2GU7A

E. coli methionine aminopeptidase unliganded, 1:0.5
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 80
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gu7A00
5E5BA 4U76A 4FLIA 5CDEA 5JFRA 4U6CA 2P9AA 2BWYA 4ZNGA 2GG5A 3CB6A 1WL6A 2BHDA 4U73A 3PKEA 2GU5A 4U71A 2GU7A 3IU9A 4IF7A 5CE6A 1W7VA 3PKDA 1Y1NA 1WKMA 1MATA 2V6CA 1QXWA 3MR1A 4S00A 1PV9A 4IKSA 5CIKA 4R60A 4RZZA 1C27A 2ADUA 2Q8KA 4MATA 3L24A 3RVAA 1XGNA 4S2TP 4S2RP 4FO8A 4Z7MA 1C22A 4IECA 4FO7A 2EVCA 2EVOA 4HXXA 2DFIA 3PKAA 2HOWA 1QXYA 2Q95A 1O0XA 5CNXA 2OKNA 3S6BA 2BN7A 2BWTA 3FMRA 2GGBA 2GG7A 4FLLA 2GG8A 1XGMA 2NQ7A 4IKRA 1WN1A 2EVMA 1JAWA 2BB7A 5JI6A 4S01A 1YJ3A 3Q6DA 4IU6A 1BOAA 4PNCA 1R58A 4U1BA 3RORA 5FCHA 2BHBA 2MATA 4JUQA 4RZYA 2B3KA 5JHUA 2BWUA 3TAVA 2BHCA 3IU8A 4FLJA 4IPAA 2P98A 4FUKA 4FKCA 1R5HA 1YW7A 4U6WA 4IKTA 4ZWOA 1B59A 1A16A 4U70A 2BWWA 2V3YA 4QR8A 3IU7A 3MATA 4RGZ1 1BN5A 1C21A 2B3HA 3PKCA 2IW2A 1KP0A 2V3ZA 4U69A 5CDLA 4IKUA 2GU4A 4U75A 2BWXA 1W2MA 1YW9A 4A6VA 3BITA 2GG9A 4A6WA 1XGOA 1KQ9A 1C23A 2Q93A 2GU6A 1N51A 3CTZA 3FM3A 2GZ5A 4PV4A 1XNZA 1QZYA 1CHMA 3BIQA 2GG2A 2NQ6A 1R5GA 4B28A 2B3LA 4U6JA 3D27A 4EGEA 2G6PA 5CDVA 4ZWUA 1WLRA 4U6ZA 2P99A 2V3XA 3IG4A 2GTXA 5D6FA 4ZWPA 2BHAA 2BWVA 4KM3A 4IDYA 1YVMA 2Q94A 1B6AA 3TB5A 2BH3A 2BWSA 5FCFA 1C24A 2EA4A 2Q92A 1KQ0A 1M35A 1WY2A 5D6EA 1XGSA 3L7GA 3CB5A 3FMQA 1WL9A 1YW8A 5CLSA 2GG0A 3PKBA 2GG3A 2ZSGA 2GA2A 1WBQA 3BIPA 4OOKA 1QXZA 2EA2A 4FLKA 4U6EA 2OAZA 2GGCA 3MX6A 2Q96A
chains in the Genus database with same CATH superfamily
5E5BA 4U76A 4FLIA 5CDEA 5JFRA 4U6CA 2P9AA 2BWYA 4ZNGA 2GG5A 3CB6A 1WL6A 2BHDA 4U73A 3PKEA 2GU5A 4U71A 2GU7A 3IU9A 4IF7A 5CE6A 1W7VA 3PKDA 1Y1NA 1WKMA 1MATA 2V6CA 1QXWA 3MR1A 4S00A 1PV9A 4IKSA 5CIKA 4R60A 4RZZA 1C27A 2ADUA 2Q8KA 4MATA 3L24A 3RVAA 1XGNA 4S2TP 4S2RP 4FO8A 4Z7MA 1C22A 4IECA 4FO7A 2EVCA 2EVOA 4HXXA 2DFIA 3PKAA 2HOWA 1QXYA 2Q95A 1O0XA 5CNXA 2OKNA 3S6BA 2BN7A 2BWTA 3FMRA 2GGBA 2GG7A 4FLLA 2GG8A 1XGMA 2NQ7A 4IKRA 1WN1A 2EVMA 1JAWA 2BB7A 5JI6A 4S01A 1YJ3A 3Q6DA 4IU6A 1BOAA 4PNCA 