2GU7A

E. coli methionine aminopeptidase unliganded, 1:0.5
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 80
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gu7A00
5FCHA 2GG0A 4HXXA 4IDYA 4IKTA 1XGMA 2NQ6A 2BN7A 4OOKA 1QZYA 1YW9A 1W2MA 2GA2A 4U6EA 3S6BA 1C22A 2G6PA 4U71A 2EA4A 3IU8A 3FMQA 4Z7MA 5CE6A 2EVOA 5JFRA 1YVMA 2GG8A 5CDLA 3PKCA 2GZ5A 4U76A 5D6FA 4B28A 4EGEA 3MX6A 2GG5A 4IKSA 3TB5A 3PKDA 5JI6A 2GG9A 2B3HA 4MATA 2BHDA 4U6ZA 5CDEA 1R58A 3RVAA 2OAZA 2EA2A 2GG2A 1XGNA 4JUQA 4RZYA 3L24A 3TAVA 1A16A 4IKUA 1R5GA 5CLSA 2OKNA 3CB6A 4U70A 1QXWA 1XNZA 1W7VA 2B3KA 2V6CA 4A6WA 4FKCA 2GGBA 4KM3A 3FMRA 2B3LA 1CHMA 2MATA 2P9AA 3CTZA 1QXYA 4FLIA 4IECA 4A6VA 4FUKA 4QR8A 2DFIA 2ZSGA 2GU4A 3BIPA 4PV4A 4U73A 2HOWA 4U6CA 3CB5A 4S2RP 1C24A 1XGSA 2BWSA 5E5BA 1KQ9A 2BB7A 1WN1A 3D27A 5CNXA 4IU6A 4IF7A 2GG7A 1WBQA 3PKEA 4FO7A 1KQ0A 4U6JA 3IU7A 1BOAA 4FO8A 2V3ZA 2BWYA 4ZWPA 2BWTA 4U75A 4S2TP 1YJ3A 2BWWA 1WKMA 1WL9A 2Q92A 1YW8A 1R5HA 4FLKA 1YW7A 2BWVA 2GTXA 1WL6A 3Q6DA 2BHAA 2GU6A 3PKBA 2IW2A 1MATA 2BWXA 1QXZA 4ZWUA 4ZNGA 1KP0A 2Q8KA 4PNCA 3PKAA 2BH3A 2P99A 2GU7A 2BHCA 1C27A 1WLRA 1B59A 1C23A 1Y1NA 2BHBA 4U6WA 3IU9A 2ADUA 3IG4A 3L7GA 2EVMA 4RGZ1 4S01A 4U1BA 4ZWOA 2Q95A 2Q94A 1JAWA 4IPAA 5CIKA 2V3XA 4RZZA 2GG3A 2NQ7A 4IKRA 1B6AA 1N51A 2BWUA 3BITA 1PV9A 4R60A 1WY2A 3FM3A 1XGOA 2Q93A 1M35A 4FLLA 2P98A 4U69A 5JHUA 3BIQA 2Q96A 5FCFA 2GGCA 5CDVA 1O0XA 2V3YA 3MR1A 2GU5A 4S00A 3RORA 1BN5A 2EVCA 4FLJA 3MATA 5D6EA 1C21A
chains in the Genus database with same CATH superfamily
5FCHA 2GG0A 4HXXA 4IDYA 4IKTA 1XGMA 2NQ6A 2BN7A 4OOKA 1QZYA 1YW9A 1W2MA 2GA2A 4U6EA 3S6BA 1C22A 2G6PA 4U71A 2EA4A 3IU8A 3FMQA 4Z7MA 5CE6A 2EVOA 5JFRA 1YVMA 2GG8A 5CDLA 3PKCA 2GZ5A 4U76A 5D6FA 4B28A 4EGEA 3MX6A 2GG5A 4IKSA 3TB5A 3PKDA 5JI6A 2GG9A 2B3HA 4MATA 2BHDA 4U6ZA 5CDEA 1R58A 3RVAA 2OAZA 2EA2A 2GG2A 1XGNA 4JUQA 4RZYA 3L24A 3TAVA 1A16A 4IKUA 1R5GA 5CLSA 2OKNA 3CB6A 4U70A 1QXWA 1XNZA 1W7VA 2B3KA 2V6CA 4A6WA 4FKCA 2GGBA 4KM3A 3FMRA 2B3LA 1CHMA 2MATA 2P9AA 3CTZA 1QXYA 4FLIA 4IECA 4A6VA 