2GU5A

E. coli methionine aminopeptidase in complex with nlep, 1: 1, di-metalated
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gu5A00
2GG9A 4RZYA 1C22A 4U6WA 1QXYA 2GU6A 3BITA 1QXWA 2NQ7A 4FO8A 1QXZA 1WL6A 1C24A 4FLIA 4U75A 1XGOA 3PKBA 2GU5A 2ADUA 1W7VA 1WLRA 2BWTA 2Q95A 4QR8A 3BIQA 4S2RP 4PV4A 4U70A 1JAWA 4S00A 3FM3A 5E5BA 4FLJA 4FKCA 4IDYA 4U69A 2DFIA 4MATA 1C23A 2BWUA 4FLLA 1BOAA 4U71A 4S01A 4U76A 2P9AA 2GA2A 2Q8KA 1C21A 2GGBA 2V6CA 4ZNGA 1YVMA 5JFRA 2P99A 4ZWUA 2GG3A 2BHDA 1BN5A 1YW9A 2BWVA 3FMRA 4U6ZA 2BHCA 3L24A 3PKCA 3RORA 5JHUA 5CDLA 2B3LA 2BWXA 2GG0A 4FO7A 2IW2A 2BWYA 2Q96A 2OAZA 3D27A 4IECA 4IKRA 2EVCA 2Q92A 3CB5A 2GG2A 4RZZA 2EA4A 2B3HA 2ZSGA 3FMQA 4IPAA 4U6CA 1R5HA 2EA2A 3MX6A 3IU7A 1KQ0A 2B3KA 2BH3A 2GG7A 4HXXA 4R60A 5CIKA 2HOWA 5CDEA 4JUQA 3CTZA 3MATA 5D6FA 1Y1NA 1C27A 1MATA 4ZWPA 4U6JA 3IU8A 4U73A 4IU6A 1M35A 2G6PA 1YW8A 2BWSA 1YW7A 4A6WA 3IU9A 4IF7A 3CB6A 5FCHA 4IKSA 1WBQA 1KP0A 5CLSA 2GTXA 1XGMA 5JI6A 2V3XA 2OKNA 1WY2A 1WKMA 3L7GA 1CHMA 4KM3A 4PNCA 3TB5A 1W2MA 1KQ9A 4IKTA 5CE6A 2EVOA 1WL9A 4Z7MA 4ZWOA 2NQ6A 3PKAA 2MATA 1WN1A 3RVAA 2BN7A 4EGEA 2BHAA 2Q94A 5CDVA 2BHBA 2P98A 2V3YA 4U6EA 4RGZ1 2V3ZA 4FLKA 1PV9A 1XGSA 2GU7A 4U1BA 3S6BA 3Q6DA 5CNXA 5FCFA 1B6AA 2GZ5A 2GGCA 5D6EA 4IKUA 2EVMA 4S2TP 1XNZA 1QZYA 2GG5A 4FUKA 2BWWA 4A6VA 3IG4A 2Q93A 4B28A 1O0XA 1B59A 1R5GA 1YJ3A 1XGNA 2BB7A 1A16A 3PKDA 3PKEA 4OOKA 3TAVA 3BIPA 1R58A 3MR1A 2GG8A 1N51A 2GU4A
chains in the Genus database with same CATH superfamily
2GG9A 4RZYA 1C22A 4U6WA 1QXYA 2GU6A 3BITA 1QXWA 2NQ7A 4FO8A 1QXZA 1WL6A 1C24A 4FLIA 4U75A 1XGOA 3PKBA 2GU5A 2ADUA 1W7VA 1WLRA 2BWTA 2Q95A 4QR8A 3BIQA 4S2RP 4PV4A 4U70A 1JAWA 4S00A 3FM3A 5E5BA 4FLJA 4FKCA 4IDYA 4U69A 2DFIA 4MATA 1C23A 2BWUA 4FLLA 1BOAA 4U71A 4S01A 4U76A 2P9AA 2GA2A 2Q8KA 1C21A 2GGBA 2V6CA 4ZNGA 1YVMA 5JFRA 2P99A 4ZWUA 2GG3A 2BHDA 1BN5A 1YW9A 2BWVA 3FMRA 4U6ZA 2BHCA 3L24A 3PKCA 3RORA 5JHUA 5CDLA 2B3LA 2BWXA 2GG0A 4FO7A 2IW2A 2BWYA 2Q96A 2OAZA 3D27A 4IECA 4IKRA 2EVCA 2Q92A 3CB5A 2GG2A 4RZZA 2EA4A 