHBA 2G6PA 5CDVA 1YW7A 3D27A 4IPAA 3L7GA 2V3XA 5CDEA 4OOKA 1R5GA 1A16A 1W7VA 2V3ZA 2MATA 4ZWPA 4ZWUA 1WBQA 2GG3A 1WL9A 4MATA 2IW2A 2GA2A 4U75A 4IF7A 3RVAA 1XGOA 1KQ9A 1KP0A 2BWUA 2P98A 4ZWOA 2BHCA 2EVMA 2GG0A 2BHDA 2GGBA 1B59A 4IU6A 2V3YA 4PNCA 4EGEA 2BN7A 4FKCA 1W2MA 2GG2A 1XGSA 3FMRA 1QXYA 2BWVA 5FCFA 2Q94A 4U69A 4QR8A 3IU8A 2BWTA 2B3KA 1BOAA 2GG9A 3CB5A 2GU6A 4S01A 4U6EA 4Z7MA 2B3LA 2DFIA 1JAWA 4FLKA 2EVOA 1PV9A 2OAZA 3BIQA 3MATA 4RZYA 2P99A 3S6BA 2BWSA 2GU4A 1M35A 1XGMA 2Q93A 4RZZA 4S00A 2GG8A 5CDLA 3PKAA 3PKDA 4PV4A 2EA2A 1WY2A 3MR1A 4RGZ1 5FCHA 4U6ZA 4FLJA 2ZSGA 3FMQA 1MATA 5JFRA 2GZ5A 5D6EA 5CLSA 2OKNA 4IKRA 2BHAA 2EVCA 1R5HA 4B28A 5CE6A 1QXWA 1C24A 1XNZA 3Q6DA 2BWXA 1KQ0A 4U70A 3IG4A 2NQ6A 5D6FA 1QZYA 4U1BA 2GU5A 4IKTA 2ADUA 1BN5A 1XGNA 4U76A 4KM3A 4A6VA 1QXZA 1YW9A 4FUKA 4U73A 4FLIA 1C27A 5CNXA 4FO8A 4U6CA 1B6AA 3PKEA 4U71A 1WLRA 3CTZA 4A6WA
chains in the Genus database with same CATH superfamily
4U6JA 3BIPA 2BWWA 4FO7A 2BH3A 4S2TP 1C21A 4U6WA 5JHUA 1R58A 2GG7A 3CB6A 2Q96A 3L24A 1YW8A 1CHMA 3PKCA 2GTXA 2Q8KA 4FLLA 2Q95A 4HXXA 4IECA 2BB7A 4ZNGA 4IKSA 1C23A 2GG5A 4IDYA 1YVMA 5E5BA 1WN1A 2P9AA 2Q92A 4S2RP 1YJ3A 1C22A 2GU7A 3RORA 5JI6A 4IKUA 2GGCA 2HOWA 2NQ7A 3PKBA 1N51A 4JUQA 1WL6A 2B3HA 2V6CA 1WKMA 2EA4A 1O0XA 4R60A 3MX6A 5CIKA 3TB5A 3FM3A 3IU7A 1Y1NA 3BITA 2BWYA 3TAVA 3IU9A 2BHBA 2G6PA 5CDVA 1YW7A 3D27A 4IPAA 3L7GA 2V3XA 5CDEA 4OOKA 1R5GA 1A16A 1W7VA 2V3ZA 2MATA 4ZWPA 4ZWUA 1WBQA 2GG3A 1WL9A 4MATA 2IW2A 2GA2A 4U75A 4IF7A 3RVAA 1XGOA 1KQ9A 1KP0A 2BWUA 2P98A 4ZWOA 2BHCA 2EVMA 2GG0A 2BHDA 2GGBA 1B59A 4IU6A 2V3YA 4PNCA 4EGEA 2BN7A 4FKCA 1W2MA 2GG2A 1XGSA 3FMRA 1QXYA 2BWVA 5FCFA 2Q94A 4U69A 4QR8A 3IU8A 2BWTA 2B3KA 1BOAA 2GG9A 3CB5A 2GU6A 4S01A 4U6EA 4Z7MA 2B3LA 2DFIA 1JAWA 4FLKA 2EVOA 1PV9A 2OAZA 3BIQA 3MATA 4RZYA 2P99A 3S6BA 2BWSA 2GU4A 1M35A 1XGMA 2Q93A 4RZZA 4S00A 2GG8A 5CDLA 3PKAA 3PKDA 4PV4A 2EA2A 1WY2A 3MR1A 4RGZ1 5FCHA 