2GW1A

Crystal structure of the yeast tom70
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
514
structure length
487
Chain Sequence
b'EKDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKNLPSVTSMASFFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDKADESFTKAARLFEEQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAKKIQET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial precursor proteins import receptor
publication title Crystal structure of yeast mitochondrial outer membrane translocon member Tom70p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 175
structure length 487
sequence length 514
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2gw1A01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2gw1A02
3Q4AB 4G2VA 3U3WA 4HOQA 3BEEA 4UQZA 4AY5A 1IYGA 4Y6WA 4JA9A 2OOEA 4CGWA 3GZ2A 3PE3A 3OXGA 3CVLA 2AVPA 2C0LA 2Y4TA 4GCOA 3AS4A 5FZQA 3Q15A 1B89A 4UI9C 4HORA 3S7BA 5ARFA 2XCCA 3LY7A 4JL0A 4WNFA 4KYOB 4EQFA 4U0ZA 5D0OD 4GZ5A 3FFLA 2DBAA 4BWRA 1QZ2A 5BW8C 4G26A 4GYWA 1Y8MA 4W9RA 3TG4A 3UQ3A 4G23A 5JJ7A 4UQXA 3CVPA 3R9AB 4AY6A 2XGMA 1P5QA 3QOUA 1FCHA 4J8EA 4HOSA 3TGOA 5G04C 3LPZA 3MKRA 5EX0A 5HI7A 2XCBA 4GA0A 4GZ6A 4GA1A 4UQYA 2KCVA 4ABNA 3CEQA 1XNFA 2FO7A 4GPKA 2UWJG 1KT0A 2E2EA 3ASHA 5KJLA 3QWPA 1QQEA 4YNDA 3NF1A 3ZHEA 3SF4A 4I9CA 4YVQC 4XI0A 3OXLA 3MV2B 4N2SA 3ULQA 3ASDA 5FT9A 4BT9A 3GZ1A 5D0QD 2P58C 2BUGA 2XGSA 4O6FA 2LSUA 4J8FA 2KCKA 3FP3A 4WNGA 3KS2A 5G05C 2FF4A 3ESKA 4GZ3A 2LNIA 2C2LA 5CCMA 3HYMB 4GCNA 4G1TA 3ZFWA 3Q47B 1NA3A 2UY1B 1KLXA 2MHKA 3AS8A 3GW4A 2HR2A 4AIFA 4N3CA 3RJVA 4I2WA 1W3BA 4U0UA 5FZRA 5KJMA 5M72A 5DBKA 4I17A 4J0UA 4N3AA 2VGXB 4N39A 4UI9K 5KJKA 3CKBA 3KD7A 2PL2A 3KAEA 3LCAA 3U4TA 3QWVA 4Y6CA 3VTXA 4G24A 2XEVA 2KATA 2Y4UA 2XGOA 3ZN3A 4BT8A 4JHRA 2QFCA 3S7JA 2HYZA 1A17A 3JYSA 5G05J 4A1SA 5ARGA 5EX3A 4NQ0A 5EKQD 4LEUA 1TJCA 2LSVA 2R5SA 5JJTA 4XI9A 3CK7A 3QWWA 5JJ6A 3N71A 2WPVA 3QKYA 3IEGA 2L6JA 4RG6A 4AM9A 5HQ8A 2Q7FA 3RIBA 2WQHA 5FZSA 3PDNA 4UI9J 1ZBPA 4N3BA 4IN3B 4ME2A 2ONDA 2I6HA 3LY9A 4BTAA 4G25A 3TAXA 4F3VA 3CVNA 4I1AA 4U0SA 1HZ4A 5LCWC 4U04A 2KCLA 4N2QA 1KT1A 4J8DA 4CDRA 1NZNA 3OXFA 5BNWA 1PC2A 2V5FA 2VYIA 3FWVA 3CVQA 5AYWD 4GA2A 1HH8A 3E4BA 4H7XA 4WNEA 2FI7A 3CK8A 3LYAA 3S7DA 1ELWA 3K9IA 4HOUA 5G04J 2PQRA 4H7YA 2HO1A 4U07A 3PE4A 4B94A 2VQ2A 3LY8A 4GYOA 3AS5A 3GYZA 4WUYA 2VGYA 2JLBA 1YA0A 2FEZA 3EDTB 2C0MA 3ZHEB 3VTYA 4HOTA 2NC9A 3MV3B 3URZA 5BT1A 3TG5A 3MA5A 4I2ZA 1NA0A 2VSNA 4XIFA 1OUVA 4APOA 2IF4A 3O48A 3RKVA 3CKCA 5CCLA 3ZPJA 5LCWJ 3Q5MA 4KXKB 1E96B 2IFUA 3LKUA 4NRHB 2UY1A 4YVOA 1HXIA 2KC7A 3MEKA 3WXXA 1IHGA 2J9QA 3CK9A 3UUXA 5KJNA 5C1DA 3S7FA 2XPIA 4CGVA 3RU0A 4I9EA 4KBQA 4GYYA 5CHEE 2GW1A 5FJYA 3SZ7A 3ASFA 2VSYA 3ZGQA 2VGXA 5FTPA 4BTBA 4RG9A 2YHCA 3Q49B 2PZIA 1WAO1 1WM5A 1ELRA 4JA7A 3UPVA 3RO3A 3ASGA 3QDNA 5A7DB 3CV0A 2YQ8A 3RO2A 5DIZA 2FBNA 1ZU2A 5A6CA 4N5CA 2PQNA 4WNDA
chains in the Genus database with same CATH superfamily
2ZU6B 3Q4AB 4G2VA 4ANXA 1WY6A 1U2VG 4GB9A 1HG2A 4Y6WA 5FINA 3TWWA 3FTWA 3J5PA 3TXMA 3E30A 3PE3A 2XRZA 2CHZA 3EHQA 2Y4TA 3E37A 5FZQA 3Q15A 1JWFA 3U64A 5ARFA 3LY7A 2IJGX 5CRVA 3ZW3A 3FEXA 3VLFA 4JL0A 3ZYLA 3B7SA 1O1TA 4EQFA 3G2SA 4ILIA 5ENPD 3FUMA 5LP0A 5T3RA 4BWRA 5EILA 2P9UG 3C5RA 1Y8MA 3FTYA 2V0PA 2F8XK 4BX8A 3CSFA 1S63A 5JJ7A 3Q73A 1LTXA 3L08A 4PS8A 1HF8A 3QOUA 1FCHA 2R2LA 1K1AA 2XEHA 3TGOA 4K5CA 2MRIA 2E0IA 4B0ZA 5ENTD 4OVUA 3FEYA 4GA0A 1JWGA 4MKTA 4GZ6A 4GA1A 1FPPA 4IULA 4FULA 3UT7A 1N52A 1XNFA 4WWOA 4GPKA 1KT0A 1WG0A 4JHKA 3ASHA 5CBOA 3S2AA 3KSQA 1LD8A 1OWPA 2X6FA 3ZHEA 2YNQA 3MYVA 2LAIA 4XKBA 4LNGA 2XS8A 3RK6A 3L13A 3ULQA 4I6JA 4C48B 1HG5A 2P58C 3PH0C 4UWFA 2ETBA 5HKPA 3FP3A 2RD0A 3KS2A 5G05C 3D9LA 1EPUA 5H7PA 2P9SG 2C2LA 4BSZB 4GCNA 3SY2A 1SVXA 3MKQB 1O1SA 3D9OA 1NA3A 3JCKC 2UY1B 4TXPA 5AQBA 4ANWA 4ACLA 2MHKA 3AS8A 2HR2A 3JXJA 3AG3E 4UWKA 5CEAA 3EHNA 3FTZA 3GZSA 5DBKA 2ZISA 4HLLA 1L5JA 3EHMA 5KJKA 5AIJA 5B1AE 1H6OA 3KAEA 2F0YA 5LOZA 3PVLA 4EPZA 1VDYA 4TUUA 3F6QA 4AV7A 4KZCA 3CIAA 2Y4UA 4M3OA 3CGHA 4C0EA 3S7JA 1A17A 3JYSA 3T8MA 1OY3D 1PY1A 4AVXA 1UJJA 4LEUA 3FDHA 3FULA 3EIQC 2GRRB 4L2YA 3ESLA 3APFA 3SQVA 3CK7A 4BX9A 3EJNA 1N94A 3N71A 3ASNE 5CEDB 2VSOE 3SNXA 4L2LA 4I6GA 1OWMA 5EN5D 3PREA 1Z5SC 1IQUA 5HQ8A 2WQHA 5FZSA 2DWZA 5ENOD 3MZLB 1NFIE 2WXLA 3L17A 4MS6A 1Z3XA 4BSXA 3RAUA 4YDWA 4BY6A 2ONDA 1OCRE 2DVWA 4I1AA 1HZ4A 3AG2E 5BXOA 2KCLA 1KT1A 2A5UA 4U95D 4J8DA 5G2NA 3CHRA 3OXFA 4J8YA 4WWPA 2VYIA 3UIOC 2AXZA 3SFZA 4GMRA 3C98A 3W9FA 3E4BA 4H7XA 2B0OE 4WNEA 2DCPA 3S7DA 3PZDA 4GTPA 4I43A 4U07A 1BI8B 3V31A 2VQ2A 3BUAA 3HHMA 3LY8A 3NOGD 1UJKA 2AWIA 2WXIA 4BEPA 3LVQE 2J8SD 2L0TB 5JA4D 4ACKA 2VGYA 4TUMA 2C0MA 3DSTA 3ZHEB 2BKGA 5FQ7A 1JCQA 1H19A 1MZCA 4BESA 4HRNA 5BT1A 4PS7A 3MA5A 4I2ZA 1NA0A 4APOA 3JUIA 3FH8A 3FUJA 4LERA 3ZEFA 2DYRE 3L6AA 1O5MA 2IFUA 1SA5A 2YINA 3FU6A 4YVOA 3DWLG 4IRUA 3D9PA 4FHJA 1MX2A 3ZXPA 4IYPA 2XPIA 2OEVA 4DRXE 2P9LG 1NP7A 2ETCA 2GW1A 3SZ7A 4CCAA 2IOSA 3E34A 2PM6A 2OEWA 2EQXA 3TL5A 4B8AA 3FTVA 1MYOA 4RG9A 2EINE 3IXEA 2YHCA 3SO8A 3Q49B 1AWCB 3CSTA 4AXHA 3NBNB 1WM5A 4GZCA 1ZB1A 4TRQA 4JA7A 3UPVA 3RO3A 2AW6A 4FLHA 3CV0A 3RO2A 5DIZA 2FBNA 5EDSA 3ZVVA 4LNBA 4WNDA 1S64A 3LDZA 1SQMA 3QAQA 4HI9A 4A3TA 3U3WA 