2GU7A

E. coli methionine aminopeptidase unliganded, 1:0.5
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 80
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gu7A00
2BHAA 2BHCA 2BWYA 1WL9A 3S6BA 1MATA 5CDEA 2B3HA 4PNCA 1KQ0A 3PKCA 4IKRA 2OAZA 4U73A 1W7VA 4S2TP 1WBQA 4ZWUA 1Y1NA 3FMRA 2V6CA 1WL6A 3PKAA 2GU4A 5JI6A 2BWSA 2GZ5A 1W2MA 4IKUA 2BH3A 1JAWA 1KQ9A 2BB7A 5CIKA 1YW9A 3FMQA 5E5BA 2BN7A 2IW2A 4RZYA 4B28A 5JFRA 3L7GA 2NQ6A 3MR1A 1QZYA 1YVMA 4FLKA 4U6CA 1R58A 1QXZA 3FM3A 3RVAA 1C22A 2Q96A 2P98A 4U6WA 2P99A 5CNXA 3TB5A 4RZZA 5CE6A 2GA2A 1KP0A 4IKSA 1PV9A 4IF7A 4IU6A 4U71A 1YW8A 2GU6A 1BOAA 2GG3A 2Q94A 3RORA 1CHMA 3PKEA 4EGEA 3MX6A 5D6FA 2V3ZA 2Q92A 5FCHA 1WKMA 1QXWA 2ZSGA 4U76A 4IKTA 1XGMA 2Q8KA 2EVMA 1M35A 2BWTA 1YW7A 2OKNA 1WY2A 5CDLA 3Q6DA 3D27A 4FLLA 2GTXA 4U75A 4RGZ1 2BWVA 4KM3A 1XGNA 3IG4A 1R5HA 1C27A 4MATA 4S01A 2Q93A 4U6ZA 2BHBA 4FUKA 2GG5A 2GG7A 2GG2A 4U69A 3MATA 4IECA 3IU8A 4IPAA 2BWUA 2EA2A 5CDVA 1C24A 4ZWOA 4ZWPA 5JHUA 4U1BA 1C21A 1BN5A 3PKDA 2EA4A 4OOKA 2GG9A 2GG0A 4HXXA 4A6WA 2Q95A 4PV4A 2DFIA 3BIPA 1R5GA 4IDYA 4QR8A 2BHDA 4FLIA 2V3XA 2HOWA 2MATA 3PKBA 3L24A 4U6EA 1O0XA 3BIQA 2B3KA 2GU7A 2P9AA 1YJ3A 3BITA 1N51A 4A6VA 2EVOA 4FO8A 1C23A 1WLRA 3CTZA 4Z7MA 3CB6A 2GU5A 2GG8A 2BWWA 1XGOA 4FLJA 2B3LA 5FCFA 2EVCA 1A16A 4R60A 2GGBA 4ZNGA 4U6JA 1B59A 2GGCA 1XGSA 4S2RP 1B6AA 2G6PA 3CB5A 1WN1A 4FO7A 4JUQA 4U70A 5CLSA 3TAVA 5D6EA 4FKCA 2NQ7A 1QXYA 2ADUA 3IU7A 1XNZA 2V3YA 4S00A 3IU9A 2BWXA
chains in the Genus database with same CATH superfamily
2BHAA 2BHCA 2BWYA 1WL9A 3S6BA 1MATA 5CDEA 2B3HA 4PNCA 1KQ0A 3PKCA 4IKRA 2OAZA 4U73A 1W7VA 4S2TP 1WBQA 4ZWUA 1Y1NA 3FMRA 2V6CA 1WL6A 3PKAA 2GU4A 5JI6A 2BWSA 2GZ5A 1W2MA 4IKUA 2BH3A 1JAWA 1KQ9A 2BB7A 5CIKA 1YW9A 3FMQA 5E5BA 2BN7A 2IW2A 4RZYA 4B28A 5JFRA 3L7GA 2NQ6A 3MR1A 1QZYA 1YVMA 4FLKA 4U6CA 1R58A 1QXZA 3FM3A 3RVAA 1C22A 2Q96A 2P98A 4U6WA 2P99A 5CNXA 3TB5A 4RZZA 5CE6A 2GA2A 1KP0A 4IKSA 1PV9A 4IF7A 4IU6A 4U71A 1YW8A 2GU6A 1BOAA 2GG3A 2Q94A 3RORA 1CHMA 3PKEA 4EGEA 3MX6A 5D6FA 2V3ZA 2Q92A 