4U6ZA 4FLJA 2ZSGA 3FMQA 1MATA 5JFRA 2GZ5A 5D6EA 5CLSA 2OKNA 4IKRA 2BHAA 2EVCA 1R5HA 4B28A 5CE6A 1QXWA 1C24A 1XNZA 3Q6DA 2BWXA 1KQ0A 4U70A 3IG4A 2NQ6A 5D6FA 1QZYA 4U1BA 2GU5A 4IKTA 2ADUA 1BN5A 1XGNA 4U76A 4KM3A 4A6VA 1QXZA 1YW9A 4FUKA 4U73A 4FLIA 1C27A 5CNXA 4FO8A 4U6CA 1B6AA 3PKEA 4U71A 1WLRA 3CTZA 4A6WA
chains in the Genus database with same CATH topology
4U6JA 3BIPA 2BWWA 4FO7A 2BH3A 4S2TP 1C21A 4U6WA 5JHUA 1R58A 2GG7A 3CB6A 2Q96A 3L24A 1YW8A 1CHMA 3PKCA 2GTXA 2Q8KA 4FLLA 2Q95A 4HXXA 4IECA 2BB7A 4ZNGA 4IKSA 1C23A 2GG5A 4IDYA 1YVMA 5E5BA 1WN1A 2P9AA 2Q92A 4S2RP 1YJ3A 1C22A 2GU7A 3RORA 5JI6A 4IKUA 2GGCA 2HOWA 2NQ7A 3PKBA 1N51A 4JUQA 1WL6A 2B3HA 2V6CA 1WKMA 2EA4A 1O0XA 4R60A 3MX6A 5CIKA 3TB5A 3FM3A 3IU7A 1Y1NA 3BITA 2BWYA 3TAVA 3IU9A 2BHBA 2G6PA 5CDVA 1YW7A 3D27A 4IPAA 3L7GA 2V3XA 5CDEA 4OOKA 1R5GA 1A16A 1W7VA 2V3ZA 2MATA 4ZWPA 4ZWUA 1WBQA 2GG3A 1WL9A 4MATA 2IW2A 2GA2A 4U75A 4IF7A 3RVAA 1XGOA 1KQ9A 1KP0A 2BWUA 2P98A 4ZWOA 2BHCA 2EVMA 2GG0A 2BHDA 2GGBA 1B59A 4IU6A 2V3YA 4PNCA 4EGEA 2BN7A 4FKCA 1W2MA 2GG2A 1XGSA 3FMRA 1QXYA 2BWVA 5FCFA 2Q94A 4U69A 4QR8A 3IU8A 2BWTA 2B3KA 1BOAA 2GG9A 3CB5A 2GU6A 4S01A 4U6EA 4Z7MA 2B3LA 2DFIA 1JAWA 4FLKA 2EVOA 1PV9A 2OAZA 3BIQA 3MATA 4RZYA 2P99A 3S6BA 2BWSA 2GU4A 1M35A 1XGMA 2Q93A 4RZZA 4S00A 2GG8A 5CDLA 3PKAA 3PKDA 4PV4A 2EA2A 1WY2A 3MR1A 4RGZ1 5FCHA 4U6ZA 4FLJA 2ZSGA 3FMQA 1MATA 5JFRA 2GZ5A 5D6EA 5CLSA 2OKNA 4IKRA 2BHAA 2EVCA 1R5HA 4B28A 5CE6A 1QXWA 1C24A 1XNZA 3Q6DA 2BWXA 1KQ0A 4U70A 3IG4A 2NQ6A 5D6FA 1QZYA 4U1BA 2GU5A 4IKTA 2ADUA 1BN5A 1XGNA 4U76A 4KM3A 4A6VA 1QXZA 1YW9A 4FUKA 4U73A 4FLIA 1C27A 5CNXA 4FO8A 4U6CA 1B6AA 3PKEA 4U71A 1WLRA 3CTZA 4A6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U6J A;  3BIP A;  2BWW A;  4FO7 A;  2BH3 A;  4S2T P;  1C21 A;  4U6W A;  5JHU A;  1R58 A;  2GG7 A;  3CB6 A;  2Q96 A;  3L24 A;  1YW8 A;  1CHM A;  3PKC A;  2GTX A;  2Q8K A;  4FLL A;  2Q95 A;  4HXX A;  4IEC