1R58A 4U1BA 3RORA 5FCHA 2BHBA 2MATA 4JUQA 4RZYA 2B3KA 5JHUA 2BWUA 3TAVA 2BHCA 3IU8A 4FLJA 4IPAA 2P98A 4FUKA 4FKCA 1R5HA 1YW7A 4U6WA 4IKTA 4ZWOA 1B59A 1A16A 4U70A 2BWWA 2V3YA 4QR8A 3IU7A 3MATA 4RGZ1 1BN5A 1C21A 2B3HA 3PKCA 2IW2A 1KP0A 2V3ZA 4U69A 5CDLA 4IKUA 2GU4A 4U75A 2BWXA 1W2MA 1YW9A 4A6VA 3BITA 2GG9A 4A6WA 1XGOA 1KQ9A 1C23A 2Q93A 2GU6A 1N51A 3CTZA 3FM3A 2GZ5A 4PV4A 1XNZA 1QZYA 1CHMA 3BIQA 2GG2A 2NQ6A 1R5GA 4B28A 2B3LA 4U6JA 3D27A 4EGEA 2G6PA 5CDVA 4ZWUA 1WLRA 4U6ZA 2P99A 2V3XA 3IG4A 2GTXA 5D6FA 4ZWPA 2BHAA 2BWVA 4KM3A 4IDYA 1YVMA 2Q94A 1B6AA 3TB5A 2BH3A 2BWSA 5FCFA 1C24A 2EA4A 2Q92A 1KQ0A 1M35A 1WY2A 5D6EA 1XGSA 3L7GA 3CB5A 3FMQA 1WL9A 1YW8A 5CLSA 2GG0A 3PKBA 2GG3A 2ZSGA 2GA2A 1WBQA 3BIPA 4OOKA 1QXZA 2EA2A 4FLKA 4U6EA 2OAZA 2GGCA 3MX6A 2Q96A
chains in the Genus database with same CATH topology
5E5BA 4U76A 4FLIA 5CDEA 5JFRA 4U6CA 2P9AA 2BWYA 4ZNGA 2GG5A 3CB6A 1WL6A 2BHDA 4U73A 3PKEA 2GU5A 4U71A 2GU7A 3IU9A 4IF7A 5CE6A 1W7VA 3PKDA 1Y1NA 1WKMA 1MATA 2V6CA 1QXWA 3MR1A 4S00A 1PV9A 4IKSA 5CIKA 4R60A 4RZZA 1C27A 2ADUA 2Q8KA 4MATA 3L24A 3RVAA 1XGNA 4S2TP 4S2RP 4FO8A 4Z7MA 1C22A 4IECA 4FO7A 2EVCA 2EVOA 4HXXA 2DFIA 3PKAA 2HOWA 1QXYA 2Q95A 1O0XA 5CNXA 2OKNA 3S6BA 2BN7A 2BWTA 3FMRA 2GGBA 2GG7A 4FLLA 2GG8A 1XGMA 2NQ7A 4IKRA 1WN1A 2EVMA 1JAWA 2BB7A 5JI6A 4S01A 1YJ3A 3Q6DA 4IU6A 1BOAA 4PNCA 1R58A 4U1BA 3RORA 5FCHA 2BHBA 2MATA 4JUQA 4RZYA 2B3KA 5JHUA 2BWUA 3TAVA 2BHCA 3IU8A 4FLJA 4IPAA 2P98A 4FUKA 4FKCA 1R5HA 1YW7A 4U6WA 4IKTA 4ZWOA 1B59A 1A16A 4U70A 2BWWA 2V3YA 4QR8A 3IU7A 3MATA 4RGZ1 1BN5A 1C21A 2B3HA 3PKCA 2IW2A 1KP0A 2V3ZA 4U69A 5CDLA 4IKUA 2GU4A 4U75A 2BWXA 1W2MA 1YW9A 4A6VA 3BITA 2GG9A 4A6WA 1XGOA 1KQ9A 1C23A 2Q93A 2GU6A 1N51A 3CTZA 3FM3A 2GZ5A 4PV4A 1XNZA 1QZYA 1CHMA 3BIQA 2GG2A 2NQ6A 1R5GA 4B28A 2B3LA 4U6JA 3D27A 4EGEA 2G6PA 5CDVA 4ZWUA 1WLRA 4U6ZA 2P99A 2V3XA 3IG4A 2GTXA 5D6FA 4ZWPA 2BHAA 2BWVA 4KM3A 4IDYA 1YVMA 2Q94A 1B6AA 3TB5A 2BH3A 2BWSA 5FCFA 1C24A 2EA4A 2Q92A 1KQ0A 1M35A 1WY2A 5D6EA 1XGSA 3L7GA 3CB5A 3FMQA 1WL9A 1YW8A 5CLSA 2GG0A 3PKBA 