2GU5A

E. coli methionine aminopeptidase in complex with nlep, 1: 1, di-metalated
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 88
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gu5A00
2ZSGA 2GG5A 4ZWOA 2V6CA 1QZYA 4U6ZA 2DFIA 1WL9A 4FLJA 4S2TP 2V3XA 3FM3A 4FLIA 3IG4A 2IW2A 4U6CA 2Q92A 2V3ZA 2B3LA 4PNCA 4U6EA 5E5BA 2EVCA 3PKDA 1XGMA 4MATA 4RZZA 2GZ5A 2Q95A 4U73A 4FO8A 1WN1A 2GA2A 3CTZA 3Q6DA 3MATA 1WKMA 1C27A 2NQ6A 1B6AA 5CDEA 2Q96A 4Z7MA 3BIQA 1QXZA 3PKEA 5D6FA 3TB5A 4EGEA 4HXXA 4U70A 2Q93A 2NQ7A 1M35A 2OKNA 1BOAA 2BWTA 2BH3A 1YVMA 2GG3A 1A16A 1YJ3A 4FKCA 2GG0A 1QXWA 4IKSA 2BN7A 3PKCA 4A6WA 5JFRA 4IPAA 2GU4A 2GTXA 1R5GA 2BHCA 4U6WA 2BWWA 2GGCA 3RVAA 2BWUA 3CB6A 2BWSA 3IU7A 2B3HA 2BWVA 1MATA 2P9AA 4ZNGA 4A6VA 3IU9A 3BIPA 1C22A 1CHMA 1W7VA 1PV9A 4KM3A 5CLSA 1XGNA 2Q8KA 5CDVA 2GU6A 2HOWA 1WL6A 2G6PA 3PKAA 1KQ0A 4IKRA 3BITA 1XGOA 1C23A 2BWXA 2V3YA 3PKBA 5FCFA 2EVMA 4RZYA 5CE6A 1YW9A 3FMRA 4RGZ1 4U6JA 1WLRA 1KQ9A 4FLKA 4U75A 2BB7A 1R5HA 2GU5A 1XNZA 1KP0A 4U76A 4PV4A 3L7GA 1XGSA 2GGBA 2GG2A 1O0XA 1WBQA 1JAWA 1YW8A 5FCHA 4IF7A 2EVOA 5D6EA 4R60A 1BN5A 4IDYA 4U1BA 1W2MA 1B59A 3IU8A 5CIKA 4ZWUA 2P99A 4FLLA 1C21A 3CB5A 5CNXA 4ZWPA 4FUKA 3MX6A 1WY2A 2Q94A 4U69A 2BHAA 4IKTA 1YW7A 3MR1A 2GG9A 3TAVA 5CDLA 3D27A 1QXYA 2BHBA 3FMQA 4IKUA 2EA2A 2BHDA 1R58A 2BWYA 2ADUA 4FO7A 4S01A 2GG7A 4U71A 1Y1NA 2P98A 4S2RP 2B3KA 4JUQA 2EA4A 3RORA 5JHUA 4S00A 4IECA 4IU6A 4OOKA 4QR8A 4B28A 3S6BA 3L24A 5JI6A 2MATA 2GG8A 1N51A 2GU7A 2OAZA 1C24A
chains in the Genus database with same CATH superfamily
2ZSGA 2GG5A 4ZWOA 2V6CA 1QZYA 4U6ZA 2DFIA 1WL9A 4FLJA 4S2TP 2V3XA 3FM3A 4FLIA 3IG4A 2IW2A 4U6CA 2Q92A 2V3ZA 2B3LA 4PNCA 4U6EA 5E5BA 2EVCA 3PKDA 1XGMA 4MATA 4RZZA 2GZ5A 2Q95A 4U73A 4FO8A 1WN1A 2GA2A 3CTZA 3Q6DA 3MATA 1WKMA 1C27A 2NQ6A 1B6AA 5CDEA 2Q96A 4Z7MA 3BIQA 1QXZA 3PKEA 5D6FA 3TB5A 4EGEA 4HXXA 4U70A 2Q93A 2NQ7A 1M35A 2OKNA 1BOAA 2BWTA 2BH3A 1YVMA 2GG3A 1A16A 1YJ3A 4FKCA 2GG0A 1QXWA 4IKSA 2BN7A 3PKCA 4A6WA 5JFRA 4IPAA 2GU4A 2GTXA 1R5GA 2BHCA 4U6WA 2BWWA 2GGCA 3RVAA 