4FUKA 4QR8A 2DFIA 2ZSGA 2GU4A 3BIPA 4PV4A 4U73A 2HOWA 4U6CA 3CB5A 4S2RP 1C24A 1XGSA 2BWSA 5E5BA 1KQ9A 2BB7A 1WN1A 3D27A 5CNXA 4IU6A 4IF7A 2GG7A 1WBQA 3PKEA 4FO7A 1KQ0A 4U6JA 3IU7A 1BOAA 4FO8A 2V3ZA 2BWYA 4ZWPA 2BWTA 4U75A 4S2TP 1YJ3A 2BWWA 1WKMA 1WL9A 2Q92A 1YW8A 1R5HA 4FLKA 1YW7A 2BWVA 2GTXA 1WL6A 3Q6DA 2BHAA 2GU6A 3PKBA 2IW2A 1MATA 2BWXA 1QXZA 4ZWUA 4ZNGA 1KP0A 2Q8KA 4PNCA 3PKAA 2BH3A 2P99A 2GU7A 2BHCA 1C27A 1WLRA 1B59A 1C23A 1Y1NA 2BHBA 4U6WA 3IU9A 2ADUA 3IG4A 3L7GA 2EVMA 4RGZ1 4S01A 4U1BA 4ZWOA 2Q95A 2Q94A 1JAWA 4IPAA 5CIKA 2V3XA 4RZZA 2GG3A 2NQ7A 4IKRA 1B6AA 1N51A 2BWUA 3BITA 1PV9A 4R60A 1WY2A 3FM3A 1XGOA 2Q93A 1M35A 4FLLA 2P98A 4U69A 5JHUA 3BIQA 2Q96A 5FCFA 2GGCA 5CDVA 1O0XA 2V3YA 3MR1A 2GU5A 4S00A 3RORA 1BN5A 2EVCA 4FLJA 3MATA 5D6EA 1C21A
chains in the Genus database with same CATH topology
5FCHA 2GG0A 4HXXA 4IDYA 4IKTA 1XGMA 2NQ6A 2BN7A 4OOKA 1QZYA 1YW9A 1W2MA 2GA2A 4U6EA 3S6BA 1C22A 2G6PA 4U71A 2EA4A 3IU8A 3FMQA 4Z7MA 5CE6A 2EVOA 5JFRA 1YVMA 2GG8A 5CDLA 3PKCA 2GZ5A 4U76A 5D6FA 4B28A 4EGEA 3MX6A 2GG5A 4IKSA 3TB5A 3PKDA 5JI6A 2GG9A 2B3HA 4MATA 2BHDA 4U6ZA 5CDEA 1R58A 3RVAA 2OAZA 2EA2A 2GG2A 1XGNA 4JUQA 4RZYA 3L24A 3TAVA 1A16A 4IKUA 1R5GA 5CLSA 2OKNA 3CB6A 4U70A 1QXWA 1XNZA 1W7VA 2B3KA 2V6CA 4A6WA 4FKCA 2GGBA 4KM3A 3FMRA 2B3LA 1CHMA 2MATA 2P9AA 3CTZA 1QXYA 4FLIA 4IECA 4A6VA 4FUKA 4QR8A 2DFIA 2ZSGA 2GU4A 3BIPA 4PV4A 4U73A 2HOWA 4U6CA 3CB5A 4S2RP 1C24A 1XGSA 2BWSA 5E5BA 1KQ9A 2BB7A 1WN1A 3D27A 5CNXA 4IU6A 4IF7A 2GG7A 1WBQA 3PKEA 4FO7A 1KQ0A 4U6JA 3IU7A 1BOAA 4FO8A 2V3ZA 2BWYA 4ZWPA 2BWTA 4U75A 4S2TP 1YJ3A 2BWWA 1WKMA 1WL9A 2Q92A 1YW8A 1R5HA 4FLKA 1YW7A 2BWVA 2GTXA 1WL6A 3Q6DA 2BHAA 2GU6A 3PKBA 2IW2A 1MATA 2BWXA 1QXZA 4ZWUA 4ZNGA 1KP0A 2Q8KA 4PNCA 3PKAA 2BH3A 2P99A 2GU7A 2BHCA 1C27A 1WLRA 1B59A 1C23A 1Y1NA 2BHBA 4U6WA 3IU9A 2ADUA 3IG4A 3L7GA 2EVMA 4RGZ1 4S01A 4U1BA 4ZWOA 2Q95A 2Q94A 1JAWA 4IPAA 5CIKA 2V3XA 4RZZA 2GG3A 2NQ7A 4IKRA 1B6AA 1N51A 2BWUA 3BITA 1PV9A 4R60A 1WY2A 3FM3A 1XGOA 2Q93A 1M35A 4FLLA 2P98A 4U69A 5JHUA 3BIQA 2Q96A 5FCFA 