4HOQA 2Y1LE 3DSVA 4ATGA 4GPMA 4URKA 2YHEA 3TJPA 4CGWA 3GZ2A 5FQ8A 3CVLA 3NOCD 3SFXA 2OCCE 3J5QB 4PDXA 3ZYKA 4UI9C 4HORA 4Q96A 2WXRA 3G2WA 4U8YD 3VLDA 4C0MA 3UXGA 3PEUB 1O1RA 2AXUA 4X8QA 2P2CP 3MKQA 3C3OA 4UQXA 4LSZE 2EILE 1DCQA 3R9AB 2DYSE 1N11A 4U63A 1YYHA 5G04C 3LPZA 5EX0A 5HI7A 3CHOA 3FTSA 4UQYA 2HM8A 3B13A 3FY4A 3CEQA 3CHPA 4P29A 1BI7B 4J6IA 2UWJG 3FH7A 3D9NA 4HFGA 1QQEA 3QWPA 5C2YA 4K03A 4YNDA 3D9HA 3QB2A 3V2XA 4XI0A 3FTUA 3RRUA 3QK0A 4XEIG 1MHQA 2Y0BG 3EIJA 5FT9A 4BT9A 4LUNU 3FHEA 2XGSA 3IHVA 4FU3A 4J8SA 1PAQA 2CFUA 5ENRD 2P9NG 2GGFA 4O60A 4ILHB 4R7LA 1TNBA 3TWSA 3HYMB 4GTOA 4B89A 4PH4B 1KLXA 2X6HA 4QFVA 3ABLE 2FULA 2WXJA 2GRLA 4XZ4A 5AARA 3GW4A 3U9WA 2JEKA 5AQ7A 4AIFA 3NZSA 3CQGB 3RJVA 1OCOE 4HRLA 4DX7D 4U0UA 3TWXA 3PZ1A 2CG2A 3PRZA 5M72A 4I1OB 4N3AA 4HI8A 4CEMA 4N39A 5KNGA 4HVBA 4OYSA 1MQSA 2PL2A 3LCAA 4JD2G 3FUNA 4GTSA 2QC9A 3VTXA 1TYQG 4FLBA 3TWTA 1FVFA 4DX2A 4DX1A 4CT0A 4JHRA 3R9MA 1Z6TA 3IHYA 3Q7FA 2F37A 2P9KG 4XKCA 5ARGA 5EX3A 3DSSA 1KZOA 1TNOA 2X38A 5FIOA 2LSVA 1UN9A 3CQCB 3CVXA 5HS0A 2WXQA 4J7WA 4OAVB 2R03A 1GW6A 2EIJE 4XE0A 1XGWA 3IEGA 2J08A 3R7RA 1KPSB 2NSZA 2OVBA 3PDNA 3ISMC 4UI9J 3U66A 2IO2C 4WAFA 3CVWA 4IN3B 2XEEA 2I6HA 3BQOA 3TAXA 2WXNA 1EYHA 4FADA 2WQ7A 2BKKB 2WQ6A 3I4GA 4L7TA 3C3QA 3UKRG 1QYMA 4NACA 4Q94A 2V5FA 3FWVA 3CVQA 3IBEA 1BU9A 3LJNA 3E33A 1D8DA 3Q9NC 3LYAA 3K9IA 4HOUA 5G04J 2PQRA 5J08A 2X6IA 2VGEA 3G2TA 4UWGA 3FU3A 5ANLA 3FUHA 3AS5A 3CR3A 3APDA 2WXHA 3GYZA 3LS8A 2A5EA 2I2OA 4WUYA 3TWRA 2JLBA 1YA0A 1HU3A 1KZPA 2WXGA 1TN7A 3DRAA 2I9CA 2AJAA 5EIBE 3KSLA 4EZKA 4JB8P 2GRPB 1OUVA 3ZKJA 3O48A 3ML8A 1N0QA 4A3VA 3OTNA 4AOFA 3FUEA 2X6KA 3EUVA 1N95A 3Q78A 4KXKB 4CT4A 2Y69E 3L16A 1E96B 2XPZA 3LKUA 5ENQD 4NRHB 5BUZA 1HXIA 1X81A 2KC7A 2X3MA 3WXXA 1IHGA 2A4ZA 3CK9A 3NQPA 3ZNGA 3UUXA 5KJNA 5C1DA 3S7FA 4CGVA 3RU0A 2R17C 3PZ4A 4KBQA 1S70B 4DX5D 3TXNA 1UW4B 3ZYMA 2WXKA 2BEDA 1OXJA 4O1PA 4APFA 3ASFA 2RFMA 3DXMG 3DBSA 2VGXA 2P9PG 5FTPA 2MOWA 4BTBA 4KT6B 2IQCA 2OV8A 1NI1A 3IV0A 3FUFA 3P2BA 1ELRA 2GRNB 2WVIA 5A7DB 5E75A 4GTRA 1INZA 3APCA 1NL4A 3RRNB 4N5CA 4GMJA 4YDEA 3Q75A 5D66A 2M63A 1JCRA 2WXMA 4JC8A 2J4BA 4HNAD 4UUCA 4UQZA 4LRZA 1IYGA 3LXUX 3V30A 4PUCA 3CHSA 3NZUA 4FC8A 4E85A 2XS1A 3AU5A 3MJWA 3SBTB 4GCOA 4GAAA 3AS4A 2ZXWE 3B7TA 1B89A 4CDNA 2XCCA 1E8WA 5JMND 1IXVA 2X6JA 2KBXA 1E8YA 3Q9UC 2WXFA 4KYOB 4EZJA 3EHRA 2JABA 4DK5A 4U0ZA 4DLOA 5D0OD 5AAOA 4OVVA 2LO6A 3IKOB 2IU1A 3FFLA 3SBSA 5FQ6A 3PZ2A 5BW8C 4G26A 3DEPA 4BFRA 4W9RA 3TG4A 3UQ3A 1BD8A 3DXKG 2GROB 3I5PA 4NIKA 4AY6A 3UIPC 4RVBA 3NAWA 3ASOE 1IQRA 1P5QA 2RKKA 4J8EA 1HO8A 3UKUG 3G2UA 1N4PA 4U7EB 1Y6IA 2R02A 3HXCA 1IHBA 3ZYQA 2BTDA 4ABNA 2FO7A 2H6HA 3FTXA 1FT1A 5AJLA 2Y3AA 1OWNA 1MX4A 3QC1A 1DNPA 2XZDG 3MGBA 4I1MA 5ANRA 4M7CA 3NF1A 3SF4A 2GRQB 4YVQC 3UM0A 3OXLA 2H6FA 4NURA 5BXUA 3ASDA 3I3NA 2LXMA 5EYLA 1TN6A 2BUGA 3B7RL 5IY5E 2LSUA 5CRUA 1AP7A 4J8FA 2KCKA 4RLYA 3UX4A 2FF4A 3EU9A 4HLEA 3ESKA 4GU5A 4DLQA 2L6BA 4GZ3A 1BPOA 2IOLA 3ULYA 5CCMA 4G1TA 3ZFWA 5KCMA 2KM4A 2WXPA 1SA4A 3Q47B 3DSUA 3ULEG 1N4SA 2I1JA 3TWQA 4I2WA 1W3BA 4GTMA 4BERA 3SI5A 1A5EA 1RW2A 4J0UA 2VGXB 3BG1B 1EF1C 4C9BB 4JEHA 3CKBA 3KD7A 4ANVA 1FT2A 3U4TA 4A55A 4D10C 1E7VA 1S0PA 4LNUD 4U8VD 4B8CB 3JUEA 2QY7A 3HXFA 2XEVA 2HE0A 4BT8A 5D2MC 4KZ0A 2J4DA 5CMYA 4K5AB 4EHMA 3VLEA 2L9BA 1JUQA 3D3MA 1N4QA 5EIDA 4A1SA 3L54A 3PUKA 5EKQD 1TR4A 2R5SA 5JJTA 2AXVA 3QWWA 4JHJA 3HRAA 4YDOA 2WPVA 3QKYA 2Q7FA 3RIBA 2KZTA 1TNUA 1OT8A 1FVHA 4MBGA 1ZBPA 3D9JA 1TEZA 3DPYA 5ITZF 4F3VA 4U0SA 3LJ3A 1JCSA 3FUKA 3T5VA 3BU8A 3PUJA 4N2QA 2ZGGA 4KMOA 2DZNA 3KEZA 4Z68A 5CECB 4GTQA 1TN8A 4CDRA 4ANUA 5BV1A 3JQ1A 3G2VA 4RQIA 1OWLA 2XHEA 1PC2A 4CDMA 2P9IG 2VTBA 3DSXA 4FJZA 5AYWD 4GZDA 3X2QE 2RFAA 1HH8A 2CG3A 3E32A 4HQDA 4UWHA 3ZU7B 5CBNA 2R59A 3AU4A 5EYPF 1SW6A 2DIWA 4F7AA 4H7YA 2HO1A 1E7UA 2CFZA 5B1BE 3WG7E 4B94A 5LFAA 2OVFA 5B3SE 3HXDA 2WB2A 2B6CA 5AQAA 4LG6A 3EDTB 2WM9A 2CHXA 3VTYA 5HRYA 2EIME 4DI4A 3MV3B 4JW1A 1UOHA 3TG5A 2J07A 2VSNA 3CKCA 5CCLA 3ZPJA 2MYOA 3SGHA 5LCWJ 4G8KA 3Q5MA 3PNLB 3ABKE 2DZOA 5AN8A 1N9AA 3ZRHA 2CHWA 5ENNA 4EBAA 2LXLA 1DC2A 2J9QA 3UT8A 2H6IA 3CHQA 3O4ZA 4GYYA 3QNKA 3W9GA 3ZUVB 2IONA 4K0RA 3ZGQA 2GRMA 4ILGA 4U8HA 4FHKA 4A1GA 4F1PA 2PZIA 1WAO1 1OCZE 2QZAA 3FUDA 3CVVA 3ASGA 3R7QA 4DI3A 3PZ3A 5CERB 2V8SE 5A6CA 3BG0B 1E90A 4FJYA 1X5BA 3RSEG 1K1BA 5T8IA 3B95A 3MCXA 3BEEA 4AY5A 1EDUA 1WDYA 4GTVA 4MLPA 3DSWA 4JA9A 2OOEA 3OXGA 2AVPA 3ML9A 3EU5A 4FP7A 2C0LA 3HIZA 1K3ZD 3CHMA 5E76A 3S7BA 5FWQA 3SFYA 2XQ0A 1OCCE 3T5XA 2KZTB 3UT4A 4WNFA 4PS3A 3PS6A 4TV3A 2XENA 4GZ5A 3DPDA 2DBAA 1IKND 1QZ2A 4B93B 4GYWA 1Z3YA 3I4RB 5JHBA 2V4LA 4G23A 4L9PA 2L0IA 2H6GA 3CVPA 3T8KA 2XGMA 4JPSA 4KVOA 2VTBB 1G3NB 4QQIA 1HX8A 3ZXSA 2RG8A 4ZFHA 4TXQA 1TJFA 4ATZD 3ONKA 4HOSA 2J49A 3L9TA 4HS2A 3MKRA 2ETAA 4O1OA 4L1BA 3PNTB 2WMOA 2XCBA 4Q69A 2BF0X 1N54A 1HFAA 2V5QC 4JEUA 3P1UA 2KCVA 3CVUA 3T9KA 3TWUA 3QARA 4U96D 2E2EA 5KJLA 4G8LA 4DUIA 3D9MA 4I9CA 2LAHA 3MX3A 3MV2B 3C3RA 4DJAA 4N2SA 5KWDA 3GZ1A 4K5BA 5D0QD 4FA6A 1H2TC 1UN8A 4O6FA 2ILRA 1TNZA 4WNGA 2LUHA 2IEJA 2FO1E 4DPRA 4LCTA 2NYJA 2LNIA 3JXIA 5G55A 4BETA 1H6KA 5J90A 3KEAA 3FU0A 2I1KA 2XPYA 4KVMA 4JZYA 2R05A 4G11A 2V4HC 1N0RA 4N3CA 2ZIRA 1MX6A 3FUIA 3AAAC 3ONLA 5FZRA 5KJMA 1SZ9A 