2B3HA 2ZSGA 3FMQA 4IPAA 4U6CA 1R5HA 2EA2A 3MX6A 3IU7A 1KQ0A 2B3KA 2BH3A 2GG7A 4HXXA 4R60A 5CIKA 2HOWA 5CDEA 4JUQA 3CTZA 3MATA 5D6FA 1Y1NA 1C27A 1MATA 4ZWPA 4U6JA 3IU8A 4U73A 4IU6A 1M35A 2G6PA 1YW8A 2BWSA 1YW7A 4A6WA 3IU9A 4IF7A 3CB6A 5FCHA 4IKSA 1WBQA 1KP0A 5CLSA 2GTXA 1XGMA 5JI6A 2V3XA 2OKNA 1WY2A 1WKMA 3L7GA 1CHMA 4KM3A 4PNCA 3TB5A 1W2MA 1KQ9A 4IKTA 5CE6A 2EVOA 1WL9A 4Z7MA 4ZWOA 2NQ6A 3PKAA 2MATA 1WN1A 3RVAA 2BN7A 4EGEA 2BHAA 2Q94A 5CDVA 2BHBA 2P98A 2V3YA 4U6EA 4RGZ1 2V3ZA 4FLKA 1PV9A 1XGSA 2GU7A 4U1BA 3S6BA 3Q6DA 5CNXA 5FCFA 1B6AA 2GZ5A 2GGCA 5D6EA 4IKUA 2EVMA 4S2TP 1XNZA 1QZYA 2GG5A 4FUKA 2BWWA 4A6VA 3IG4A 2Q93A 4B28A 1O0XA 1B59A 1R5GA 1YJ3A 1XGNA 2BB7A 1A16A 3PKDA 3PKEA 4OOKA 3TAVA 3BIPA 1R58A 3MR1A 2GG8A 1N51A 2GU4A
chains in the Genus database with same CATH topology
2GG9A 4RZYA 1C22A 4U6WA 1QXYA 2GU6A 3BITA 1QXWA 2NQ7A 4FO8A 1QXZA 1WL6A 1C24A 4FLIA 4U75A 1XGOA 3PKBA 2GU5A 2ADUA 1W7VA 1WLRA 2BWTA 2Q95A 4QR8A 3BIQA 4S2RP 4PV4A 4U70A 1JAWA 4S00A 3FM3A 5E5BA 4FLJA 4FKCA 4IDYA 4U69A 2DFIA 4MATA 1C23A 2BWUA 4FLLA 1BOAA 4U71A 4S01A 4U76A 2P9AA 2GA2A 2Q8KA 1C21A 2GGBA 2V6CA 4ZNGA 1YVMA 5JFRA 2P99A 4ZWUA 2GG3A 2BHDA 1BN5A 1YW9A 2BWVA 3FMRA 4U6ZA 2BHCA 3L24A 3PKCA 3RORA 5JHUA 5CDLA 2B3LA 2BWXA 2GG0A 4FO7A 2IW2A 2BWYA 2Q96A 2OAZA 3D27A 4IECA 4IKRA 2EVCA 2Q92A 3CB5A 2GG2A 4RZZA 2EA4A 2B3HA 2ZSGA 3FMQA 4IPAA 4U6CA 1R5HA 2EA2A 3MX6A 3IU7A 1KQ0A 2B3KA 2BH3A 2GG7A 4HXXA 4R60A 5CIKA 2HOWA 5CDEA 4JUQA 3CTZA 3MATA 5D6FA 1Y1NA 1C27A 1MATA 4ZWPA 4U6JA 3IU8A 4U73A 4IU6A 1M35A 2G6PA 1YW8A 2BWSA 1YW7A 4A6WA 3IU9A 4IF7A 3CB6A 5FCHA 4IKSA 1WBQA 1KP0A 5CLSA 2GTXA 1XGMA 5JI6A 2V3XA 2OKNA 1WY2A 1WKMA 3L7GA 1CHMA 4KM3A 4PNCA 3TB5A 1W2MA 1KQ9A 4IKTA 5CE6A 2EVOA 1WL9A 4Z7MA 4ZWOA 2NQ6A 3PKAA 2MATA 1WN1A 3RVAA 2BN7A 4EGEA 2BHAA 2Q94A 5CDVA 2BHBA 2P98A 2V3YA 4U6EA 4RGZ1 2V3ZA 4FLKA 1PV9A 1XGSA 2GU7A 4U1BA 3S6BA 3Q6DA 5CNXA 5FCFA 1B6AA 2GZ5A 2GGCA 5D6EA 4IKUA 2EVMA 4S2TP 1XNZA 1QZYA 2GG5A 4FUKA 2BWWA 4A6VA 3IG4A 2Q93A 4B28A 1O0XA 1B59A 1R5GA 1YJ3A 1XGNA 2BB7A 