2GGCA 5CDVA 1O0XA 2V3YA 3MR1A 2GU5A 4S00A 3RORA 1BN5A 2EVCA 4FLJA 3MATA 5D6EA 1C21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FCH A;  2GG0 A;  4HXX A;  4IDY A;  4IKT A;  1XGM A;  2NQ6 A;  2BN7 A;  4OOK A;  1QZY A;  1YW9 A;  1W2M A;  2GA2 A;  4U6E A;  3S6B A;  1C22 A;  2G6P A;  4U71 A;  2EA4 A;  3IU8 A;  3FMQ A;  4Z7M A;  5CE6 A;  2EVO A;  5JFR A;  1YVM A;  2GG8 A;  5CDL A;  3PKC A;  2GZ5 A;  4U76 A;  5D6F A;  4B28 A;  4EGE A;  3MX6 A;  2GG5 A;  4IKS A;  3TB5 A;  3PKD A;  5JI6 A;  2GG9 A;  2B3H A;  4MAT A;  2BHD A;  4U6Z A;  5CDE A;  1R58 A;  3RVA A;  2OAZ A;  2EA2 A;  2GG2 A;  1XGN A;  4JUQ A;  4RZY A;  3L24 A;  3TAV A;  1A16 A;  4IKU A;  1R5G A;  5CLS A;  2OKN A;  3CB6 A;  4U70 A;  1QXW A;  1XNZ A;  1W7V A;  2B3K A;  2V6C A;  4A6W A;  4FKC A;  2GGB A;  4KM3 A;  3FMR A;  2B3L A;  1CHM A;  2MAT A;  2P9A A;  3CTZ A;  1QXY A;  4FLI A;  4IEC A;  4A6V A;  4FUK A;  4QR8 A;  2DFI A;  2ZSG A;  2GU4 A;  3BIP A;  4PV4 A;  4U73 A;  2HOW A;  4U6C A;  3CB5 A;  4S2R P;  1C24 A;  1XGS A;  2BWS A;  5E5B A;  1KQ9 A;  2BB7 A;  1WN1 A;  3D27 A;  5CNX A;  4IU6 A;  4IF7 A;  2GG7 A;  1WBQ A;  3PKE A;  4FO7 A;  1KQ0 A;  4U6J A;  3IU7 A;  1BOA A;  4FO8 A;  2V3Z A;  2BWY A;  4ZWP A;  2BWT A;  4U75 A;  4S2T P;  1YJ3 A;  2BWW A;  1WKM A;  1WL9 A;  2Q92 A;  1YW8 A;  1R5H A;  4FLK A;  1YW7 A;  2BWV A;  2GTX A;  1WL6 A;  3Q6D A;  2BHA A;  2GU6 A;  3PKB A;  2IW2 A;  1MAT A;  2BWX A;  1QXZ A;  4ZWU A;  4ZNG A;  1KP0 A;  2Q8K A;  4PNC A;  3PKA A;  2BH3 A;  2P99 A;  2GU7 A;  2BHC A;  1C27 A;  1WLR A;  1B59 A;  1C23 A;  1Y1N A;  2BHB A;  4U6W A;  3IU9 A;  2ADU A;  3IG4 A;  3L7G A;  2EVM A;  4RGZ 1;  4S01 A;  4U1B A;  4ZWO A;  2Q95 A;  2Q94 A;  1JAW A;  4IPA A;  5CIK A;  2V3X A;  4RZZ A;  2GG3 A;  2NQ7 A;  4IKR A;  1B6A A;  1N51 A;  2BWU A;  3BIT A;  1PV9 A;  4R60 A;  1WY2 A;  3FM3 A;  1XGO A;  2Q93 A;  1M35 A;  4FLL A;  2P98 A;  4U69 A;  5JHU A;  3BIQ A;  2Q96 A;  5FCF A;  2GGC A;  5CDV A;  1O0X A;  2V3Y A;  3MR1 A;  2GU5 A;  4S00 A;  3ROR A;  1BN5 A;  2EVC A;  4FLJ A;  3MAT A;  5D6E A;  1C21 A; 