5FCHA 1WKMA 1QXWA 2ZSGA 4U76A 4IKTA 1XGMA 2Q8KA 2EVMA 1M35A 2BWTA 1YW7A 2OKNA 1WY2A 5CDLA 3Q6DA 3D27A 4FLLA 2GTXA 4U75A 4RGZ1 2BWVA 4KM3A 1XGNA 3IG4A 1R5HA 1C27A 4MATA 4S01A 2Q93A 4U6ZA 2BHBA 4FUKA 2GG5A 2GG7A 2GG2A 4U69A 3MATA 4IECA 3IU8A 4IPAA 2BWUA 2EA2A 5CDVA 1C24A 4ZWOA 4ZWPA 5JHUA 4U1BA 1C21A 1BN5A 3PKDA 2EA4A 4OOKA 2GG9A 2GG0A 4HXXA 4A6WA 2Q95A 4PV4A 2DFIA 3BIPA 1R5GA 4IDYA 4QR8A 2BHDA 4FLIA 2V3XA 2HOWA 2MATA 3PKBA 3L24A 4U6EA 1O0XA 3BIQA 2B3KA 2GU7A 2P9AA 1YJ3A 3BITA 1N51A 4A6VA 2EVOA 4FO8A 1C23A 1WLRA 3CTZA 4Z7MA 3CB6A 2GU5A 2GG8A 2BWWA 1XGOA 4FLJA 2B3LA 5FCFA 2EVCA 1A16A 4R60A 2GGBA 4ZNGA 4U6JA 1B59A 2GGCA 1XGSA 4S2RP 1B6AA 2G6PA 3CB5A 1WN1A 4FO7A 4JUQA 4U70A 5CLSA 3TAVA 5D6EA 4FKCA 2NQ7A 1QXYA 2ADUA 3IU7A 1XNZA 2V3YA 4S00A 3IU9A 2BWXA
chains in the Genus database with same CATH topology
2BHAA 2BHCA 2BWYA 1WL9A 3S6BA 1MATA 5CDEA 2B3HA 4PNCA 1KQ0A 3PKCA 4IKRA 2OAZA 4U73A 1W7VA 4S2TP 1WBQA 4ZWUA 1Y1NA 3FMRA 2V6CA 1WL6A 3PKAA 2GU4A 5JI6A 2BWSA 2GZ5A 1W2MA 4IKUA 2BH3A 1JAWA 1KQ9A 2BB7A 5CIKA 1YW9A 3FMQA 5E5BA 2BN7A 2IW2A 4RZYA 4B28A 5JFRA 3L7GA 2NQ6A 3MR1A 1QZYA 1YVMA 4FLKA 4U6CA 1R58A 1QXZA 3FM3A 3RVAA 1C22A 2Q96A 2P98A 4U6WA 2P99A 5CNXA 3TB5A 4RZZA 5CE6A 2GA2A 1KP0A 4IKSA 1PV9A 4IF7A 4IU6A 4U71A 1YW8A 2GU6A 1BOAA 2GG3A 2Q94A 3RORA 1CHMA 3PKEA 4EGEA 3MX6A 5D6FA 2V3ZA 2Q92A 5FCHA 1WKMA 1QXWA 2ZSGA 4U76A 4IKTA 1XGMA 2Q8KA 2EVMA 1M35A 2BWTA 1YW7A 2OKNA 1WY2A 5CDLA 3Q6DA 3D27A 4FLLA 2GTXA 4U75A 4RGZ1 2BWVA 4KM3A 1XGNA 3IG4A 1R5HA 1C27A 4MATA 4S01A 2Q93A 4U6ZA 2BHBA 4FUKA 2GG5A 2GG7A 2GG2A 4U69A 3MATA 4IECA 3IU8A 4IPAA 2BWUA 2EA2A 5CDVA 1C24A 4ZWOA 4ZWPA 5JHUA 4U1BA 1C21A 1BN5A 3PKDA 2EA4A 4OOKA 2GG9A 2GG0A 4HXXA 4A6WA 2Q95A 4PV4A 2DFIA 3BIPA 1R5GA 4IDYA 4QR8A 2BHDA 4FLIA 2V3XA 2HOWA 2MATA 3PKBA 3L24A 4U6EA 1O0XA 3BIQA 2B3KA 2GU7A 2P9AA 1YJ3A 3BITA 1N51A 4A6VA 2EVOA 4FO8A 1C23A 1WLRA 3CTZA 4Z7MA 3CB6A 2GU5A 2GG8A 2BWWA 1XGOA 4FLJA 2B3LA 5FCFA 2EVCA 1A16A 4R60A 2GGBA 4ZNGA 4U6JA 1B59A 2GGCA 1XGSA 4S2RP 1B6AA 2G6PA 3CB5A 1WN1A 4FO7A 