3AJIA 4ZHBA 3HVEA 4I17A 3UINC 1U3DA 4CYMD 1H2UA 4UI9K 3UI2A 4WWNA 3NB2A 1TNYA 4DX6D 3HDXA 1DVPA 3QWVA 4Y6CA 1SZAA 4OAUC 4G24A 5JHAA 5CMWA 5FQ4A 2KATA 5LX8A 2XGOA 3ZN3A 1V54E 4CZ2D 4EBAG 3OAWA 2QFCA 3PEVB 5KBAA 3UM1A 4UWLA 2HYZA 5AJDA 1OWOA 3D9KA 5G05J 5A23A 4NQ0A 3AG4E 1TJCA 4GMLA 4HRMB 5AQ9A 3LEWA 1LF8A 4XI9A 5AENA 1E8ZA 5JJ6A 4AP2A 3CVYA 1D9SA 2ZGDA 2J09A 1JPLA 4EECA 2L6JA 4RG6A 4AM9A 3UM3A 3DEOA 2NXPA 4N3BA 4TXRA 4JXTA 4ME2A 3LY9A 4BTAA 4G25A 3CVNA 5LCWC 1BLXB 4U04A 1LD7A 1K8KG 4A63B 1NZNA 4AJWA 1YCSB 5BNWA 2F8YA 3B7UX 4CRWA 3QJZA 4F53A 3V2OA 1H2VC 3L82A 1V55E 4GA2A 1UG3A 3AG1E 4YDYA 2FI7A 4E6HA 3CK8A 4JVSA 1ELWA 1Q2ZA 3UTMA 2WMNA 3PE4A 4F6RD 4V3IA 3ENEA 4GYOA 3TWVA 3UMVA 2FEZA 1DCEA 1H0AA 1U3CA 2XRYA 1H6PA 1MJ0A 5T4YA 4MRUA 2NC9A 4HOTA 3URZA 2XZTG 4AEZC 3UM2A 4RSYA 4XIFA 3SHFA 2IF4A 4GTTA 3RKVA 3RRMB 1YMPA 5ENSD 3HXBA 3V79K 4I6EA 2UY1A 3CLJA 3FU5A 1E8XA 5BPPA 4L23A 2PNNA 3MEKA 3JQ0A 1N4RA 2WXOA 4EZLA 3Q79A 4F1SA 3D9IA 4HBDA 5KNHD 2QYUA 4N5QA 4I9EA 3C72A 2IO3C 2VSXE 1HS6A 1QNFA 5CHEE 5FJYA 3B7BA 4HXIA 2VSYA 3ABME 3HVEB 2PM7A 1RZ4A 5BV0A 2EIKE 3Q7AA 3LVRE 4XX5A 4HB5A 2QYJA 3QDNA 2YQ8A 1ELKA 1D8EA 1ZU2A 1HE8A 3HG0D 3SD5A 2PQNA 2VJ8A 2KXPC 3FH5A 2IY0C 3ZIMA 1QBQA 3HXEA 3L22A
chains in the Genus database with same CATH topology
2ZU6B 1X5BA 2M63A 3Q4AB 4G2VA 3LDZA 1SQMA 2WXMA 4JC8A 3QAQA 5T8IA 2J4BA 4A3TA 4ANXA 4HOQA 3U3WA 3MCXA 1WY6A 3BEEA 4UQZA 4AY5A 4LRZA 4GB9A 1HG2A 4ATGA 1EDUA 3LXUX 4MLPA 4Y6WA 1IYGA 4URKA 2YHEA 3TJPA 3FTWA 4JA9A 2OOEA 4PUCA 4CGWA 3TXMA 3CHSA 3GZ2A 3NZUA 3PE3A 4FC8A 5FQ8A 3OXGA 4E85A 3CVLA 2AVPA 3AU5A 2XRZA 3ML9A 2CHZA 3MJWA 4FP7A 2C0LA 3HIZA 3SBTB 4PDXA 2Y4TA 4GCOA 4GAAA 3AS4A 3CHMA 3B7TA 5FZQA 3Q15A 1B89A 1JWFA 4UI9C 3ZYKA 5E76A 4HORA 4Q96A 3S7BA 2WXRA 5FWQA 3U64A 5ARFA 4CDNA 2XCCA 3LY7A 2IJGX 3ZW3A 2XQ0A 3FEXA 1E8WA 3T5XA 3G2WA 2X6JA 2KZTB 3UT4A 1E8YA 3VLFA 4JL0A 2WXFA 3ZYLA 4WNFA 4KYOB 4EZJA 3VLDA 4C0MA 4PS3A 3B7SA 4DK5A 4EQFA 3G2SA 3PS6A 4ILIA 4U0ZA 4DLOA 4TV3A 5D0OD 4OVVA 4GZ5A 2LO6A 3IKOB 2IU1A 3PEUB 3DPDA 3FUMA 5LP0A 3FFLA 2DBAA 3SBSA 5T3RA 5FQ6A 4BWRA 1QZ2A 5BW8C 4G26A 4GYWA 1Y8MA 3FTYA 2V0PA 1Z3YA 4BFRA 3I4RB 4W9RA 5JHBA 4BX8A 2AXUA 3CSFA 3TG4A 2V4LA 3UQ3A 4G23A 3MKQA 5JJ7A 4UQXA 2L0IA 3CVPA 3R9AB 3I5PA 4AY6A 2XGMA 4JPSA 4KVOA 4RVBA 4U63A 2VTBB 3L08A 1HX8A 4PS8A 2RG8A 1HF8A 3ZXSA 1TJFA 1IQRA 1P5QA 3QOUA 3ONKA 1FCHA 4J8EA 1HO8A 4HOSA 3TGOA 2J49A 5G04C 4HS2A 2MRIA 2E0IA 3G2UA 3LPZA 4B0ZA 3MKRA 5EX0A 4L1BA 1Y6IA 4OVUA 3PNTB 3CHOA 2WMOA 5HI7A 2XCBA 3FTSA 3FEYA 1JWGA 4GA0A 4GZ6A 4MKTA 4Q69A 4GA1A 2BF0X 4IULA 1N54A 4UQYA 1HFAA 2HM8A 4FULA 4JEUA 3ZYQA 3UT7A 3B13A 3P1UA 2BTDA 2KCVA 1N52A 3CVUA 3FY4A 4ABNA 3CEQA 3CHPA 1XNFA 3QARA 4P29A 4WWOA 2FO7A 3FTXA 4GPKA 4J6IA 2UWJG 5AJLA 2Y3AA 1KT0A 1OWNA 3FH7A 4JHKA 2E2EA 3ASHA 3D9NA 3S2AA 3QC1A 1DNPA 4HFGA 5KJLA 1QQEA 3QWPA 3MGBA 4I1MA 5C2YA 4K03A 1OWPA 5ANRA 2X6FA 4YNDA 3NF1A 2YNQA 3ZHEA 3D9MA 3SF4A 3MYVA 3QB2A 4I9CA 2LAIA 4YVQC 2LAHA 3MX3A 4XI0A 3OXLA 3MV2B 4XKBA 3FTUA 3RRUA 4DJAA 3QK0A 4NURA 4N2SA 1MHQA 3RK6A 3L13A 3ULQA 3EIJA 3ASDA 5FT9A 4I6JA 4BT9A 3GZ1A 4LUNU 3I3NA 5D0QD 4FA6A 1HG5A 1H2TC 1UN8A 2P58C 2BUGA 2XGSA 3FHEA 3PH0C 4O6FA 4UWFA 3B7RL 2LSUA 3IHVA 2ILRA 4J8FA 2KCKA 3FP3A 4WNGA 4FU3A 2RD0A 3KS2A 5G05C 3UX4A 4J8SA 3D9LA 1PAQA 2FF4A 4HLEA 2CFUA 4DPRA 3ESKA 2GGFA 4GU5A 4LCTA 1EPUA 4DLQA 4GZ3A 4ILHB 4R7LA 2LNIA 2C2LA 1BPOA 2IOLA 5CCMA 3HYMB 4GCNA 4G1TA 3ZFWA 5G55A 5KCMA 1H6KA 5J90A 3MKQB 2KM4A 2WXPA 3FU0A 2I1KA 3D9OA 2XPYA 4B89A 3Q47B 1NA3A 4PH4B 3JCKC 2UY1B 4ANWA 1KLXA 2X6HA 4KVMA 4QFVA 4ACLA 4JZYA 2FULA 2MHKA 2WXJA 2GRLA 4XZ4A 4G11A 3AS8A 2I1JA 3GW4A 3U9WA 2HR2A 2JEKA 4AIFA 4N3CA 3NZSA 3CQGB 3RJVA 4I2WA 1W3BA 4UWKA 3EHNA 3FTZA 3SI5A 4U0UA 3FUIA 3ONLA 5FZRA 5KJMA 1SZ9A 2CG2A 3PRZA 3GZSA 5M72A 3HVEA 4I1OB 5DBKA 4I17A 4J0UA 4N3AA 1U3DA 2VGXB 4CEMA 4N39A 3BG1B 1EF1C 1H2UA 4C9BB 1L5JA 3EHMA 4JEHA 4UI9K 3CKBA 4OYSA 4HVBA 5KJKA 5AIJA 3KD7A 1MQSA 2PL2A 3KAEA 3LCAA 4WWNA 4ANVA 5LOZA 3PVLA 3U4TA 4EPZA 3HDXA 1VDYA 4A55A 1DVPA 3FUNA 3QWVA 4TUUA 4Y6CA 1E7VA 1S0PA 3VTXA 1SZAA 4D10C 4B8CB 4FLBA 4G24A 5JHAA 2QY7A 4KZCA 4AV7A 5CMWA 2XEVA 5FQ4A 3CIAA 2KATA 2Y4UA 1FVFA 2XGOA 3ZN3A 4BT8A 4KZ0A 2J4DA 5LX8A 4CT0A 4M3OA 4JHRA 3CGHA 3OAWA 5CMYA 3VLEA 4EBAG 4C0EA 2QFCA 3PEVB 2L9BA 1JUQA 3D3MA 4UWLA 3CVVA 3S7JA 2HYZA 1Z6TA 3IHYA 5AJDA 1A17A 1OWOA 3D9KA 3JYSA 5G05J 5A23A 4XKCA 3T8MA 4A1SA 5ARGA 5EX3A 3L54A 1PY1A 3PUKA 4NQ0A 5EKQD 4AVXA 1UJJA 2X38A 4LEUA 3FDHA 1TJCA 2LSVA 2R5SA 3EIQC 3FULA 4GMLA 3ESLA 4L2YA 5JJTA 3LEWA 1LF8A 2AXVA 1UN9A 4XI9A 5AENA 3CQCB 3APFA 3CK7A 3QWWA 4BX9A 3CVXA 1E8ZA 2WXQA 5JJ6A 4AP2A 3EJNA 4JHJA 3CVYA 3N71A 1GW6A 2VSOE 2J09A 4XE0A 3SNXA 2WPVA 3QKYA 4L2LA 4I6GA 1OWMA 1JPLA 1XGWA 3PREA 4EECA 3IEGA 2J08A 3R7RA 1IQUA 2L6JA 4RG6A 2NSZA 4AM9A 5HQ8A 2Q7FA 3RIBA 2WQHA 5FZSA 2OVBA 3PDNA 3MZLB 2KZTA 2WXLA 4UI9J 3U66A 3L17A 4MS6A 1Z3XA 4WAFA 1FVHA 2NXPA 1ZBPA 4BSXA 4N3BA 3CVWA 4IN3B 4BY6A 4JXTA 4ME2A 2ONDA 2I6HA 3LY9A 3D9JA 1TEZA 4BTAA 4G25A 3TAXA 4F3VA 2WXNA 3CVNA 4I1AA 4U0SA 1HZ4A 3LJ3A 5LCWC 3FUKA 4U04A 3T5VA 2KCLA 3PUJA 1EYHA 4FADA 2WQ7A 4N2QA 4KMOA 1KT1A 2A5UA 3KEZA 2WQ6A 4J8DA 4CDRA 4ANUA 5G2NA 3I4GA 5BV1A 3JQ1A 4L7TA 3G2VA 3CHRA 1NZNA 