#chains in the Genus database with same CATH topology
 5FCH A;  2GG0 A;  4HXX A;  4IDY A;  4IKT A;  1XGM A;  2NQ6 A;  2BN7 A;  4OOK A;  1QZY A;  1YW9 A;  1W2M A;  2GA2 A;  4U6E A;  3S6B A;  1C22 A;  2G6P A;  4U71 A;  2EA4 A;  3IU8 A;  3FMQ A;  4Z7M A;  5CE6 A;  2EVO A;  5JFR A;  1YVM A;  2GG8 A;  5CDL A;  3PKC A;  2GZ5 A;  4U76 A;  5D6F A;  4B28 A;  4EGE A;  3MX6 A;  2GG5 A;  4IKS A;  3TB5 A;  3PKD A;  5JI6 A;  2GG9 A;  2B3H A;  4MAT A;  2BHD A;  4U6Z A;  5CDE A;  1R58 A;  3RVA A;  2OAZ A;  2EA2 A;  2GG2 A;  1XGN A;  4JUQ A;  4RZY A;  3L24 A;  3TAV A;  1A16 A;  4IKU A;  1R5G A;  5CLS A;  2OKN A;  3CB6 A;  4U70 A;  1QXW A;  1XNZ A;  1W7V A;  2B3K A;  2V6C A;  4A6W A;  4FKC A;  2GGB A;  4KM3 A;  3FMR A;  2B3L A;  1CHM A;  2MAT A;  2P9A A;  3CTZ A;  1QXY A;  4FLI A;  4IEC A;  4A6V A;  4FUK A;  4QR8 A;  2DFI A;  2ZSG A;  2GU4 A;  3BIP A;  4PV4 A;  4U73 A;  2HOW A;  4U6C A;  3CB5 A;  4S2R P;  1C24 A;  1XGS A;  2BWS A;  5E5B A;  1KQ9 A;  2BB7 A;  1WN1 A;  3D27 A;  5CNX A;  4IU6 A;  4IF7 A;  2GG7 A;  1WBQ A;  3PKE A;  4FO7 A;  1KQ0 A;  4U6J A;  3IU7 A;  1BOA A;  4FO8 A;  2V3Z A;  2BWY A;  4ZWP A;  2BWT A;  4U75 A;  4S2T P;  1YJ3 A;  2BWW A;  1WKM A;  1WL9 A;  2Q92 A;  1YW8 A;  1R5H A;  4FLK A;  1YW7 A;  2BWV A;  2GTX A;  1WL6 A;  3Q6D A;  2BHA A;  2GU6 A;  3PKB A;  2IW2 A;  1MAT A;  2BWX A;  1QXZ A;  4ZWU A;  4ZNG A;  1KP0 A;  2Q8K A;  4PNC A;  3PKA A;  2BH3 A;  2P99 A;  2GU7 A;  2BHC A;  1C27 A;  1WLR A;  1B59 A;  1C23 A;  1Y1N A;  2BHB A;  4U6W A;  3IU9 A;  2ADU A;  3IG4 A;  3L7G A;  2EVM A;  4RGZ 1;  4S01 A;  4U1B A;  4ZWO A;  2Q95 A;  2Q94 A;  1JAW A;  4IPA A;  5CIK A;  2V3X A;  4RZZ A;  2GG3 A;  2NQ7 A;  4IKR A;  1B6A A;  1N51 A;  2BWU A;  3BIT A;  1PV9 A;  4R60 A;  1WY2 A;  3FM3 A;  1XGO A;  2Q93 A;  1M35 A;  4FLL A;  2P98 A;  4U69 A;  5JHU A;  3BIQ A;  2Q96 A;  5FCF A;  2GGC A;  5CDV A;  1O0X A;  2V3Y A;  3MR1 A;  2GU5 A;  4S00 A;  3ROR A;  1BN5 A;  2EVC A;  4FLJ A;  3MAT A;  5D6E A;  1C21 A; 