1A16A 3PKDA 3PKEA 4OOKA 3TAVA 3BIPA 1R58A 3MR1A 2GG8A 1N51A 2GU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG9 A;  4RZY A;  1C22 A;  4U6W A;  1QXY A;  2GU6 A;  3BIT A;  1QXW A;  2NQ7 A;  4FO8 A;  1QXZ A;  1WL6 A;  1C24 A;  4FLI A;  4U75 A;  1XGO A;  3PKB A;  2GU5 A;  2ADU A;  1W7V A;  1WLR A;  2BWT A;  2Q95 A;  4QR8 A;  3BIQ A;  4S2R P;  4PV4 A;  4U70 A;  1JAW A;  4S00 A;  3FM3 A;  5E5B A;  4FLJ A;  4FKC A;  4IDY A;  4U69 A;  2DFI A;  4MAT A;  1C23 A;  2BWU A;  4FLL A;  1BOA A;  4U71 A;  4S01 A;  4U76 A;  2P9A A;  2GA2 A;  2Q8K A;  1C21 A;  2GGB A;  2V6C A;  4ZNG A;  1YVM A;  5JFR A;  2P99 A;  4ZWU A;  2GG3 A;  2BHD A;  1BN5 A;  1YW9 A;  2BWV A;  3FMR A;  4U6Z A;  2BHC A;  3L24 A;  3PKC A;  3ROR A;  5JHU A;  5CDL A;  2B3L A;  2BWX A;  2GG0 A;  4FO7 A;  2IW2 A;  2BWY A;  2Q96 A;  2OAZ A;  3D27 A;  4IEC A;  4IKR A;  2EVC A;  2Q92 A;  3CB5 A;  2GG2 A;  4RZZ A;  2EA4 A;  2B3H A;  2ZSG A;  3FMQ A;  4IPA A;  4U6C A;  1R5H A;  2EA2 A;  3MX6 A;  3IU7 A;  1KQ0 A;  2B3K A;  2BH3 A;  2GG7 A;  4HXX A;  4R60 A;  5CIK A;  2HOW A;  5CDE A;  4JUQ A;  3CTZ A;  3MAT A;  5D6F A;  1Y1N A;  1C27 A;  1MAT A;  4ZWP A;  4U6J A;  3IU8 A;  4U73 A;  4IU6 A;  1M35 A;  2G6P A;  1YW8 A;  2BWS A;  1YW7 A;  4A6W A;  3IU9 A;  4IF7 A;  3CB6 A;  5FCH A;  4IKS A;  1WBQ A;  1KP0 A;  5CLS A;  2GTX A;  1XGM A;  5JI6 A;  2V3X A;  2OKN A;  1WY2 A;  1WKM A;  3L7G A;  1CHM A;  4KM3 A;  4PNC A;  3TB5 A;  1W2M A;  1KQ9 A;  4IKT A;  5CE6 A;  2EVO A;  1WL9 A;  4Z7M A;  4ZWO A;  2NQ6 A;  3PKA A;  2MAT A;  1WN1 A;  3RVA A;  2BN7 A;  4EGE A;  2BHA A;  2Q94 A;  5CDV A;  2BHB A;  2P98 A;  2V3Y A;  4U6E A;  4RGZ 1;  2V3Z A;  4FLK A;  1PV9 A;  1XGS A;  2GU7 A;  4U1B A;  3S6B A;  3Q6D A;  5CNX A;  5FCF A;  1B6A A;  2GZ5 A;  2GGC A;  5D6E A;  4IKU A;  2EVM A;  4S2T P;  1XNZ A;  1QZY A;  2GG5 A;  4FUK A;  2BWW A;  4A6V A;  3IG4 A;  2Q93 A;  4B28 A;  1O0X A;  1B59 A;  1R5G A;  1YJ3 A;  1XGN A;  2BB7 A;  1A16 A;  3PKD A;  3PKE A;  4OOK A;  3TAV A;  3BIP A;  1R58 A;  3MR1 A;  2GG8 A;  1N51 A;  2GU4 A; 