2GG3A 2ZSGA 2GA2A 1WBQA 3BIPA 4OOKA 1QXZA 2EA2A 4FLKA 4U6EA 2OAZA 2GGCA 3MX6A 2Q96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E5B A;  4U76 A;  4FLI A;  5CDE A;  5JFR A;  4U6C A;  2P9A A;  2BWY A;  4ZNG A;  2GG5 A;  3CB6 A;  1WL6 A;  2BHD A;  4U73 A;  3PKE A;  2GU5 A;  4U71 A;  2GU7 A;  3IU9 A;  4IF7 A;  5CE6 A;  1W7V A;  3PKD A;  1Y1N A;  1WKM A;  1MAT A;  2V6C A;  1QXW A;  3MR1 A;  4S00 A;  1PV9 A;  4IKS A;  5CIK A;  4R60 A;  4RZZ A;  1C27 A;  2ADU A;  2Q8K A;  4MAT A;  3L24 A;  3RVA A;  1XGN A;  4S2T P;  4S2R P;  4FO8 A;  4Z7M A;  1C22 A;  4IEC A;  4FO7 A;  2EVC A;  2EVO A;  4HXX A;  2DFI A;  3PKA A;  2HOW A;  1QXY A;  2Q95 A;  1O0X A;  5CNX A;  2OKN A;  3S6B A;  2BN7 A;  2BWT A;  3FMR A;  2GGB A;  2GG7 A;  4FLL A;  2GG8 A;  1XGM A;  2NQ7 A;  4IKR A;  1WN1 A;  2EVM A;  1JAW A;  2BB7 A;  5JI6 A;  4S01 A;  1YJ3 A;  3Q6D A;  4IU6 A;  1BOA A;  4PNC A;  1R58 A;  4U1B A;  3ROR A;  5FCH A;  2BHB A;  2MAT A;  4JUQ A;  4RZY A;  2B3K A;  5JHU A;  2BWU A;  3TAV A;  2BHC A;  3IU8 A;  4FLJ A;  4IPA A;  2P98 A;  4FUK A;  4FKC A;  1R5H A;  1YW7 A;  4U6W A;  4IKT A;  4ZWO A;  1B59 A;  1A16 A;  4U70 A;  2BWW A;  2V3Y A;  4QR8 A;  3IU7 A;  3MAT A;  4RGZ 1;  1BN5 A;  1C21 A;  2B3H A;  3PKC A;  2IW2 A;  1KP0 A;  2V3Z A;  4U69 A;  5CDL A;  4IKU A;  2GU4 A;  4U75 A;  2BWX A;  1W2M A;  1YW9 A;  4A6V A;  3BIT A;  2GG9 A;  4A6W A;  1XGO A;  1KQ9 A;  1C23 A;  2Q93 A;  2GU6 A;  1N51 A;  3CTZ A;  3FM3 A;  2GZ5 A;  4PV4 A;  1XNZ A;  1QZY A;  1CHM A;  3BIQ A;  2GG2 A;  2NQ6 A;  1R5G A;  4B28 A;  2B3L A;  4U6J A;  3D27 A;  4EGE A;  2G6P A;  5CDV A;  4ZWU A;  1WLR A;  4U6Z A;  2P99 A;  2V3X A;  3IG4 A;  2GTX A;  5D6F A;  4ZWP A;  2BHA A;  2BWV A;  4KM3 A;  4IDY A;  1YVM A;  2Q94 A;  1B6A A;  3TB5 A;  2BH3 A;  2BWS A;  5FCF A;  1C24 A;  2EA4 A;  2Q92 A;  1KQ0 A;  1M35 A;  1WY2 A;  5D6E A;  1XGS A;  3L7G A;  3CB5 A;  3FMQ A;  1WL9 A;  1YW8 A;  5CLS A;  2GG0 A;  3PKB A;  2GG3 A;  2ZSG A;  2GA2 A;  1WBQ A;  3BIP A;  4OOK A;  1QXZ A;  2EA2 A;  4FLK A;  4U6E A;  2OAZ A;  2GGC A;  3MX6 A;  2Q96 A; 