3OXFA 4WWPA 1OWLA 2XHEA 4AJWA 5BNWA 4NACA 1PC2A 4Q94A 4CDMA 2VTBA 2V5FA 3B7UX 2VYIA 4CRWA 2AXZA 3SFZA 3QJZA 4F53A 3FWVA 4FJZA 1H2VC 3CVQA 3IBEA 5AYWD 4GZDA 4GA2A 1UG3A 3C98A 1HH8A 2CG3A 3E4BA 4H7XA 4UWHA 4WNEA 2DCPA 2FI7A 4E6HA 2R59A 3CK8A 3LYAA 3S7DA 3AU4A 4JVSA 1ELWA 3K9IA 4HOUA 5G04J 2DIWA 2PQRA 4F7AA 3PZDA 4H7YA 2HO1A 4I43A 4U07A 1E7UA 2CFZA 2WMNA 5J08A 3PE4A 4B94A 2X6IA 2VQ2A 3G2TA 3HHMA 4V3IA 3LY8A 5LFAA 3ENEA 4GYOA 4UWGA 3FU3A 5ANLA 1UJKA 2AWIA 2OVFA 3FUHA 2WXIA 3AS5A 3CR3A 3UMVA 3APDA 2WB2A 2WXHA 3GYZA 3LVQE 3LS8A 2L0TB 4WUYA 2I2OA 4ACKA 2VGYA 2JLBA 2FEZA 1YA0A 3EDTB 1HU3A 2C0MA 2WM9A 1H0AA 1U3CA 2CHXA 3ZHEB 3VTYA 2WXGA 2XRYA 5FQ7A 1H19A 5T4YA 4DI4A 2I9CA 4MRUA 2NC9A 3MV3B 4JW1A 4HOTA 3URZA 4EZKA 4AEZC 5BT1A 4PS7A 4RSYA 3TG5A 3MA5A 4I2ZA 1NA0A 2J07A 2VSNA 4XIFA 1OUVA 3SHFA 4APOA 2IF4A 3O48A 3ML8A 3CKCA 3RKVA 3RRMB 5CCLA 3JUIA 3ZPJA 4A3VA 3SGHA 5LCWJ 3OTNA 4AOFA 3FUEA 3Q5MA 2X6KA 3FH8A 3FUJA 4LERA 3ZEFA 4KXKB 4CT4A 3PNLB 4I6EA 3L16A 3ZRHA 1E96B 2XPZA 3L6AA 2IFUA 3LKUA 4NRHB 2YINA 2UY1A 3FU6A 3CLJA 4YVOA 3FU5A 1E8XA 1HXIA 2KC7A 2X3MA 5BPPA 2CHWA 4IRUA 4L23A 5ENNA 5BUZA 3MEKA 4EBAA 3D9PA 4FHJA 3JQ0A 3WXXA 1IHGA 2WXOA 2J9QA 4EZLA 2A4ZA 3CK9A 4F1SA 3D9IA 3NQPA 3UT8A 3UUXA 5KJNA 5C1DA 4IYPA 3S7FA 2XPIA 4CGVA 3RU0A 2R17C 4I9EA 4KBQA 3CHQA 3O4ZA 4GYYA 3QNKA 2VSXE 1NP7A 3TXNA 1HS6A 1QNFA 5CHEE 1UW4B 3ZYMA 2WXKA 2GW1A 5FJYA 3SZ7A 4APFA 4HXIA 3ASFA 4CCAA 2IOSA 2IONA 2PM6A 2VSYA 4K0RA 3DBSA 2EQXA 2VGXA 3ZGQA 3TL5A 3HVEB 2GRMA 4B8AA 5FTPA 3FTVA 2MOWA 4ILGA 4U8HA 2PM7A 4BTBA 4RG9A 4FHKA 4KT6B 2IQCA 2OV8A 4A1GA 2YHCA 3Q49B 5BV0A 3IV0A 2PZIA 3FUFA 3CSTA 3P2BA 3LVRE 1WAO1 4AXHA 1WM5A 4GZCA 1ELRA 4TRQA 4XX5A 4JA7A 3UPVA 3RO3A 3FUDA 2AW6A 3ASGA 4FLHA 3R7QA 2WVIA 3QDNA 5A7DB 4DI3A 3CV0A 2YQ8A 5E75A 3RO2A 5DIZA 1INZA 1ELKA 3APCA 2FBNA 1ZU2A 1HE8A 3RRNB 2V8SE 3SD5A 5A6CA 4N5CA 2PQNA 2VJ8A 4GMJA 5EDSA 3BG0B 3ZVVA 3FH5A 1E90A 3ZIMA 4FJYA 4WNDA 3L22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q4A B;  4G2V A;  3U3W A;  4HOQ A;  3BEE A;  4UQZ A;  4AY5 A;  1IYG A;  4Y6W A;  4JA9 A;  2OOE A;  4CGW A;  3GZ2 A;  3PE3 A;  3OXG A;  3CVL A;  2AVP A;  2C0L A;  2Y4T A;  4GCO A;  3AS4 A;  5FZQ A;  3Q15 A;  1B89 A;  4UI9 C;  4HOR A;  3S7B A;  5ARF A;  2XCC A;  3LY7 A;  4JL0 A;  4WNF A;  4KYO B;  4EQF A;  4U0Z A;  5D0O D;  4GZ5 A;  3FFL A;  2DBA A;  4BWR A;  1QZ2 A;  5BW8 C;  4G26 A;  4GYW A;  1Y8M A;  4W9R A;  3TG4 A;  3UQ3 A;  4G23 A;  5JJ7 A;  4UQX A;  3CVP A;  3R9A B;  4AY6 A;  2XGM A;  1P5Q A;  3QOU A;  1FCH A;  4J8E A;  4HOS A;  3TGO A;  5G04 C;  3LPZ A;  3MKR A;  5EX0 A;  5HI7 A;  2XCB A;  4GA0 A;  4GZ6 A;  4GA1 A;  4UQY A;  2KCV A;  4ABN A;  3CEQ A;  1XNF A;  2FO7 A;  4GPK A;  2UWJ G;  1KT0 A;  2E2E A;  3ASH A;  5KJL A;  3QWP A;  1QQE A;  4YND A;  3NF1 A;  3ZHE A;  3SF4 A;  4I9C A;  4YVQ C;  4XI0 A;  3OXL A;  3MV2 B;  4N2S A;  3ULQ A;  3ASD A;  5FT9 A;  4BT9 A;  3GZ1 A;  5D0Q D;  2P58 C;  2BUG A;  2XGS A;  4O6F A;  2LSU A;  4J8F A;  2KCK A;  3FP3 A;  4WNG A;  3KS2 A;  5G05 C;  2FF4 A;  3ESK A;  4GZ3 A;  2LNI A;  2C2L A;  5CCM A;  3HYM B;  4GCN A;  4G1T A;  3ZFW A;  3Q47 B;  1NA3 A;  2UY1 B;  1KLX A;  2MHK A;  3AS8 A;  3GW4 A;  2HR2 A;  4AIF A;  4N3C A;  3RJV A;  4I2W A;  1W3B A;  4U0U A;  5FZR A;  5KJM A;  5M72 A;  5DBK A;  4I17 A;  4J0U A;  4N3A A;  2VGX B;  4N39 A;  4UI9 K;  5KJK A;  3CKB A;  3KD7 A;  2PL2 A;  3KAE A;  3LCA A;  3U4T A;  3QWV A;  4Y6C A;  3VTX A;  4G24 A;  2XEV A;  2KAT A;  2Y4U A;  2XGO A;  3ZN3 A;  4BT8 A;  4JHR A;  2QFC A;  3S7J A;  2HYZ A;  1A17 A;  3JYS A;  5G05 J;  4A1S A;  5ARG A;  5EX3 A;  4NQ0 A;  5EKQ D;  4LEU A;  1TJC A;  2LSV A;  2R5S A;  5JJT A;  4XI9 A;  3CK7 A;  3QWW A;  5JJ6 A;  3N71 A;  2WPV A;  3QKY A;  3IEG A;  2L6J A;  4RG6 A;  4AM9 A;  5HQ8 A;  2Q7F A;  3RIB A;  2WQH A;  5FZS A;  3PDN A;  4UI9 J;  1ZBP A;  4N3B A;  4IN3 B;  4ME2 A;  2OND A;  2I6H A;  3LY9 A;  4BTA A;  4G25 A;  3TAX A;  4F3V A;  3CVN A;  4I1A A;  4U0S A;  1HZ4 A;  5LCW C;  4U04 A;  2KCL A;  4N2Q A;  1KT1 A;  4J8D A;  4CDR A;  1NZN A;  3OXF A;  5BNW A;  1PC2 A;  2V5F A;  2VYI A;  3FWV A;  3CVQ A;  5AYW D;  4GA2 A;  1HH8 A;  3E4B A;  4H7X A;  4WNE A;  2FI7 A;  3CK8 A;  3LYA A;  3S7D A;  1ELW A;  3K9I A;  4HOU A;  5G04 J;  2PQR A;  4H7Y A;  2HO1 A;  4U07 A;  3PE4 A;  4B94 A;  2VQ2 A;  3LY8 A;  4GYO A;  3AS5 A;  3GYZ A;  4WUY A;  2VGY A;  2JLB A;  1YA0 A;  2FEZ A;  3EDT B;  2C0M A;  3ZHE B;  3VTY A;  4HOT A;  2NC9 A;  3MV3 B;  3URZ A;  5BT1 A;  3TG5 A;  3MA5 A;  4I2Z A;  1NA0 A;  2VSN A;  4XIF A;  1OUV A;  4APO A;  2IF4 A;  3O48 A;  3RKV A;  3CKC A;  5CCL A;  3ZPJ A;  5LCW J;  3Q5M A;  4KXK B;  1E96 B;  2IFU A;  3LKU A;  4NRH B;  2UY1 A;  4YVO A;  1HXI A;  2KC7 A;  3MEK A;  3WXX A;  1IHG A;  2J9Q A;  3CK9 A;  3UUX A;  5KJN A;  5C1D A;  3S7F A;  2XPI A;  4CGV A;  3RU0 A;  4I9E A;  4KBQ A;  4GYY A;  5CHE E;  2GW1 A;  5FJY A;  3SZ7 A;  3ASF A;  2VSY A;  3ZGQ A;  2VGX A;  5FTP A;  4BTB A;  4RG9 A;  2YHC A;  3Q49 B;  2PZI A;  1WAO 1;  1WM5 A;  1ELR A;  4JA7 A;  3UPV A;  3RO3 A;  3ASG A;  3QDN A;  5A7D B;  3CV0 A;  2YQ8 A;  3RO2 A;  5DIZ A;  2FBN A;  1ZU2 A;  5A6C A;  4N5C A;  2PQN A;  4WND A; 