#chains in the Genus database with same CATH homology
 5FCH A;  2GG0 A;  4HXX A;  4IDY A;  4IKT A;  1XGM A;  2NQ6 A;  2BN7 A;  4OOK A;  1QZY A;  1YW9 A;  1W2M A;  2GA2 A;  4U6E A;  3S6B A;  1C22 A;  2G6P A;  4U71 A;  2EA4 A;  3IU8 A;  3FMQ A;  4Z7M A;  5CE6 A;  2EVO A;  5JFR A;  1YVM A;  2GG8 A;  5CDL A;  3PKC A;  2GZ5 A;  4U76 A;  5D6F A;  4B28 A;  4EGE A;  3MX6 A;  2GG5 A;  4IKS A;  3TB5 A;  3PKD A;  5JI6 A;  2GG9 A;  2B3H A;  4MAT A;  2BHD A;  4U6Z A;  5CDE A;  1R58 A;  3RVA A;  2OAZ A;  2EA2 A;  2GG2 A;  1XGN A;  4JUQ A;  4RZY A;  3L24 A;  3TAV A;  1A16 A;  4IKU A;  1R5G A;  5CLS A;  2OKN A;  3CB6 A;  4U70 A;  1QXW A;  1XNZ A;  1W7V A;  2B3K A;  2V6C A;  4A6W A;  4FKC A;  2GGB A;  4KM3 A;  3FMR A;  2B3L A;  1CHM A;  2MAT A;  2P9A A;  3CTZ A;  1QXY A;  4FLI A;  4IEC A;  4A6V A;  4FUK A;  4QR8 A;  2DFI A;  2ZSG A;  2GU4 A;  3BIP A;  4PV4 A;  4U73 A;  2HOW A;  4U6C A;  3CB5 A;  4S2R P;  1C24 A;  1XGS A;  2BWS A;  5E5B A;  1KQ9 A;  2BB7 A;  1WN1 A;  3D27 A;  5CNX A;  4IU6 A;  4IF7 A;  2GG7 A;  1WBQ A;  3PKE A;  4FO7 A;  1KQ0 A;  4U6J A;  3IU7 A;  1BOA A;  4FO8 A;  2V3Z A;  2BWY A;  4ZWP A;  2BWT A;  4U75 A;  4S2T P;  1YJ3 A;  2BWW A;  1WKM A;  1WL9 A;  2Q92 A;  1YW8 A;  1R5H A;  4FLK A;  1YW7 A;  2BWV A;  2GTX A;  1WL6 A;  3Q6D A;  2BHA A;  2GU6 A;  3PKB A;  2IW2 A;  1MAT A;  2BWX A;  1QXZ A;  4ZWU A;  4ZNG A;  1KP0 A;  2Q8K A;  4PNC A;  3PKA A;  2BH3 A;  2P99 A;  2GU7 A;  2BHC A;  1C27 A;  1WLR A;  1B59 A;  1C23 A;  1Y1N A;  2BHB A;  4U6W A;  3IU9 A;  2ADU A;  3IG4 A;  3L7G A;  2EVM A;  4RGZ 1;  4S01 A;  4U1B A;  4ZWO A;  2Q95 A;  2Q94 A;  1JAW A;  4IPA A;  5CIK A;  2V3X A;  4RZZ A;  2GG3 A;  2NQ7 A;  4IKR A;  1B6A A;  1N51 A;  2BWU A;  3BIT A;  1PV9 A;  4R60 A;  1WY2 A;  3FM3 A;  1XGO A;  2Q93 A;  1M35 A;  4FLL A;  2P98 A;  4U69 A;  5JHU A;  3BIQ A;  2Q96 A;  5FCF A;  2GGC A;  5CDV A;  1O0X A;  2V3Y A;  3MR1 A;  2GU5 A;  4S00 A;  3ROR A;  1BN5 A;  2EVC A;  4FLJ A;  3MAT A;  5D6E A;  1C21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...