#chains in the Genus database with same CATH topology
 5E5B A;  4U76 A;  4FLI A;  5CDE A;  5JFR A;  4U6C A;  2P9A A;  2BWY A;  4ZNG A;  2GG5 A;  3CB6 A;  1WL6 A;  2BHD A;  4U73 A;  3PKE A;  2GU5 A;  4U71 A;  2GU7 A;  3IU9 A;  4IF7 A;  5CE6 A;  1W7V A;  3PKD A;  1Y1N A;  1WKM A;  1MAT A;  2V6C A;  1QXW A;  3MR1 A;  4S00 A;  1PV9 A;  4IKS A;  5CIK A;  4R60 A;  4RZZ A;  1C27 A;  2ADU A;  2Q8K A;  4MAT A;  3L24 A;  3RVA A;  1XGN A;  4S2T P;  4S2R P;  4FO8 A;  4Z7M A;  1C22 A;  4IEC A;  4FO7 A;  2EVC A;  2EVO A;  4HXX A;  2DFI A;  3PKA A;  2HOW A;  1QXY A;  2Q95 A;  1O0X A;  5CNX A;  2OKN A;  3S6B A;  2BN7 A;  2BWT A;  3FMR A;  2GGB A;  2GG7 A;  4FLL A;  2GG8 A;  1XGM A;  2NQ7 A;  4IKR A;  1WN1 A;  2EVM A;  1JAW A;  2BB7 A;  5JI6 A;  4S01 A;  1YJ3 A;  3Q6D A;  4IU6 A;  1BOA A;  4PNC A;  1R58 A;  4U1B A;  3ROR A;  5FCH A;  2BHB A;  2MAT A;  4JUQ A;  4RZY A;  2B3K A;  5JHU A;  2BWU A;  3TAV A;  2BHC A;  3IU8 A;  4FLJ A;  4IPA A;  2P98 A;  4FUK A;  4FKC A;  1R5H A;  1YW7 A;  4U6W A;  4IKT A;  4ZWO A;  1B59 A;  1A16 A;  4U70 A;  2BWW A;  2V3Y A;  4QR8 A;  3IU7 A;  3MAT A;  4RGZ 1;  1BN5 A;  1C21 A;  2B3H A;  3PKC A;  2IW2 A;  1KP0 A;  2V3Z A;  4U69 A;  5CDL A;  4IKU A;  2GU4 A;  4U75 A;  2BWX A;  1W2M A;  1YW9 A;  4A6V A;  3BIT A;  2GG9 A;  4A6W A;  1XGO A;  1KQ9 A;  1C23 A;  2Q93 A;  2GU6 A;  1N51 A;  3CTZ A;  3FM3 A;  2GZ5 A;  4PV4 A;  1XNZ A;  1QZY A;  1CHM A;  3BIQ A;  2GG2 A;  2NQ6 A;  1R5G A;  4B28 A;  2B3L A;  4U6J A;  3D27 A;  4EGE A;  2G6P A;  5CDV A;  4ZWU A;  1WLR A;  4U6Z A;  2P99 A;  2V3X A;  3IG4 A;  2GTX A;  5D6F A;  4ZWP A;  2BHA A;  2BWV A;  4KM3 A;  4IDY A;  1YVM A;  2Q94 A;  1B6A A;  3TB5 A;  2BH3 A;  2BWS A;  5FCF A;  1C24 A;  2EA4 A;  2Q92 A;  1KQ0 A;  1M35 A;  1WY2 A;  5D6E A;  1XGS A;  3L7G A;  3CB5 A;  3FMQ A;  1WL9 A;  1YW8 A;  5CLS A;  2GG0 A;  3PKB A;  2GG3 A;  2ZSG A;  2GA2 A;  1WBQ A;  3BIP A;  4OOK A;  1QXZ A;  2EA2 A;  4FLK A;  4U6E A;  2OAZ A;  2GGC A;  3MX6 A;  2Q96 A; 