#chains in the Genus database with same CATH topology
 2GG9 A;  4RZY A;  1C22 A;  4U6W A;  1QXY A;  2GU6 A;  3BIT A;  1QXW A;  2NQ7 A;  4FO8 A;  1QXZ A;  1WL6 A;  1C24 A;  4FLI A;  4U75 A;  1XGO A;  3PKB A;  2GU5 A;  2ADU A;  1W7V A;  1WLR A;  2BWT A;  2Q95 A;  4QR8 A;  3BIQ A;  4S2R P;  4PV4 A;  4U70 A;  1JAW A;  4S00 A;  3FM3 A;  5E5B A;  4FLJ A;  4FKC A;  4IDY A;  4U69 A;  2DFI A;  4MAT A;  1C23 A;  2BWU A;  4FLL A;  1BOA A;  4U71 A;  4S01 A;  4U76 A;  2P9A A;  2GA2 A;  2Q8K A;  1C21 A;  2GGB A;  2V6C A;  4ZNG A;  1YVM A;  5JFR A;  2P99 A;  4ZWU A;  2GG3 A;  2BHD A;  1BN5 A;  1YW9 A;  2BWV A;  3FMR A;  4U6Z A;  2BHC A;  3L24 A;  3PKC A;  3ROR A;  5JHU A;  5CDL A;  2B3L A;  2BWX A;  2GG0 A;  4FO7 A;  2IW2 A;  2BWY A;  2Q96 A;  2OAZ A;  3D27 A;  4IEC A;  4IKR A;  2EVC A;  2Q92 A;  3CB5 A;  2GG2 A;  4RZZ A;  2EA4 A;  2B3H A;  2ZSG A;  3FMQ A;  4IPA A;  4U6C A;  1R5H A;  2EA2 A;  3MX6 A;  3IU7 A;  1KQ0 A;  2B3K A;  2BH3 A;  2GG7 A;  4HXX A;  4R60 A;  5CIK A;  2HOW A;  5CDE A;  4JUQ A;  3CTZ A;  3MAT A;  5D6F A;  1Y1N A;  1C27 A;  1MAT A;  4ZWP A;  4U6J A;  3IU8 A;  4U73 A;  4IU6 A;  1M35 A;  2G6P A;  1YW8 A;  2BWS A;  1YW7 A;  4A6W A;  3IU9 A;  4IF7 A;  3CB6 A;  5FCH A;  4IKS A;  1WBQ A;  1KP0 A;  5CLS A;  2GTX A;  1XGM A;  5JI6 A;  2V3X A;  2OKN A;  1WY2 A;  1WKM A;  3L7G A;  1CHM A;  4KM3 A;  4PNC A;  3TB5 A;  1W2M A;  1KQ9 A;  4IKT A;  5CE6 A;  2EVO A;  1WL9 A;  4Z7M A;  4ZWO A;  2NQ6 A;  3PKA A;  2MAT A;  1WN1 A;  3RVA A;  2BN7 A;  4EGE A;  2BHA A;  2Q94 A;  5CDV A;  2BHB A;  2P98 A;  2V3Y A;  4U6E A;  4RGZ 1;  2V3Z A;  4FLK A;  1PV9 A;  1XGS A;  2GU7 A;  4U1B A;  3S6B A;  3Q6D A;  5CNX A;  5FCF A;  1B6A A;  2GZ5 A;  2GGC A;  5D6E A;  4IKU A;  2EVM A;  4S2T P;  1XNZ A;  1QZY A;  2GG5 A;  4FUK A;  2BWW A;  4A6V A;  3IG4 A;  2Q93 A;  4B28 A;  1O0X A;  1B59 A;  1R5G A;  1YJ3 A;  1XGN A;  2BB7 A;  1A16 A;  3PKD A;  3PKE A;  4OOK A;  3TAV A;  3BIP A;  1R58 A;  3MR1 A;  2GG8 A;  1N51 A;  2GU4 A; 