#chains in the Genus database with same CATH topology
 2ZU6 B;  3Q4A B;  4G2V A;  4ANX A;  1WY6 A;  1U2V G;  4GB9 A;  1HG2 A;  4Y6W A;  5FIN A;  3TWW A;  3FTW A;  3J5P A;  3TXM A;  3E30 A;  3PE3 A;  2XRZ A;  2CHZ A;  3EHQ A;  2Y4T A;  3E37 A;  5FZQ A;  3Q15 A;  1JWF A;  3U64 A;  5ARF A;  3LY7 A;  2IJG X;  5CRV A;  3ZW3 A;  3FEX A;  3VLF A;  4JL0 A;  3ZYL A;  3B7S A;  1O1T A;  4EQF A;  3G2S A;  4ILI A;  5ENP D;  3FUM A;  5LP0 A;  5T3R A;  4BWR A;  5EIL A;  2P9U G;  3C5R A;  1Y8M A;  3FTY A;  2V0P A;  2F8X K;  4BX8 A;  3CSF A;  1S63 A;  5JJ7 A;  3Q73 A;  1LTX A;  3L08 A;  4PS8 A;  1HF8 A;  3QOU A;  1FCH A;  2R2L A;  1K1A A;  2XEH A;  3TGO A;  4K5C A;  2MRI A;  2E0I A;  4B0Z A;  5ENT D;  4OVU A;  3FEY A;  4GA0 A;  1JWG A;  4MKT A;  4GZ6 A;  4GA1 A;  1FPP A;  4IUL A;  4FUL A;  3UT7 A;  1N52 A;  1XNF A;  4WWO A;  4GPK A;  1KT0 A;  1WG0 A;  4JHK A;  3ASH A;  5CBO A;  3S2A A;  3KSQ A;  1LD8 A;  1OWP A;  2X6F A;  3ZHE A;  2YNQ A;  3MYV A;  2LAI A;  4XKB A;  4LNG A;  2XS8 A;  3RK6 A;  3L13 A;  3ULQ A;  4I6J A;  4C48 B;  1HG5 A;  2P58 C;  3PH0 C;  4UWF A;  2ETB A;  5HKP A;  3FP3 A;  2RD0 A;  3KS2 A;  5G05 C;  3D9L A;  1EPU A;  5H7P A;  2P9S G;  2C2L A;  4BSZ B;  4GCN A;  3SY2 A;  1SVX A;  3MKQ B;  1O1S A;  3D9O A;  1NA3 A;  3JCK C;  2UY1 B;  4TXP A;  5AQB A;  4ANW A;  4ACL A;  2MHK A;  3AS8 A;  2HR2 A;  3JXJ A;  3AG3 E;  4UWK A;  5CEA A;  3EHN A;  3FTZ A;  3GZS A;  5DBK A;  2ZIS A;  4HLL A;  1L5J A;  3EHM A;  5KJK A;  5AIJ A;  5B1A E;  1H6O A;  3KAE A;  2F0Y A;  5LOZ A;  3PVL A;  4EPZ A;  1VDY A;  4TUU A;  3F6Q A;  4AV7 A;  4KZC A;  3CIA A;  2Y4U A;  4M3O A;  3CGH A;  4C0E A;  3S7J A;  1A17 A;  3JYS A;  3T8M A;  1OY3 D;  1PY1 A;  4AVX A;  1UJJ A;  4LEU A;  3FDH A;  3FUL A;  3EIQ C;  2GRR B;  4L2Y A;  3ESL A;  3APF A;  3SQV A;  3CK7 A;  4BX9 A;  3EJN A;  1N94 A;  3N71 A;  3ASN E;  5CED B;  2VSO E;  3SNX A;  4L2L A;  4I6G A;  1OWM A;  5EN5 D;  3PRE A;  1Z5S C;  1IQU A;  5HQ8 A;  2WQH A;  5FZS A;  2DWZ A;  5ENO D;  3MZL B;  1NFI E;  2WXL A;  3L17 A;  4MS6 A;  1Z3X A;  4BSX A;  3RAU A;  4YDW A;  4BY6 A;  2OND A;  1OCR E;  2DVW A;  4I1A A;  1HZ4 A;  3AG2 E;  5BXO A;  2KCL A;  1KT1 A;  2A5U A;  4U95 D;  4J8D A;  5G2N A;  3CHR A;  3OXF A;  4J8Y A;  4WWP A;  2VYI A;  3UIO C;  2AXZ A;  3SFZ A;  4GMR A;  3C98 A;  3W9F A;  3E4B A;  4H7X A;  2B0O E;  4WNE A;  2DCP A;  3S7D A;  3PZD A;  4GTP A;  4I43 A;  4U07 A;  1BI8 B;  3V31 A;  2VQ2 A;  3BUA A;  3HHM A;  3LY8 A;  3NOG D;  1UJK A;  2AWI A;  2WXI A;  4BEP A;  3LVQ E;  2J8S D;  2L0T B;  5JA4 D;  4ACK A;  2VGY A;  4TUM A;  2C0M A;  3DST A;  3ZHE B;  2BKG A;  5FQ7 A;  1JCQ A;  1H19 A;  1MZC A;  4BES A;  4HRN A;  5BT1 A;  4PS7 A;  3MA5 A;  4I2Z A;  1NA0 A;  4APO A;  3JUI A;  3FH8 A;  3FUJ A;  4LER A;  3ZEF A;  2DYR E;  3L6A A;  1O5M A;  2IFU A;  1SA5 A;  2YIN A;  3FU6 A;  4YVO A;  3DWL G;  4IRU A;  3D9P A;  4FHJ A;  1MX2 A;  3ZXP A;  4IYP A;  2XPI A;  2OEV A;  4DRX E;  2P9L G;  1NP7 A;  2ETC A;  2GW1 A;  3SZ7 A;  4CCA A;  2IOS A;  3E34 A;  2PM6 A;  2OEW A;  2EQX A;  3TL5 A;  4B8A A;  3FTV A;  1MYO A;  4RG9 A;  2EIN E;  3IXE A;  2YHC A;  3SO8 A;  3Q49 B;  1AWC B;  3CST A;  4AXH A;  3NBN B;  1WM5 A;  4GZC A;  1ZB1 A;  4TRQ A;  4JA7 A;  3UPV A;  3RO3 A;  2AW6 A;  4FLH A;  3CV0 A;  3RO2 A;  5DIZ A;  2FBN A;  5EDS A;  3ZVV A;  4LNB A;  4WND A;  1S64 A;  3LDZ A;  1SQM A;  3QAQ A;  4HI9 A;  4A3T A;  3U3W A;  4HOQ A;  2Y1L E;  3DSV A;  4ATG A;  4GPM A;  4URK A;  2YHE A;  3TJP A;  4CGW A;  3GZ2 A;  5FQ8 A;  3CVL A;  3NOC D;  3SFX A;  2OCC E;  3J5Q B;  4PDX A;  3ZYK A;  4UI9 C;  4HOR A;  4Q96 A;  2WXR A;  3G2W A;  4U8Y D;  3VLD A;  4C0M A;  3UXG A;  3PEU B;  1O1R A;  2AXU A;  4X8Q A;  2P2C P;  3MKQ A;  3C3O A;  4UQX A;  4LSZ E;  2EIL E;  1DCQ A;  3R9A B;  2DYS E;  1N11 A;  4U63 A;  1YYH A;  5G04 C;  3LPZ A;  5EX0 A;  5HI7 A;  3CHO A;  3FTS A;  4UQY A;  2HM8 A;  3B13 A;  3FY4 A;  3CEQ A;  3CHP A;  4P29 A;  1BI7 B;  4J6I A;  2UWJ G;  3FH7 A;  3D9N A;  4HFG A;  1QQE A;  3QWP A;  5C2Y A;  4K03 A;  4YND A;  3D9H A;  3QB2 A;  3V2X A;  4XI0 A;  3FTU A;  3RRU A;  3QK0 A;  4XEI G;  1MHQ A;  2Y0B G;  3EIJ A;  5FT9 A;  4BT9 A;  4LUN U;  3FHE A;  2XGS A;  3IHV A;  4FU3 A;  4J8S A;  1PAQ A;  2CFU A;  5ENR D;  2P9N G;  2GGF A;  4O60 A;  4ILH B;  4R7L A;  1TNB A;  3TWS A;  3HYM B;  4GTO A;  4B89 A;  4PH4 B;  1KLX A;  2X6H A;  4QFV A;  3ABL E;  2FUL A;  2WXJ A;  2GRL A;  4XZ4 A;  5AAR A;  3GW4 A;  3U9W A;  2JEK A;  5AQ7 A;  4AIF A;  3NZS A;  3CQG B;  3RJV A;  1OCO E;  4HRL A;  4DX7 D;  4U0U A;  3TWX A;  3PZ1 A;  2CG2 A;  3PRZ A;  5M72 A;  4I1O B;  4N3A A;  4HI8 A;  4CEM A;  4N39 A;  5KNG A;  4HVB A;  4OYS A;  1MQS A;  2PL2 A;  3LCA A;  4JD2 G;  3FUN A;  4GTS A;  2QC9 A;  3VTX A;  1TYQ G;  4FLB A;  3TWT A;  1FVF A;  4DX2 A;  4DX1 A;  4CT0 A;  4JHR A;  3R9M A;  1Z6T A;  3IHY A;  3Q7F A;  2F37 A;  2P9K G;  4XKC A;  5ARG A;  5EX3 A;  3DSS A;  1KZO A;  1TNO A;  2X38 A;  5FIO A;  2LSV A;  1UN9 A;  3CQC B;  3CVX A;  5HS0 A;  2WXQ A;  4J7W A;  4OAV B;  2R03 A;  1GW6 A;  2EIJ E;  4XE0 A;  1XGW A;  3IEG A;  2J08 A;  3R7R A;  1KPS B;  2NSZ A;  2OVB A;  3PDN A;  3ISM C;  4UI9 J;  3U66 A;  2IO2 C;  4WAF A;  3CVW A;  4IN3 B;  2XEE A;  2I6H