#chains in the Genus database with same CATH homology
 5E5B A;  4U76 A;  4FLI A;  5CDE A;  5JFR A;  4U6C A;  2P9A A;  2BWY A;  4ZNG A;  2GG5 A;  3CB6 A;  1WL6 A;  2BHD A;  4U73 A;  3PKE A;  2GU5 A;  4U71 A;  2GU7 A;  3IU9 A;  4IF7 A;  5CE6 A;  1W7V A;  3PKD A;  1Y1N A;  1WKM A;  1MAT A;  2V6C A;  1QXW A;  3MR1 A;  4S00 A;  1PV9 A;  4IKS A;  5CIK A;  4R60 A;  4RZZ A;  1C27 A;  2ADU A;  2Q8K A;  4MAT A;  3L24 A;  3RVA A;  1XGN A;  4S2T P;  4S2R P;  4FO8 A;  4Z7M A;  1C22 A;  4IEC A;  4FO7 A;  2EVC A;  2EVO A;  4HXX A;  2DFI A;  3PKA A;  2HOW A;  1QXY A;  2Q95 A;  1O0X A;  5CNX A;  2OKN A;  3S6B A;  2BN7 A;  2BWT A;  3FMR A;  2GGB A;  2GG7 A;  4FLL A;  2GG8 A;  1XGM A;  2NQ7 A;  4IKR A;  1WN1 A;  2EVM A;  1JAW A;  2BB7 A;  5JI6 A;  4S01 A;  1YJ3 A;  3Q6D A;  4IU6 A;  1BOA A;  4PNC A;  1R58 A;  4U1B A;  3ROR A;  5FCH A;  2BHB A;  2MAT A;  4JUQ A;  4RZY A;  2B3K A;  5JHU A;  2BWU A;  3TAV A;  2BHC A;  3IU8 A;  4FLJ A;  4IPA A;  2P98 A;  4FUK A;  4FKC A;  1R5H A;  1YW7 A;  4U6W A;  4IKT A;  4ZWO A;  1B59 A;  1A16 A;  4U70 A;  2BWW A;  2V3Y A;  4QR8 A;  3IU7 A;  3MAT A;  4RGZ 1;  1BN5 A;  1C21 A;  2B3H A;  3PKC A;  2IW2 A;  1KP0 A;  2V3Z A;  4U69 A;  5CDL A;  4IKU A;  2GU4 A;  4U75 A;  2BWX A;  1W2M A;  1YW9 A;  4A6V A;  3BIT A;  2GG9 A;  4A6W A;  1XGO A;  1KQ9 A;  1C23 A;  2Q93 A;  2GU6 A;  1N51 A;  3CTZ A;  3FM3 A;  2GZ5 A;  4PV4 A;  1XNZ A;  1QZY A;  1CHM A;  3BIQ A;  2GG2 A;  2NQ6 A;  1R5G A;  4B28 A;  2B3L A;  4U6J A;  3D27 A;  4EGE A;  2G6P A;  5CDV A;  4ZWU A;  1WLR A;  4U6Z A;  2P99 A;  2V3X A;  3IG4 A;  2GTX A;  5D6F A;  4ZWP A;  2BHA A;  2BWV A;  4KM3 A;  4IDY A;  1YVM A;  2Q94 A;  1B6A A;  3TB5 A;  2BH3 A;  2BWS A;  5FCF A;  1C24 A;  2EA4 A;  2Q92 A;  1KQ0 A;  1M35 A;  1WY2 A;  5D6E A;  1XGS A;  3L7G A;  3CB5 A;  3FMQ A;  1WL9 A;  1YW8 A;  5CLS A;  2GG0 A;  3PKB A;  2GG3 A;  2ZSG A;  2GA2 A;  1WBQ A;  3BIP A;  4OOK A;  1QXZ A;  2EA2 A;  4FLK A;  4U6E A;  2OAZ A;  2GGC A;  3MX6 A;  2Q96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...