A;  2BB7 A;  4ZNG A;  4IKS A;  1C23 A;  2GG5 A;  4IDY A;  1YVM A;  5E5B A;  1WN1 A;  2P9A A;  2Q92 A;  4S2R P;  1YJ3 A;  1C22 A;  2GU7 A;  3ROR A;  5JI6 A;  4IKU A;  2GGC A;  2HOW A;  2NQ7 A;  3PKB A;  1N51 A;  4JUQ A;  1WL6 A;  2B3H A;  2V6C A;  1WKM A;  2EA4 A;  1O0X A;  4R60 A;  3MX6 A;  5CIK A;  3TB5 A;  3FM3 A;  3IU7 A;  1Y1N A;  3BIT A;  2BWY A;  3TAV A;  3IU9 A;  2BHB A;  2G6P A;  5CDV A;  1YW7 A;  3D27 A;  4IPA A;  3L7G A;  2V3X A;  5CDE A;  4OOK A;  1R5G A;  1A16 A;  1W7V A;  2V3Z A;  2MAT A;  4ZWP A;  4ZWU A;  1WBQ A;  2GG3 A;  1WL9 A;  4MAT A;  2IW2 A;  2GA2 A;  4U75 A;  4IF7 A;  3RVA A;  1XGO A;  1KQ9 A;  1KP0 A;  2BWU A;  2P98 A;  4ZWO A;  2BHC A;  2EVM A;  2GG0 A;  2BHD A;  2GGB A;  1B59 A;  4IU6 A;  2V3Y A;  4PNC A;  4EGE A;  2BN7 A;  4FKC A;  1W2M A;  2GG2 A;  1XGS A;  3FMR A;  1QXY A;  2BWV A;  5FCF A;  2Q94 A;  4U69 A;  4QR8 A;  3IU8 A;  2BWT A;  2B3K A;  1BOA A;  2GG9 A;  3CB5 A;  2GU6 A;  4S01 A;  4U6E A;  4Z7M A;  2B3L A;  2DFI A;  1JAW A;  4FLK A;  2EVO A;  1PV9 A;  2OAZ A;  3BIQ A;  3MAT A;  4RZY A;  2P99 A;  3S6B A;  2BWS A;  2GU4 A;  1M35 A;  1XGM A;  2Q93 A;  4RZZ A;  4S00 A;  2GG8 A;  5CDL A;  3PKA A;  3PKD A;  4PV4 A;  2EA2 A;  1WY2 A;  3MR1 A;  4RGZ 1;  5FCH A;  4U6Z A;  4FLJ A;  2ZSG A;  3FMQ A;  1MAT A;  5JFR A;  2GZ5 A;  5D6E A;  5CLS A;  2OKN A;  4IKR A;  2BHA A;  2EVC A;  1R5H A;  4B28 A;  5CE6 A;  1QXW A;  1C24 A;  1XNZ A;  3Q6D A;  2BWX A;  1KQ0 A;  4U70 A;  3IG4 A;  2NQ6 A;  5D6F A;  1QZY A;  4U1B A;  2GU5 A;  4IKT A;  2ADU A;  1BN5 A;  1XGN A;  4U76 A;  4KM3 A;  4A6V A;  1QXZ A;  1YW9 A;  4FUK A;  4U73 A;  4FLI A;  1C27 A;  5CNX A;  4FO8 A;  4U6C A;  1B6A A;  3PKE A;  4U71 A;  1WLR A;  3CTZ A;  4A6W A; 
#chains in the Genus database with same CATH topology