A;  3BQO A;  3TAX A;  2WXN A;  1EYH A;  4FAD A;  2WQ7 A;  2BKK B;  2WQ6 A;  3I4G A;  4L7T A;  3C3Q A;  3UKR G;  1QYM A;  4NAC A;  4Q94 A;  2V5F A;  3FWV A;  3CVQ A;  3IBE A;  1BU9 A;  3LJN A;  3E33 A;  1D8D A;  3Q9N C;  3LYA A;  3K9I A;  4HOU A;  5G04 J;  2PQR A;  5J08 A;  2X6I A;  2VGE A;  3G2T A;  4UWG A;  3FU3 A;  5ANL A;  3FUH A;  3AS5 A;  3CR3 A;  3APD A;  2WXH A;  3GYZ A;  3LS8 A;  2A5E A;  2I2O A;  4WUY A;  3TWR A;  2JLB A;  1YA0 A;  1HU3 A;  1KZP A;  2WXG A;  1TN7 A;  3DRA A;  2I9C A;  2AJA A;  5EIB E;  3KSL A;  4EZK A;  4JB8 P;  2GRP B;  1OUV A;  3ZKJ A;  3O48 A;  3ML8 A;  1N0Q A;  4A3V A;  3OTN A;  4AOF A;  3FUE A;  2X6K A;  3EUV A;  1N95 A;  3Q78 A;  4KXK B;  4CT4 A;  2Y69 E;  3L16 A;  1E96 B;  2XPZ A;  3LKU A;  5ENQ D;  4NRH B;  5BUZ A;  1HXI A;  1X81 A;  2KC7 A;  2X3M A;  3WXX A;  1IHG A;  2A4Z A;  3CK9 A;  3NQP A;  3ZNG A;  3UUX A;  5KJN A;  5C1D A;  3S7F A;  4CGV A;  3RU0 A;  2R17 C;  3PZ4 A;  4KBQ A;  1S70 B;  4DX5 D;  3TXN A;  1UW4 B;  3ZYM A;  2WXK A;  2BED A;  1OXJ A;  4O1P A;  4APF A;  3ASF A;  2RFM A;  3DXM G;  3DBS A;  2VGX A;  2P9P G;  5FTP A;  2MOW A;  4BTB A;  4KT6 B;  2IQC A;  2OV8 A;  1NI1 A;  3IV0 A;  3FUF A;  3P2B A;  1ELR A;  2GRN B;  2WVI A;  5A7D B;  5E75 A;  4GTR A;  1INZ A;  3APC A;  1NL4 A;  3RRN B;  4N5C A;  4GMJ A;  4YDE A;  3Q75 A;  5D66 A;  2M63 A;  1JCR A;  2WXM A;  4JC8 A;  2J4B A;  4HNA D;  4UUC A;  4UQZ A;  4LRZ A;  1IYG A;  3LXU X;  3V30 A;  4PUC A;  3CHS A;  3NZU A;  4FC8 A;  4E85 A;  2XS1 A;  3AU5 A;  3MJW A;  3SBT B;  4GCO A;  4GAA A;  3AS4 A;  2ZXW E;  3B7T A;  1B89 A;  4CDN A;  2XCC A;  1E8W A;  5JMN D;  1IXV A;  2X6J A;  2KBX A;  1E8Y A;  3Q9U C;  2WXF A;  4KYO B;  4EZJ A;  3EHR A;  2JAB A;  4DK5 A;  4U0Z A;  4DLO A;  5D0O D;  5AAO A;  4OVV A;  2LO6 A;  3IKO B;  2IU1 A;  3FFL A;  3SBS A;  5FQ6 A;  3PZ2 A;  5BW8 C;  4G26 A;  3DEP A;  4BFR A;  4W9R A;  3TG4 A;  3UQ3 A;  1BD8 A;  3DXK G;  2GRO B;  3I5P A;  4NIK A;  4AY6 A;  3UIP C;  4RVB A;  3NAW A;  3ASO E;  1IQR A;  1P5Q A;  2RKK A;  4J8E A;  1HO8 A;  3UKU G;  3G2U A;  1N4P A;  4U7E B;  1Y6I A;  2R02 A;  3HXC A;  1IHB A;  3ZYQ A;  2BTD A;  4ABN A;  2FO7 A;  2H6H A;  3FTX A;  1FT1 A;  5AJL A;  2Y3A A;  1OWN A;  1MX4 A;  3QC1 A;  1DNP A;  2XZD G;  3MGB A;  4I1M A;  5ANR A;  4M7C A;  3NF1 A;  3SF4 A;  2GRQ B;  4YVQ C;  3UM0 A;  3OXL A;  2H6F A;  4NUR A;  5BXU A;  3ASD A;  3I3N A;  2LXM A;  5EYL A;  1TN6 A;  2BUG A;  3B7R L;  5IY5 E;  2LSU A;  5CRU A;  1AP7 A;  4J8F A;  2KCK A;  4RLY A;  3UX4 A;  2FF4 A;  3EU9 A;  4HLE A;  3ESK A;  4GU5 A;  4DLQ A;  2L6B A;  4GZ3 A;  1BPO A;  2IOL A;  3ULY A;  5CCM A;  4G1T A;  3ZFW A;  5KCM A;  2KM4 A;  2WXP A;  1SA4 A;  3Q47 B;  3DSU A;  3ULE G;  1N4S A;  2I1J A;  3TWQ A;  4I2W A;  1W3B A;  4GTM A;  4BER A;  3SI5 A;  1A5E A;  1RW2 A;  4J0U A;  2VGX B;  3BG1 B;  1EF1 C;  4C9B B;  4JEH A;  3CKB A;  3KD7 A;  4ANV A;  1FT2 A;  3U4T A;  4A55 A;  4D10 C;  1E7V A;  1S0P A;  4LNU D;  4U8V D;  4B8C B;  3JUE A;  2QY7 A;  3HXF A;  2XEV A;  2HE0 A;  4BT8 A;  5D2M C;  4KZ0 A;  2J4D A;  5CMY A;  4K5A B;  4EHM A;  3VLE A;  2L9B A;  1JUQ A;  3D3M A;  1N4Q A;  5EID A;  4A1S A;  3L54 A;  3PUK A;  5EKQ D;  1TR4 A;  2R5S A;  5JJT A;  2AXV A;  3QWW A;  4JHJ A;  3HRA A;  4YDO A;  2WPV A;  3QKY A;  2Q7F A;  3RIB A;  2KZT A;  1TNU A;  1OT8 A;  1FVH A;  4MBG A;  1ZBP A;  3D9J A;  1TEZ A;  3DPY A;  5ITZ F;  4F3V A;  4U0S A;  3LJ3 A;  1JCS A;  3FUK A;  3T5V A;  3BU8 A;  3PUJ A;  4N2Q A;  2ZGG A;  4KMO A;  2DZN A;  3KEZ A;  4Z68 A;  5CEC B;  4GTQ A;  1TN8 A;  4CDR A;  4ANU A;  5BV1 A;  3JQ1 A;  3G2V A;  4RQI A;  1OWL A;  2XHE A;  1PC2 A;  4CDM A;  2P9I G;  2VTB A;  3DSX A;  4FJZ A;  5AYW D;  4GZD A;  3X2Q E;  2RFA A;  1HH8 A;  2CG3 A;  3E32 A;  4HQD A;  4UWH A;  3ZU7 B;  5CBN A;  2R59 A;  3AU4 A;  5EYP F;  1SW6 A;  2DIW A;  4F7A A;  4H7Y A;  2HO1 A;  1E7U A;  2CFZ A;  5B1B E;  3WG7 E;  4B94 A;  5LFA A;  2OVF A;  5B3S E;  3HXD A;  2WB2 A;  2B6C A;  5AQA A;  4LG6 A;  3EDT B;  2WM9 A;  2CHX A;  3VTY A;  5HRY A;  2EIM E;  4DI4 A;  3MV3 B;  4JW1 A;  1UOH A;  3TG5 A;  2J07 A;  2VSN A;  3CKC A;  5CCL A;  3ZPJ A;  2MYO A;  3SGH A;  5LCW J;  4G8K A;  3Q5M A;  3PNL B;  3ABK E;  2DZO A;  5AN8 A;  1N9A A;  3ZRH A;  2CHW A;  5ENN A;  4EBA A;  2LXL A;  1DC2 A;  2J9Q A;  3UT8 A;  2H6I A;  3CHQ A;  3O4Z A;  4GYY A;  3QNK A;  3W9G A;  3ZUV B;  2ION A;  4K0R A;  3ZGQ A;  2GRM A;  4ILG A;  4U8H A;  4FHK A;  4A1G A;  4F1P A;  2PZI A;  1WAO 1;  1OCZ E;  2QZA A;  3FUD A;  3CVV A;  3ASG A;  3R7Q A;  4DI3 A;  3PZ3 A;  5CER B;  2V8S E;  5A6C A;  3BG0 B;  1E90 A;  4FJY A;  1X5B A;  3RSE G;  1K1B A;  5T8I A;  3B95 A;  3MCX A;  3BEE A;  4AY5 A;  1EDU A;  1WDY A;  4GTV A;  4MLP A;  3DSW A;  4JA9 A;  2OOE A;  3OXG A;  2AVP A;  3ML9 A;  3EU5 A;  4FP7 A;  2C0L A;  3HIZ A;  1K3Z D;  3CHM A;  5E76 A;  3S7B A;  5FWQ A;  3SFY A;  2XQ0 A;  1OCC E;  3T5X A;  2KZT B;  3UT4 A;  4WNF A;  4PS3 A;  3PS6 A;  4TV3 A;  2XEN A;  4GZ5 A;  3DPD A;  2DBA A;  1IKN D;  1QZ2 A;  4B93 B;  4GYW A;  1Z3Y A;  3I4R B;  5JHB A;  2V4L A;  4G23 A;  4L9P A;  2L0I A;  2H6G A;  3CVP A;  3T8K A;  2XGM A;  4JPS A;  4KVO A;  2VTB B;  1G3N B;  4QQI A;  1HX8 A;  