4JUQA 4U70A 5CLSA 3TAVA 5D6EA 4FKCA 2NQ7A 1QXYA 2ADUA 3IU7A 1XNZA 2V3YA 4S00A 3IU9A 2BWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BHA A;  2BHC A;  2BWY A;  1WL9 A;  3S6B A;  1MAT A;  5CDE A;  2B3H A;  4PNC A;  1KQ0 A;  3PKC A;  4IKR A;  2OAZ A;  4U73 A;  1W7V A;  4S2T P;  1WBQ A;  4ZWU A;  1Y1N A;  3FMR A;  2V6C A;  1WL6 A;  3PKA A;  2GU4 A;  5JI6 A;  2BWS A;  2GZ5 A;  1W2M A;  4IKU A;  2BH3 A;  1JAW A;  1KQ9 A;  2BB7 A;  5CIK A;  1YW9 A;  3FMQ A;  5E5B A;  2BN7 A;  2IW2 A;  4RZY A;  4B28 A;  5JFR A;  3L7G A;  2NQ6 A;  3MR1 A;  1QZY A;  1YVM A;  4FLK A;  4U6C A;  1R58 A;  1QXZ A;  3FM3 A;  3RVA A;  1C22 A;  2Q96 A;  2P98 A;  4U6W A;  2P99 A;  5CNX A;  3TB5 A;  4RZZ A;  5CE6 A;  2GA2 A;  1KP0 A;  4IKS A;  1PV9 A;  4IF7 A;  4IU6 A;  4U71 A;  1YW8 A;  2GU6 A;  1BOA A;  2GG3 A;  2Q94 A;  3ROR A;  1CHM A;  3PKE A;  4EGE A;  3MX6 A;  5D6F A;  2V3Z A;  2Q92 A;  5FCH A;  1WKM A;  1QXW A;  2ZSG A;  4U76 A;  4IKT A;  1XGM A;  2Q8K A;  2EVM A;  1M35 A;  2BWT A;  1YW7 A;  2OKN A;  1WY2 A;  5CDL A;  3Q6D A;  3D27 A;  4FLL A;  2GTX A;  4U75 A;  4RGZ 1;  2BWV A;  4KM3 A;  1XGN A;  3IG4 A;  1R5H A;  1C27 A;  4MAT A;  4S01 A;  2Q93 A;  4U6Z A;  2BHB A;  4FUK A;  2GG5 A;  2GG7 A;  2GG2 A;  4U69 A;  3MAT A;  4IEC A;  3IU8 A;  4IPA A;  2BWU A;  2EA2 A;  5CDV A;  1C24 A;  4ZWO A;  4ZWP A;  5JHU A;  4U1B A;  1C21 A;  1BN5 A;  3PKD A;  2EA4 A;  4OOK A;  2GG9 A;  2GG0 A;  4HXX A;  4A6W A;  2Q95 A;  4PV4 A;  2DFI A;  3BIP A;  1R5G A;  4IDY A;  4QR8 A;  2BHD A;  4FLI A;  2V3X A;  2HOW A;  2MAT A;  3PKB A;  3L24 A;  4U6E A;  1O0X A;  3BIQ A;  2B3K A;  2GU7 A;  2P9A A;  1YJ3 A;  3BIT A;  1N51 A;  4A6V A;  2EVO A;  4FO8 A;  1C23 A;  1WLR A;  3CTZ A;  4Z7M A;  3CB6 A;  2GU5 A;  2GG8 A;  2BWW A;  1XGO A;  4FLJ A;  2B3L A;  5FCF A;  2EVC A;  1A16 A;  4R60 A;  2GGB A;  4ZNG A;  4U6J A;  1B59 A;  2GGC A;  1XGS A;  4S2R P;  1B6A A;  2G6P A;  3CB5 A;  1WN1 A;  4FO7 A;  4JUQ A;  4U70 A;  5CLS A;  3TAV A;  5D6E A;  4FKC A;  2NQ7 A;  1QXY A;  2ADU A;  3IU7 A;  1XNZ A;  2V3Y A;  4S00 A;  3IU9 A;  2BWX A; 