#chains in the Genus database with same CATH homology
 2GG9 A;  4RZY A;  1C22 A;  4U6W A;  1QXY A;  2GU6 A;  3BIT A;  1QXW A;  2NQ7 A;  4FO8 A;  1QXZ A;  1WL6 A;  1C24 A;  4FLI A;  4U75 A;  1XGO A;  3PKB A;  2GU5 A;  2ADU A;  1W7V A;  1WLR A;  2BWT A;  2Q95 A;  4QR8 A;  3BIQ A;  4S2R P;  4PV4 A;  4U70 A;  1JAW A;  4S00 A;  3FM3 A;  5E5B A;  4FLJ A;  4FKC A;  4IDY A;  4U69 A;  2DFI A;  4MAT A;  1C23 A;  2BWU A;  4FLL A;  1BOA A;  4U71 A;  4S01 A;  4U76 A;  2P9A A;  2GA2 A;  2Q8K A;  1C21 A;  2GGB A;  2V6C A;  4ZNG A;  1YVM A;  5JFR A;  2P99 A;  4ZWU A;  2GG3 A;  2BHD A;  1BN5 A;  1YW9 A;  2BWV A;  3FMR A;  4U6Z A;  2BHC A;  3L24 A;  3PKC A;  3ROR A;  5JHU A;  5CDL A;  2B3L A;  2BWX A;  2GG0 A;  4FO7 A;  2IW2 A;  2BWY A;  2Q96 A;  2OAZ A;  3D27 A;  4IEC A;  4IKR A;  2EVC A;  2Q92 A;  3CB5 A;  2GG2 A;  4RZZ A;  2EA4 A;  2B3H A;  2ZSG A;  3FMQ A;  4IPA A;  4U6C A;  1R5H A;  2EA2 A;  3MX6 A;  3IU7 A;  1KQ0 A;  2B3K A;  2BH3 A;  2GG7 A;  4HXX A;  4R60 A;  5CIK A;  2HOW A;  5CDE A;  4JUQ A;  3CTZ A;  3MAT A;  5D6F A;  1Y1N A;  1C27 A;  1MAT A;  4ZWP A;  4U6J A;  3IU8 A;  4U73 A;  4IU6 A;  1M35 A;  2G6P A;  1YW8 A;  2BWS A;  1YW7 A;  4A6W A;  3IU9 A;  4IF7 A;  3CB6 A;  5FCH A;  4IKS A;  1WBQ A;  1KP0 A;  5CLS A;  2GTX A;  1XGM A;  5JI6 A;  2V3X A;  2OKN A;  1WY2 A;  1WKM A;  3L7G A;  1CHM A;  4KM3 A;  4PNC A;  3TB5 A;  1W2M A;  1KQ9 A;  4IKT A;  5CE6 A;  2EVO A;  1WL9 A;  4Z7M A;  4ZWO A;  2NQ6 A;  3PKA A;  2MAT A;  1WN1 A;  3RVA A;  2BN7 A;  4EGE A;  2BHA A;  2Q94 A;  5CDV A;  2BHB A;  2P98 A;  2V3Y A;  4U6E A;  4RGZ 1;  2V3Z A;  4FLK A;  1PV9 A;  1XGS A;  2GU7 A;  4U1B A;  3S6B A;  3Q6D A;  5CNX A;  5FCF A;  1B6A A;  2GZ5 A;  2GGC A;  5D6E A;  4IKU A;  2EVM A;  4S2T P;  1XNZ A;  1QZY A;  2GG5 A;  4FUK A;  2BWW A;  4A6V A;  3IG4 A;  2Q93 A;  4B28 A;  1O0X A;  1B59 A;  1R5G A;  1YJ3 A;  1XGN A;  2BB7 A;  1A16 A;  3PKD A;  3PKE A;  4OOK A;  3TAV A;  3BIP A;  1R58 A;  3MR1 A;  2GG8 A;  1N51 A;  2GU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...