2BWUA 3CB6A 2BWSA 3IU7A 2B3HA 2BWVA 1MATA 2P9AA 4ZNGA 4A6VA 3IU9A 3BIPA 1C22A 1CHMA 1W7VA 1PV9A 4KM3A 5CLSA 1XGNA 2Q8KA 5CDVA 2GU6A 2HOWA 1WL6A 2G6PA 3PKAA 1KQ0A 4IKRA 3BITA 1XGOA 1C23A 2BWXA 2V3YA 3PKBA 5FCFA 2EVMA 4RZYA 5CE6A 1YW9A 3FMRA 4RGZ1 4U6JA 1WLRA 1KQ9A 4FLKA 4U75A 2BB7A 1R5HA 2GU5A 1XNZA 1KP0A 4U76A 4PV4A 3L7GA 1XGSA 2GGBA 2GG2A 1O0XA 1WBQA 1JAWA 1YW8A 5FCHA 4IF7A 2EVOA 5D6EA 4R60A 1BN5A 4IDYA 4U1BA 1W2MA 1B59A 3IU8A 5CIKA 4ZWUA 2P99A 4FLLA 1C21A 3CB5A 5CNXA 4ZWPA 4FUKA 3MX6A 1WY2A 2Q94A 4U69A 2BHAA 4IKTA 1YW7A 3MR1A 2GG9A 3TAVA 5CDLA 3D27A 1QXYA 2BHBA 3FMQA 4IKUA 2EA2A 2BHDA 1R58A 2BWYA 2ADUA 4FO7A 4S01A 2GG7A 4U71A 1Y1NA 2P98A 4S2RP 2B3KA 4JUQA 2EA4A 3RORA 5JHUA 4S00A 4IECA 4IU6A 4OOKA 4QR8A 4B28A 3S6BA 3L24A 5JI6A 2MATA 2GG8A 1N51A 2GU7A 2OAZA 1C24A
chains in the Genus database with same CATH topology
2ZSGA 2GG5A 4ZWOA 2V6CA 1QZYA 4U6ZA 2DFIA 1WL9A 4FLJA 4S2TP 2V3XA 3FM3A 4FLIA 3IG4A 2IW2A 4U6CA 2Q92A 2V3ZA 2B3LA 4PNCA 4U6EA 5E5BA 2EVCA 3PKDA 1XGMA 4MATA 4RZZA 2GZ5A 2Q95A 4U73A 4FO8A 1WN1A 2GA2A 3CTZA 3Q6DA 3MATA 1WKMA 1C27A 2NQ6A 1B6AA 5CDEA 2Q96A 4Z7MA 3BIQA 1QXZA 3PKEA 5D6FA 3TB5A 4EGEA 4HXXA 4U70A 2Q93A 2NQ7A 1M35A 2OKNA 1BOAA 2BWTA 2BH3A 1YVMA 2GG3A 1A16A 1YJ3A 4FKCA 2GG0A 1QXWA 4IKSA 2BN7A 3PKCA 4A6WA 5JFRA 4IPAA 2GU4A 2GTXA 1R5GA 2BHCA 4U6WA 2BWWA 2GGCA 3RVAA 2BWUA 3CB6A 2BWSA 3IU7A 2B3HA 2BWVA 1MATA 2P9AA 4ZNGA 4A6VA 3IU9A 3BIPA 1C22A 1CHMA 1W7VA 1PV9A 4KM3A 5CLSA 1XGNA 2Q8KA 5CDVA 2GU6A 2HOWA 1WL6A 2G6PA 3PKAA 1KQ0A 4IKRA 3BITA 1XGOA 1C23A 2BWXA 2V3YA 3PKBA 5FCFA 2EVMA 4RZYA 5CE6A 1YW9A 3FMRA 4RGZ1 4U6JA 1WLRA 1KQ9A 4FLKA 4U75A 2BB7A 1R5HA 2GU5A 1XNZA 1KP0A 4U76A 4PV4A 3L7GA 1XGSA 2GGBA 2GG2A 1O0XA 1WBQA 1JAWA 1YW8A 5FCHA 4IF7A 2EVOA 5D6EA 4R60A 1BN5A 4IDYA 4U1BA 1W2MA 1B59A 3IU8A 5CIKA 4ZWUA 2P99A 4FLLA 1C21A 3CB5A 5CNXA 4ZWPA 4FUKA 3MX6A 1WY2A 2Q94A 4U69A 2BHAA 4IKTA 1YW7A 3MR1A 2GG9A 3TAVA 5CDLA 3D27A 1QXYA 2BHBA 3FMQA 4IKUA 2EA2A 2BHDA 1R58A 2BWYA 2ADUA 4FO7A 4S01A 2GG7A 4U71A 1Y1NA 2P98A 4S2RP 2B3KA 4JUQA 2EA4A 