3ZXS A;  2RG8 A;  4ZFH A;  4TXQ A;  1TJF A;  4ATZ D;  3ONK A;  4HOS A;  2J49 A;  3L9T A;  4HS2 A;  3MKR A;  2ETA A;  4O1O A;  4L1B A;  3PNT B;  2WMO A;  2XCB A;  4Q69 A;  2BF0 X;  1N54 A;  1HFA A;  2V5Q C;  4JEU A;  3P1U A;  2KCV A;  3CVU A;  3T9K A;  3TWU A;  3QAR A;  4U96 D;  2E2E A;  5KJL A;  4G8L A;  4DUI A;  3D9M A;  4I9C A;  2LAH A;  3MX3 A;  3MV2 B;  3C3R A;  4DJA A;  4N2S A;  5KWD A;  3GZ1 A;  4K5B A;  5D0Q D;  4FA6 A;  1H2T C;  1UN8 A;  4O6F A;  2ILR A;  1TNZ A;  4WNG A;  2LUH A;  2IEJ A;  2FO1 E;  4DPR A;  4LCT A;  2NYJ A;  2LNI A;  3JXI A;  5G55 A;  4BET A;  1H6K A;  5J90 A;  3KEA A;  3FU0 A;  2I1K A;  2XPY A;  4KVM A;  4JZY A;  2R05 A;  4G11 A;  2V4H C;  1N0R A;  4N3C A;  2ZIR A;  1MX6 A;  3FUI A;  3AAA C;  3ONL A;  5FZR A;  5KJM A;  1SZ9 A;  3AJI A;  4ZHB A;  3HVE A;  4I17 A;  3UIN C;  1U3D A;  4CYM D;  1H2U A;  4UI9 K;  3UI2 A;  4WWN A;  3NB2 A;  1TNY A;  4DX6 D;  3HDX A;  1DVP A;  3QWV A;  4Y6C A;  1SZA A;  4OAU C;  4G24 A;  5JHA A;  5CMW A;  5FQ4 A;  2KAT A;  5LX8 A;  2XGO A;  3ZN3 A;  1V54 E;  4CZ2 D;  4EBA G;  3OAW A;  2QFC A;  3PEV B;  5KBA A;  3UM1 A;  4UWL A;  2HYZ A;  5AJD A;  1OWO A;  3D9K A;  5G05 J;  5A23 A;  4NQ0 A;  3AG4 E;  1TJC A;  4GML A;  4HRM B;  5AQ9 A;  3LEW A;  1LF8 A;  4XI9 A;  5AEN A;  1E8Z A;  5JJ6 A;  4AP2 A;  3CVY A;  1D9S A;  2ZGD A;  2J09 A;  1JPL A;  4EEC A;  2L6J A;  4RG6 A;  4AM9 A;  3UM3 A;  3DEO A;  2NXP A;  4N3B A;  4TXR A;  4JXT A;  4ME2 A;  3LY9 A;  4BTA A;  4G25 A;  3CVN A;  5LCW C;  1BLX B;  4U04 A;  1LD7 A;  1K8K G;  4A63 B;  1NZN A;  4AJW A;  1YCS B;  5BNW A;  2F8Y A;  3B7U X;  4CRW A;  3QJZ A;  4F53 A;  3V2O A;  1H2V C;  3L82 A;  1V55 E;  4GA2 A;  1UG3 A;  3AG1 E;  4YDY A;  2FI7 A;  4E6H A;  3CK8 A;  4JVS A;  1ELW A;  1Q2Z A;  3UTM A;  2WMN A;  3PE4 A;  4F6R D;  4V3I A;  3ENE A;  4GYO A;  3TWV A;  3UMV A;  2FEZ A;  1DCE A;  1H0A A;  1U3C A;  2XRY A;  1H6P A;  1MJ0 A;  5T4Y A;  4MRU A;  2NC9 A;  4HOT A;  3URZ A;  2XZT G;  4AEZ C;  3UM2 A;  4RSY A;  4XIF A;  3SHF A;  2IF4 A;  4GTT A;  3RKV A;  3RRM B;  1YMP A;  5ENS D;  3HXB A;  3V79 K;  4I6E A;  2UY1 A;  3CLJ A;  3FU5 A;  1E8X A;  5BPP A;  4L23 A;  2PNN A;  3MEK A;  3JQ0 A;  1N4R A;  2WXO A;  4EZL A;  3Q79 A;  4F1S A;  3D9I A;  4HBD A;  5KNH D;  2QYU A;  4N5Q A;  4I9E A;  3C72 A;  2IO3 C;  2VSX E;  1HS6 A;  1QNF A;  5CHE E;  5FJY A;  3B7B A;  4HXI A;  2VSY A;  3ABM E;  3HVE B;  2PM7 A;  1RZ4 A;  5BV0 A;  2EIK E;  3Q7A A;  3LVR E;  4XX5 A;  4HB5 A;  2QYJ A;  3QDN A;  2YQ8 A;  1ELK A;  1D8E A;  1ZU2 A;  1HE8 A;  3HG0 D;  3SD5 A;  2PQN A;  2VJ8 A;  2KXP C;  3FH5 A;  2IY0 C;  3ZIM A;  1QBQ A;  3HXE A;  3L22 A; 
#chains in the Genus database with same CATH homology
 2ZU6 B;  1X5B A;  2M63 A;  3Q4A B;  4G2V A;  3LDZ A;  1SQM A;  2WXM A;  4JC8 A;  3QAQ A;  5T8I A;  2J4B A;  4A3T A;  4ANX A;  4HOQ A;  3U3W A;  3MCX A;  1WY6 A;  3BEE A;  4UQZ A;  4AY5 A;  4LRZ A;  4GB9 A;  1HG2 A;  4ATG A;  1EDU A;  3LXU X;  4MLP A;  4Y6W A;  1IYG A;  4URK A;  2YHE A;  3TJP A;  3FTW A;  4JA9 A;  2OOE A;  4PUC A;  4CGW A;  3TXM A;  3CHS A;  3GZ2 A;  3NZU A;  3PE3 A;  4FC8 A;  5FQ8 A;  3OXG A;  4E85 A;  3CVL A;  2AVP A;  3AU5 A;  2XRZ A;  3ML9 A;  2CHZ A;  3MJW A;  4FP7 A;  2C0L A;  3HIZ A;  3SBT B;  4PDX A;  2Y4T A;  4GCO A;  4GAA A;  3AS4 A;  3CHM A;  3B7T A;  5FZQ A;  3Q15 A;  1B89 A;  1JWF A;  4UI9 C;  3ZYK A;  5E76 A;  4HOR A;  4Q96 A;  3S7B A;  2WXR A;  5FWQ A;  3U64 A;  5ARF A;  4CDN A;  2XCC A;  3LY7 A;  2IJG X;  3ZW3 A;  2XQ0 A;  3FEX A;  1E8W A;  3T5X A;  3G2W A;  2X6J A;  2KZT B;  3UT4 A;  1E8Y A;  3VLF A;  4JL0 A;  2WXF A;  3ZYL A;  4WNF A;  4KYO B;  4EZJ A;  3VLD A;  4C0M A;  4PS3 A;  3B7S A;  4DK5 A;  4EQF A;  3G2S A;  3PS6 A;  4ILI A;  4U0Z A;  4DLO A;  4TV3 A;  5D0O D;  4OVV A;  4GZ5 A;  2LO6 A;  3IKO B;  2IU1 A;  3PEU B;  3DPD A;  3FUM A;  5LP0 A;  3FFL A;  2DBA A;  3SBS A;  5T3R A;  5FQ6 A;  4BWR A;  1QZ2 A;  5BW8 C;  4G26 A;  4GYW A;  1Y8M A;  3FTY A;  2V0P A;  1Z3Y A;  4BFR A;  3I4R B;  4W9R A;  5JHB A;  4BX8 A;  2AXU A;  3CSF A;  3TG4 A;  2V4L A;  3UQ3 A;  4G23 A;  3MKQ A;  5JJ7 A;  4UQX A;  2L0I A;  3CVP A;  3R9A B;  3I5P A;  4AY6 A;  2XGM A;  4JPS A;  4KVO A;  4RVB A;  4U63 A;  2VTB B;  3L08 A;  1HX8 A;  4PS8 A;  2RG8 A;  1HF8 A;  3ZXS A;  1TJF A;  1IQR A;  1P5Q A;  3QOU A;  3ONK A;  1FCH A;  4J8E A;  1HO8 A;  4HOS A;  3TGO A;  2J49 A;  5G04 C;  4HS2 A;  2MRI A;  2E0I A;  3G2U A;  3LPZ A;  4B0Z A;  3MKR A;  5EX0 A;  4L1B A;  1Y6I A;  4OVU A;  3PNT B;  3CHO A;  2WMO A;  5HI7 A;  2XCB A;  3FTS A;  3FEY A;  1JWG A;  4GA0 A;  4GZ6 A;  4MKT A;  4Q69 A;  4GA1 A;  2BF0 X;  4IUL A;  1N54 A;  4UQY A;  1HFA A;  2HM8 A;  4FUL A;  4JEU A;  3ZYQ A;  3UT7 A;  3B13 A;  3P1U A;  2BTD A;  2KCV A;  1N52 A;  3CVU A;  3FY4 A;  4ABN A;  3CEQ A;  3CHP A;  1XNF A;  3QAR A;  4P29 A;  4WWO A;  2FO7 A;  3FTX A;  4GPK A;  4J6I A;  2UWJ G;  5AJL A;  2Y3A A;  1KT0 A;  1OWN A;  3FH7 A;  4JHK A;  2E2E A;  3ASH A;  3D9N A;  3S2A A;  3QC1 A;  1DNP A;  4HFG A;  5KJL A;  1QQE A;  3QWP A;  3MGB A;  4I1M A;  5C2Y A;  4K03 A;  1OWP A;  5ANR A;  2X6F A;  4YND A;  3NF1 A;  2YNQ A;  3ZHE A;  3D9M A;  3SF4 A;  3MYV A;  3QB2 A;  4I9C A;  2LAI