 4U6J A;  3BIP A;  2BWW A;  4FO7 A;  2BH3 A;  4S2T P;  1C21 A;  4U6W A;  5JHU A;  1R58 A;  2GG7 A;  3CB6 A;  2Q96 A;  3L24 A;  1YW8 A;  1CHM A;  3PKC A;  2GTX A;  2Q8K A;  4FLL A;  2Q95 A;  4HXX A;  4IEC A;  2BB7 A;  4ZNG A;  4IKS A;  1C23 A;  2GG5 A;  4IDY A;  1YVM A;  5E5B A;  1WN1 A;  2P9A A;  2Q92 A;  4S2R P;  1YJ3 A;  1C22 A;  2GU7 A;  3ROR A;  5JI6 A;  4IKU A;  2GGC A;  2HOW A;  2NQ7 A;  3PKB A;  1N51 A;  4JUQ A;  1WL6 A;  2B3H A;  2V6C A;  1WKM A;  2EA4 A;  1O0X A;  4R60 A;  3MX6 A;  5CIK A;  3TB5 A;  3FM3 A;  3IU7 A;  1Y1N A;  3BIT A;  2BWY A;  3TAV A;  3IU9 A;  2BHB A;  2G6P A;  5CDV A;  1YW7 A;  3D27 A;  4IPA A;  3L7G A;  2V3X A;  5CDE A;  4OOK A;  1R5G A;  1A16 A;  1W7V A;  2V3Z A;  2MAT A;  4ZWP A;  4ZWU A;  1WBQ A;  2GG3 A;  1WL9 A;  4MAT A;  2IW2 A;  2GA2 A;  4U75 A;  4IF7 A;  3RVA A;  1XGO A;  1KQ9 A;  1KP0 A;  2BWU A;  2P98 A;  4ZWO A;  2BHC A;  2EVM A;  2GG0 A;  2BHD A;  2GGB A;  1B59 A;  4IU6 A;  2V3Y A;  4PNC A;  4EGE A;  2BN7 A;  4FKC A;  1W2M A;  2GG2 A;  1XGS A;  3FMR A;  1QXY A;  2BWV A;  5FCF A;  2Q94 A;  4U69 A;  4QR8 A;  3IU8 A;  2BWT A;  2B3K A;  1BOA A;  2GG9 A;  3CB5 A;  2GU6 A;  4S01 A;  4U6E A;  4Z7M A;  2B3L A;  2DFI A;  1JAW A;  4FLK A;  2EVO A;  1PV9 A;  2OAZ A;  3BIQ A;  3MAT A;  4RZY A;  2P99 A;  3S6B A;  2BWS A;  2GU4 A;  1M35 A;  1XGM A;  2Q93 A;  4RZZ A;  4S00 A;  2GG8 A;  5CDL A;  3PKA A;  3PKD A;  4PV4 A;  2EA2 A;  1WY2 A;  3MR1 A;  4RGZ 1;  5FCH A;  4U6Z A;  4FLJ A;  2ZSG A;  3FMQ A;  1MAT A;  5JFR A;  2GZ5 A;  5D6E A;  5CLS A;  2OKN A;  4IKR A;  2BHA A;  2EVC A;  1R5H A;  4B28 A;  5CE6 A;  1QXW A;  1C24 A;  1XNZ A;  3Q6D A;  2BWX A;  1KQ0 A;  4U70 A;  3IG4 A;  2NQ6 A;  5D6F A;  1QZY A;  4U1B A;  2GU5 A;  4IKT A;  2ADU A;  1BN5 A;  1XGN A;  4U76 A;  4KM3 A;  4A6V A;  1QXZ A;  1YW9 A;  4FUK A;  4U73 A;  4FLI A;  1C27 A;  5CNX A;  4FO8 A;  4U6C A;  1B6A A;  3PKE A;  4U71 A;  1WLR A;  3CTZ A;  4A6W A; 
#chains in the Genus database with same CATH homology