#chains in the Genus database with same CATH topology
 2BHA A;  2BHC A;  2BWY A;  1WL9 A;  3S6B A;  1MAT A;  5CDE A;  2B3H A;  4PNC A;  1KQ0 A;  3PKC A;  4IKR A;  2OAZ A;  4U73 A;  1W7V A;  4S2T P;  1WBQ A;  4ZWU A;  1Y1N A;  3FMR A;  2V6C A;  1WL6 A;  3PKA A;  2GU4 A;  5JI6 A;  2BWS A;  2GZ5 A;  1W2M A;  4IKU A;  2BH3 A;  1JAW A;  1KQ9 A;  2BB7 A;  5CIK A;  1YW9 A;  3FMQ A;  5E5B A;  2BN7 A;  2IW2 A;  4RZY A;  4B28 A;  5JFR A;  3L7G A;  2NQ6 A;  3MR1 A;  1QZY A;  1YVM A;  4FLK A;  4U6C A;  1R58 A;  1QXZ A;  3FM3 A;  3RVA A;  1C22 A;  2Q96 A;  2P98 A;  4U6W A;  2P99 A;  5CNX A;  3TB5 A;  4RZZ A;  5CE6 A;  2GA2 A;  1KP0 A;  4IKS A;  1PV9 A;  4IF7 A;  4IU6 A;  4U71 A;  1YW8 A;  2GU6 A;  1BOA A;  2GG3 A;  2Q94 A;  3ROR A;  1CHM A;  3PKE A;  4EGE A;  3MX6 A;  5D6F A;  2V3Z A;  2Q92 A;  5FCH A;  1WKM A;  1QXW A;  2ZSG A;  4U76 A;  4IKT A;  1XGM A;  2Q8K A;  2EVM A;  1M35 A;  2BWT A;  1YW7 A;  2OKN A;  1WY2 A;  5CDL A;  3Q6D A;  3D27 A;  4FLL A;  2GTX A;  4U75 A;  4RGZ 1;  2BWV A;  4KM3 A;  1XGN A;  3IG4 A;  1R5H A;  1C27 A;  4MAT A;  4S01 A;  2Q93 A;  4U6Z A;  2BHB A;  4FUK A;  2GG5 A;  2GG7 A;  2GG2 A;  4U69 A;  3MAT A;  4IEC A;  3IU8 A;  4IPA A;  2BWU A;  2EA2 A;  5CDV A;  1C24 A;  4ZWO A;  4ZWP A;  5JHU A;  4U1B A;  1C21 A;  1BN5 A;  3PKD A;  2EA4 A;  4OOK A;  2GG9 A;  2GG0 A;  4HXX A;  4A6W A;  2Q95 A;  4PV4 A;  2DFI A;  3BIP A;  1R5G A;  4IDY A;  4QR8 A;  2BHD A;  4FLI A;  2V3X A;  2HOW A;  2MAT A;  3PKB A;  3L24 A;  4U6E A;  1O0X A;  3BIQ A;  2B3K A;  2GU7 A;  2P9A A;  1YJ3 A;  3BIT A;  1N51 A;  4A6V A;  2EVO A;  4FO8 A;  1C23 A;  1WLR A;  3CTZ A;  4Z7M A;  3CB6 A;  2GU5 A;  2GG8 A;  2BWW A;  1XGO A;  4FLJ A;  2B3L A;  5FCF A;  2EVC A;  1A16 A;  4R60 A;  2GGB A;  4ZNG A;  4U6J A;  1B59 A;  2GGC A;  1XGS A;  4S2R P;  1B6A A;  2G6P A;  3CB5 A;  1WN1 A;  4FO7 A;  4JUQ A;  4U70 A;  5CLS A;  3TAV A;  5D6E A;  4FKC A;  2NQ7 A;  1QXY A;  2ADU A;  3IU7 A;  1XNZ A;  2V3Y A;  4S00 A;  3IU9 A;  2BWX A; 