3RORA 5JHUA 4S00A 4IECA 4IU6A 4OOKA 4QR8A 4B28A 3S6BA 3L24A 5JI6A 2MATA 2GG8A 1N51A 2GU7A 2OAZA 1C24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZSG A;  2GG5 A;  4ZWO A;  2V6C A;  1QZY A;  4U6Z A;  2DFI A;  1WL9 A;  4FLJ A;  4S2T P;  2V3X A;  3FM3 A;  4FLI A;  3IG4 A;  2IW2 A;  4U6C A;  2Q92 A;  2V3Z A;  2B3L A;  4PNC A;  4U6E A;  5E5B A;  2EVC A;  3PKD A;  1XGM A;  4MAT A;  4RZZ A;  2GZ5 A;  2Q95 A;  4U73 A;  4FO8 A;  1WN1 A;  2GA2 A;  3CTZ A;  3Q6D A;  3MAT A;  1WKM A;  1C27 A;  2NQ6 A;  1B6A A;  5CDE A;  2Q96 A;  4Z7M A;  3BIQ A;  1QXZ A;  3PKE A;  5D6F A;  3TB5 A;  4EGE A;  4HXX A;  4U70 A;  2Q93 A;  2NQ7 A;  1M35 A;  2OKN A;  1BOA A;  2BWT A;  2BH3 A;  1YVM A;  2GG3 A;  1A16 A;  1YJ3 A;  4FKC A;  2GG0 A;  1QXW A;  4IKS A;  2BN7 A;  3PKC A;  4A6W A;  5JFR A;  4IPA A;  2GU4 A;  2GTX A;  1R5G A;  2BHC A;  4U6W A;  2BWW A;  2GGC A;  3RVA A;  2BWU A;  3CB6 A;  2BWS A;  3IU7 A;  2B3H A;  2BWV A;  1MAT A;  2P9A A;  4ZNG A;  4A6V A;  3IU9 A;  3BIP A;  1C22 A;  1CHM A;  1W7V A;  1PV9 A;  4KM3 A;  5CLS A;  1XGN A;  2Q8K A;  5CDV A;  2GU6 A;  2HOW A;  1WL6 A;  2G6P A;  3PKA A;  1KQ0 A;  4IKR A;  3BIT A;  1XGO A;  1C23 A;  2BWX A;  2V3Y A;  3PKB A;  5FCF A;  2EVM A;  4RZY A;  5CE6 A;  1YW9 A;  3FMR A;  4RGZ 1;  4U6J A;  1WLR A;  1KQ9 A;  4FLK A;  4U75 A;  2BB7 A;  1R5H A;  2GU5 A;  1XNZ A;  1KP0 A;  4U76 A;  4PV4 A;  3L7G A;  1XGS A;  2GGB A;  2GG2 A;  1O0X A;  1WBQ A;  1JAW A;  1YW8 A;  5FCH A;  4IF7 A;  2EVO A;  5D6E A;  4R60 A;  1BN5 A;  4IDY A;  4U1B A;  1W2M A;  1B59 A;  3IU8 A;  5CIK A;  4ZWU A;  2P99 A;  4FLL A;  1C21 A;  3CB5 A;  5CNX A;  4ZWP A;  4FUK A;  3MX6 A;  1WY2 A;  2Q94 A;  4U69 A;  2BHA A;  4IKT A;  1YW7 A;  3MR1 A;  2GG9 A;  3TAV A;  5CDL A;  3D27 A;  1QXY A;  2BHB A;  3FMQ A;  4IKU A;  2EA2 A;  2BHD A;  1R58 A;  2BWY A;  2ADU A;  4FO7 A;  4S01 A;  2GG7 A;  4U71 A;  1Y1N A;  2P98 A;  4S2R P;  2B3K A;  4JUQ A;  2EA4 A;  3ROR A;  5JHU A;  4S00 A;  4IEC A;  4IU6 A;  4OOK A;  4QR8 A;  4B28 A;  3S6B A;  3L24 A;  5JI6 A;  2MAT A;  2GG8 A;  1N51 A;  2GU7 A;  2OAZ A;  1C24 A; 