 4U6J A;  3BIP A;  2BWW A;  4FO7 A;  2BH3 A;  4S2T P;  1C21 A;  4U6W A;  5JHU A;  1R58 A;  2GG7 A;  3CB6 A;  2Q96 A;  3L24 A;  1YW8 A;  1CHM A;  3PKC A;  2GTX A;  2Q8K A;  4FLL A;  2Q95 A;  4HXX A;  4IEC A;  2BB7 A;  4ZNG A;  4IKS A;  1C23 A;  2GG5 A;  4IDY A;  1YVM A;  5E5B A;  1WN1 A;  2P9A A;  2Q92 A;  4S2R P;  1YJ3 A;  1C22 A;  2GU7 A;  3ROR A;  5JI6 A;  4IKU A;  2GGC A;  2HOW A;  2NQ7 A;  3PKB A;  1N51 A;  4JUQ A;  1WL6 A;  2B3H A;  2V6C A;  1WKM A;  2EA4 A;  1O0X A;  4R60 A;  3MX6 A;  5CIK A;  3TB5 A;  3FM3 A;  3IU7 A;  1Y1N A;  3BIT A;  2BWY A;  3TAV A;  3IU9 A;  2BHB A;  2G6P A;  5CDV A;  1YW7 A;  3D27 A;  4IPA A;  3L7G A;  2V3X A;  5CDE A;  4OOK A;  1R5G A;  1A16 A;  1W7V A;  2V3Z A;  2MAT A;  4ZWP A;  4ZWU A;  1WBQ A;  2GG3 A;  1WL9 A;  4MAT A;  2IW2 A;  2GA2 A;  4U75 A;  4IF7 A;  3RVA A;  1XGO A;  1KQ9 A;  1KP0 A;  2BWU A;  2P98 A;  4ZWO A;  2BHC A;  2EVM A;  2GG0 A;  2BHD A;  2GGB A;  1B59 A;  4IU6 A;  2V3Y A;  4PNC A;  4EGE A;  2BN7 A;  4FKC A;  1W2M A;  2GG2 A;  1XGS A;  3FMR A;  1QXY A;  2BWV A;  5FCF A;  2Q94 A;  4U69 A;  4QR8 A;  3IU8 A;  2BWT A;  2B3K A;  1BOA A;  2GG9 A;  3CB5 A;  2GU6 A;  4S01 A;  4U6E A;  4Z7M A;  2B3L A;  2DFI A;  1JAW A;  4FLK A;  2EVO A;  1PV9 A;  2OAZ A;  3BIQ A;  3MAT A;  4RZY A;  2P99 A;  3S6B A;  2BWS A;  2GU4 A;  1M35 A;  1XGM A;  2Q93 A;  4RZZ A;  4S00 A;  2GG8 A;  5CDL A;  3PKA A;  3PKD A;  4PV4 A;  2EA2 A;  1WY2 A;  3MR1 A;  4RGZ 1;  5FCH A;  4U6Z A;  4FLJ A;  2ZSG A;  3FMQ A;  1MAT A;  5JFR A;  2GZ5 A;  5D6E A;  5CLS A;  2OKN A;  4IKR A;  2BHA A;  2EVC A;  1R5H A;  4B28 A;  5CE6 A;  1QXW A;  1C24 A;  1XNZ A;  3Q6D A;  2BWX A;  1KQ0 A;  4U70 A;  3IG4 A;  2NQ6 A;  5D6F A;  1QZY A;  4U1B A;  2GU5 A;  4IKT A;  2ADU A;  1BN5 A;  1XGN A;  4U76 A;  4KM3 A;  4A6V A;  1QXZ A;  1YW9 A;  4FUK A;  4U73 A;  4FLI A;  1C27 A;  5CNX A;  4FO8 A;  4U6C A;  1B6A A;  3PKE A;  4U71 A;  1WLR A;  3CTZ A;  4A6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...