#chains in the Genus database with same CATH homology
 2BHA A;  2BHC A;  2BWY A;  1WL9 A;  3S6B A;  1MAT A;  5CDE A;  2B3H A;  4PNC A;  1KQ0 A;  3PKC A;  4IKR A;  2OAZ A;  4U73 A;  1W7V A;  4S2T P;  1WBQ A;  4ZWU A;  1Y1N A;  3FMR A;  2V6C A;  1WL6 A;  3PKA A;  2GU4 A;  5JI6 A;  2BWS A;  2GZ5 A;  1W2M A;  4IKU A;  2BH3 A;  1JAW A;  1KQ9 A;  2BB7 A;  5CIK A;  1YW9 A;  3FMQ A;  5E5B A;  2BN7 A;  2IW2 A;  4RZY A;  4B28 A;  5JFR A;  3L7G A;  2NQ6 A;  3MR1 A;  1QZY A;  1YVM A;  4FLK A;  4U6C A;  1R58 A;  1QXZ A;  3FM3 A;  3RVA A;  1C22 A;  2Q96 A;  2P98 A;  4U6W A;  2P99 A;  5CNX A;  3TB5 A;  4RZZ A;  5CE6 A;  2GA2 A;  1KP0 A;  4IKS A;  1PV9 A;  4IF7 A;  4IU6 A;  4U71 A;  1YW8 A;  2GU6 A;  1BOA A;  2GG3 A;  2Q94 A;  3ROR A;  1CHM A;  3PKE A;  4EGE A;  3MX6 A;  5D6F A;  2V3Z A;  2Q92 A;  5FCH A;  1WKM A;  1QXW A;  2ZSG A;  4U76 A;  4IKT A;  1XGM A;  2Q8K A;  2EVM A;  1M35 A;  2BWT A;  1YW7 A;  2OKN A;  1WY2 A;  5CDL A;  3Q6D A;  3D27 A;  4FLL A;  2GTX A;  4U75 A;  4RGZ 1;  2BWV A;  4KM3 A;  1XGN A;  3IG4 A;  1R5H A;  1C27 A;  4MAT A;  4S01 A;  2Q93 A;  4U6Z A;  2BHB A;  4FUK A;  2GG5 A;  2GG7 A;  2GG2 A;  4U69 A;  3MAT A;  4IEC A;  3IU8 A;  4IPA A;  2BWU A;  2EA2 A;  5CDV A;  1C24 A;  4ZWO A;  4ZWP A;  5JHU A;  4U1B A;  1C21 A;  1BN5 A;  3PKD A;  2EA4 A;  4OOK A;  2GG9 A;  2GG0 A;  4HXX A;  4A6W A;  2Q95 A;  4PV4 A;  2DFI A;  3BIP A;  1R5G A;  4IDY A;  4QR8 A;  2BHD A;  4FLI A;  2V3X A;  2HOW A;  2MAT A;  3PKB A;  3L24 A;  4U6E A;  1O0X A;  3BIQ A;  2B3K A;  2GU7 A;  2P9A A;  1YJ3 A;  3BIT A;  1N51 A;  4A6V A;  2EVO A;  4FO8 A;  1C23 A;  1WLR A;  3CTZ A;  4Z7M A;  3CB6 A;  2GU5 A;  2GG8 A;  2BWW A;  1XGO A;  4FLJ A;  2B3L A;  5FCF A;  2EVC A;  1A16 A;  4R60 A;  2GGB A;  4ZNG A;  4U6J A;  1B59 A;  2GGC A;  1XGS A;  4S2R P;  1B6A A;  2G6P A;  3CB5 A;  1WN1 A;  4FO7 A;  4JUQ A;  4U70 A;  5CLS A;  3TAV A;  5D6E A;  4FKC A;  2NQ7 A;  1QXY A;  2ADU A;  3IU7 A;  1XNZ A;  2V3Y A;  4S00 A;  3IU9 A;  2BWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...