#chains in the Genus database with same CATH topology
 2ZSG A;  2GG5 A;  4ZWO A;  2V6C A;  1QZY A;  4U6Z A;  2DFI A;  1WL9 A;  4FLJ A;  4S2T P;  2V3X A;  3FM3 A;  4FLI A;  3IG4 A;  2IW2 A;  4U6C A;  2Q92 A;  2V3Z A;  2B3L A;  4PNC A;  4U6E A;  5E5B A;  2EVC A;  3PKD A;  1XGM A;  4MAT A;  4RZZ A;  2GZ5 A;  2Q95 A;  4U73 A;  4FO8 A;  1WN1 A;  2GA2 A;  3CTZ A;  3Q6D A;  3MAT A;  1WKM A;  1C27 A;  2NQ6 A;  1B6A A;  5CDE A;  2Q96 A;  4Z7M A;  3BIQ A;  1QXZ A;  3PKE A;  5D6F A;  3TB5 A;  4EGE A;  4HXX A;  4U70 A;  2Q93 A;  2NQ7 A;  1M35 A;  2OKN A;  1BOA A;  2BWT A;  2BH3 A;  1YVM A;  2GG3 A;  1A16 A;  1YJ3 A;  4FKC A;  2GG0 A;  1QXW A;  4IKS A;  2BN7 A;  3PKC A;  4A6W A;  5JFR A;  4IPA A;  2GU4 A;  2GTX A;  1R5G A;  2BHC A;  4U6W A;  2BWW A;  2GGC A;  3RVA A;  2BWU A;  3CB6 A;  2BWS A;  3IU7 A;  2B3H A;  2BWV A;  1MAT A;  2P9A A;  4ZNG A;  4A6V A;  3IU9 A;  3BIP A;  1C22 A;  1CHM A;  1W7V A;  1PV9 A;  4KM3 A;  5CLS A;  1XGN A;  2Q8K A;  5CDV A;  2GU6 A;  2HOW A;  1WL6 A;  2G6P A;  3PKA A;  1KQ0 A;  4IKR A;  3BIT A;  1XGO A;  1C23 A;  2BWX A;  2V3Y A;  3PKB A;  5FCF A;  2EVM A;  4RZY A;  5CE6 A;  1YW9 A;  3FMR A;  4RGZ 1;  4U6J A;  1WLR A;  1KQ9 A;  4FLK A;  4U75 A;  2BB7 A;  1R5H A;  2GU5 A;  1XNZ A;  1KP0 A;  4U76 A;  4PV4 A;  3L7G A;  1XGS A;  2GGB A;  2GG2 A;  1O0X A;  1WBQ A;  1JAW A;  1YW8 A;  5FCH A;  4IF7 A;  2EVO A;  5D6E A;  4R60 A;  1BN5 A;  4IDY A;  4U1B A;  1W2M A;  1B59 A;  3IU8 A;  5CIK A;  4ZWU A;  2P99 A;  4FLL A;  1C21 A;  3CB5 A;  5CNX A;  4ZWP A;  4FUK A;  3MX6 A;  1WY2 A;  2Q94 A;  4U69 A;  2BHA A;  4IKT A;  1YW7 A;  3MR1 A;  2GG9 A;  3TAV A;  5CDL A;  3D27 A;  1QXY A;  2BHB A;  3FMQ A;  4IKU A;  2EA2 A;  2BHD A;  1R58 A;  2BWY A;  2ADU A;  4FO7 A;  4S01 A;  2GG7 A;  4U71 A;  1Y1N A;  2P98 A;  4S2R P;  2B3K A;  4JUQ A;  2EA4 A;  3ROR A;  5JHU A;  4S00 A;  4IEC A;  4IU6 A;  4OOK A;  4QR8 A;  4B28 A;  3S6B A;  3L24 A;  5JI6 A;  2MAT A;  2GG8 A;  1N51 A;  2GU7 A;  2OAZ A;  1C24 A; 
#chains in the Genus database with same CATH homology
 2ZSG A;  2GG5 A;  4ZWO A;  2V6C A;  1QZY A;  4U6Z A;  2DFI A;  1WL9 A;  4FLJ A;  4S2T P;  2V3X A;  3FM3 A;  4FLI A;  3IG4 A;  2IW2 A;  4U6C A;  2Q92 A;  2V3Z A;  2B3L A;  4PNC A;  4U6E A;  5E5B A;  2EVC A;  3PKD A;  1XGM A;  4MAT A;  4RZZ A;  2GZ5 A;  2Q95 A;  4U73 A;  4FO8 A;  1WN1 A;  2GA2 A;  3CTZ A;  3Q6D A;  3MAT A;  1WKM A;  1C27 A;  2NQ6 A;  1B6A A;  5CDE A;  2Q96 A;  4Z7M A;  3BIQ A;  1QXZ A;  3PKE A;  5D6F A;  3TB5 A;  4EGE A;  4HXX A;  4U70 A;  2Q93 A;  2NQ7 A;  1M35 A;  2OKN A;  1BOA A;  2BWT A;  2BH3 A;  1YVM A;  2GG3 A;  1A16 A;  1YJ3 A;  4FKC A;  2GG0 A;  1QXW A;  4IKS A;  2BN7 A;  3PKC A;  4A6W A;  5JFR A;  4IPA A;  2GU4 A;  2GTX A;  1R5G A;  2BHC A;  4U6W A;  2BWW A;  2GGC A;  3RVA A;  2BWU A;  3CB6 A;  2BWS A;  3IU7 A;  2B3H A;  2BWV A;  1MAT A;  2P9A A;  4ZNG A;  4A6V A;  3IU9 A;  3BIP A;  1C22 A;  1CHM A;  1W7V A;  1PV9 A;  4KM3 A;  5CLS A;  1XGN A;  2Q8K A;  5CDV A;  2GU6 A;  2HOW A;  1WL6 A;  2G6P A;  3PKA A;  1KQ0 A;  4IKR A;  3BIT A;  1XGO A;  1C23 A;  2BWX A;  2V3Y A;  3PKB A;  5FCF A;  2EVM A;  4RZY A;  5CE6 A;  1YW9 A;  3FMR A;  4RGZ 1;  4U6J A;  1WLR A;  1KQ9 A;  4FLK A;  4U75 A;  2BB7 A;  1R5H A;  2GU5 A;  1XNZ A;  1KP0 A;  4U76 A;  4PV4 A;  3L7G A;  1XGS A;  2GGB A;  2GG2 A;  1O0X A;  1WBQ A;  1JAW A;  1YW8 A;  5FCH A;  4IF7 A;  2EVO A;  5D6E A;  4R60 A;  1BN5 A;  4IDY A;  4U1B A;  1W2M A;  1B59 A;  3IU8 A;  5CIK A;  4ZWU A;  2P99 A;  4FLL A;  1C21 A;  3CB5 A;  5CNX A;  4ZWP A;  4FUK A;  3MX6 A;  1WY2 A;  2Q94 A;  4U69 A;  2BHA A;  4IKT A;  1YW7 A;  3MR1 A;  2GG9 A;  3TAV A;  5CDL A;  3D27 A;  1QXY A;  2BHB A;  3FMQ A;  4IKU A;  2EA2 A;  2BHD A;  1R58 A;  2BWY A;  2ADU A;  4FO7 A;  4S01 A;  2GG7 A;  4U71 A;  1Y1N A;  2P98 A;  4S2R P;  2B3K A;  4JUQ A;  2EA4 A;  3ROR A;  5JHU A;  4S00 A;  4IEC A;  4IU6 A;  4OOK A;  4QR8 A;  4B28 A;  3S6B A;  3L24 A;  5JI6 A;  2MAT A;  2GG8 A;  1N51 A;  2GU7 A;  2OAZ A;  1C24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...