A;  4YVQ C;  2LAH A;  3MX3 A;  4XI0 A;  3OXL A;  3MV2 B;  4XKB A;  3FTU A;  3RRU A;  4DJA A;  3QK0 A;  4NUR A;  4N2S A;  1MHQ A;  3RK6 A;  3L13 A;  3ULQ A;  3EIJ A;  3ASD A;  5FT9 A;  4I6J A;  4BT9 A;  3GZ1 A;  4LUN U;  3I3N A;  5D0Q D;  4FA6 A;  1HG5 A;  1H2T C;  1UN8 A;  2P58 C;  2BUG A;  2XGS A;  3FHE A;  3PH0 C;  4O6F A;  4UWF A;  3B7R L;  2LSU A;  3IHV A;  2ILR A;  4J8F A;  2KCK A;  3FP3 A;  4WNG A;  4FU3 A;  2RD0 A;  3KS2 A;  5G05 C;  3UX4 A;  4J8S A;  3D9L A;  1PAQ A;  2FF4 A;  4HLE A;  2CFU A;  4DPR A;  3ESK A;  2GGF A;  4GU5 A;  4LCT A;  1EPU A;  4DLQ A;  4GZ3 A;  4ILH B;  4R7L A;  2LNI A;  2C2L A;  1BPO A;  2IOL A;  5CCM A;  3HYM B;  4GCN A;  4G1T A;  3ZFW A;  5G55 A;  5KCM A;  1H6K A;  5J90 A;  3MKQ B;  2KM4 A;  2WXP A;  3FU0 A;  2I1K A;  3D9O A;  2XPY A;  4B89 A;  3Q47 B;  1NA3 A;  4PH4 B;  3JCK C;  2UY1 B;  4ANW A;  1KLX A;  2X6H A;  4KVM A;  4QFV A;  4ACL A;  4JZY A;  2FUL A;  2MHK A;  2WXJ A;  2GRL A;  4XZ4 A;  4G11 A;  3AS8 A;  2I1J A;  3GW4 A;  3U9W A;  2HR2 A;  2JEK A;  4AIF A;  4N3C A;  3NZS A;  3CQG B;  3RJV A;  4I2W A;  1W3B A;  4UWK A;  3EHN A;  3FTZ A;  3SI5 A;  4U0U A;  3FUI A;  3ONL A;  5FZR A;  5KJM A;  1SZ9 A;  2CG2 A;  3PRZ A;  3GZS A;  5M72 A;  3HVE A;  4I1O B;  5DBK A;  4I17 A;  4J0U A;  4N3A A;  1U3D A;  2VGX B;  4CEM A;  4N39 A;  3BG1 B;  1EF1 C;  1H2U A;  4C9B B;  1L5J A;  3EHM A;  4JEH A;  4UI9 K;  3CKB A;  4OYS A;  4HVB A;  5KJK A;  5AIJ A;  3KD7 A;  1MQS A;  2PL2 A;  3KAE A;  3LCA A;  4WWN A;  4ANV A;  5LOZ A;  3PVL A;  3U4T A;  4EPZ A;  3HDX A;  1VDY A;  4A55 A;  1DVP A;  3FUN A;  3QWV A;  4TUU A;  4Y6C A;  1E7V A;  1S0P A;  3VTX A;  1SZA A;  4D10 C;  4B8C B;  4FLB A;  4G24 A;  5JHA A;  2QY7 A;  4KZC A;  4AV7 A;  5CMW A;  2XEV A;  5FQ4 A;  3CIA A;  2KAT A;  2Y4U A;  1FVF A;  2XGO A;  3ZN3 A;  4BT8 A;  4KZ0 A;  2J4D A;  5LX8 A;  4CT0 A;  4M3O A;  4JHR A;  3CGH A;  3OAW A;  5CMY A;  3VLE A;  4EBA G;  4C0E A;  2QFC A;  3PEV B;  2L9B A;  1JUQ A;  3D3M A;  4UWL A;  3CVV A;  3S7J A;  2HYZ A;  1Z6T A;  3IHY A;  5AJD A;  1A17 A;  1OWO A;  3D9K A;  3JYS A;  5G05 J;  5A23 A;  4XKC A;  3T8M A;  4A1S A;  5ARG A;  5EX3 A;  3L54 A;  1PY1 A;  3PUK A;  4NQ0 A;  5EKQ D;  4AVX A;  1UJJ A;  2X38 A;  4LEU A;  3FDH A;  1TJC A;  2LSV A;  2R5S A;  3EIQ C;  3FUL A;  4GML A;  3ESL A;  4L2Y A;  5JJT A;  3LEW A;  1LF8 A;  2AXV A;  1UN9 A;  4XI9 A;  5AEN A;  3CQC B;  3APF A;  3CK7 A;  3QWW A;  4BX9 A;  3CVX A;  1E8Z A;  2WXQ A;  5JJ6 A;  4AP2 A;  3EJN A;  4JHJ A;  3CVY A;  3N71 A;  1GW6 A;  2VSO E;  2J09 A;  4XE0 A;  3SNX A;  2WPV A;  3QKY A;  4L2L A;  4I6G A;  1OWM A;  1JPL A;  1XGW A;  3PRE A;  4EEC A;  3IEG A;  2J08 A;  3R7R A;  1IQU A;  2L6J A;  4RG6 A;  2NSZ A;  4AM9 A;  5HQ8 A;  2Q7F A;  3RIB A;  2WQH A;  5FZS A;  2OVB A;  3PDN A;  3MZL B;  2KZT A;  2WXL A;  4UI9 J;  3U66 A;  3L17 A;  4MS6 A;  1Z3X A;  4WAF A;  1FVH A;  2NXP A;  1ZBP A;  4BSX A;  4N3B A;  3CVW A;  4IN3 B;  4BY6 A;  4JXT A;  4ME2 A;  2OND A;  2I6H A;  3LY9 A;  3D9J A;  1TEZ A;  4BTA A;  4G25 A;  3TAX A;  4F3V A;  2WXN A;  3CVN A;  4I1A A;  4U0S A;  1HZ4 A;  3LJ3 A;  5LCW C;  3FUK A;  4U04 A;  3T5V A;  2KCL A;  3PUJ A;  1EYH A;  4FAD A;  2WQ7 A;  4N2Q A;  4KMO A;  1KT1 A;  2A5U A;  3KEZ A;  2WQ6 A;  4J8D A;  4CDR A;  4ANU A;  5G2N A;  3I4G A;  5BV1 A;  3JQ1 A;  4L7T A;  3G2V A;  3CHR A;  1NZN A;  3OXF A;  4WWP A;  1OWL A;  2XHE A;  4AJW A;  5BNW A;  4NAC A;  1PC2 A;  4Q94 A;  4CDM A;  2VTB A;  2V5F A;  3B7U X;  2VYI A;  4CRW A;  2AXZ A;  3SFZ A;  3QJZ A;  4F53 A;  3FWV A;  4FJZ A;  1H2V C;  3CVQ A;  3IBE A;  5AYW D;  4GZD A;  4GA2 A;  1UG3 A;  3C98 A;  1HH8 A;  2CG3 A;  3E4B A;  4H7X A;  4UWH A;  4WNE A;  2DCP A;  2FI7 A;  4E6H A;  2R59 A;  3CK8 A;  3LYA A;  3S7D A;  3AU4 A;  4JVS A;  1ELW A;  3K9I A;  4HOU A;  5G04 J;  2DIW A;  2PQR A;  4F7A A;  3PZD A;  4H7Y A;  2HO1 A;  4I43 A;  4U07 A;  1E7U A;  2CFZ A;  2WMN A;  5J08 A;  3PE4 A;  4B94 A;  2X6I A;  2VQ2 A;  3G2T A;  3HHM A;  4V3I A;  3LY8 A;  5LFA A;  3ENE A;  4GYO A;  4UWG A;  3FU3 A;  5ANL A;  1UJK A;  2AWI A;  2OVF A;  3FUH A;  2WXI A;  3AS5 A;  3CR3 A;  3UMV A;  3APD A;  2WB2 A;  2WXH A;  3GYZ A;  3LVQ E;  3LS8 A;  2L0T B;  4WUY A;  2I2O A;  4ACK A;  2VGY A;  2JLB A;  2FEZ A;  1YA0 A;  3EDT B;  1HU3 A;  2C0M A;  2WM9 A;  1H0A A;  1U3C A;  2CHX A;  3ZHE B;  3VTY A;  2WXG A;  2XRY A;  5FQ7 A;  1H19 A;  5T4Y A;  4DI4 A;  2I9C A;  4MRU A;  2NC9 A;  3MV3 B;  4JW1 A;  4HOT A;  3URZ A;  4EZK A;  4AEZ C;  5BT1 A;  4PS7 A;  4RSY A;  3TG5 A;  3MA5 A;  4I2Z A;  1NA0 A;  2J07 A;  2VSN A;  4XIF A;  1OUV A;  3SHF A;  4APO A;  2IF4 A;  3O48 A;  3ML8 A;  3CKC A;  3RKV A;  3RRM B;  5CCL A;  3JUI A;  3ZPJ A;  4A3V A;  3SGH A;  5LCW J;  3OTN A;  4AOF A;  3FUE A;  3Q5M A;  2X6K A;  3FH8 A;  3FUJ A;  4LER A;  3ZEF A;  4KXK B;  4CT4 A;  3PNL B;  4I6E A;  3L16 A;  3ZRH A;  1E96 B;  2XPZ A;  3L6A A;  2IFU A;  3LKU A;  4NRH B;  2YIN A;  2UY1 A;  3FU6 A;  3CLJ A;  4YVO A;  3FU5 A;  1E8X A;  1HXI A;  2KC7 A;  2X3M A;  5BPP A;  2CHW A;  4IRU A;  4L23 A;  5ENN A;  5BUZ A;  3MEK A;  4EBA A;  3D9P A;  4FHJ A;  3JQ0 A;  3WXX A;  1IHG A;  2WXO A;  2J9Q A;  4EZL A;  2A4Z A;  3CK9 A;  4F1S A;  3D9I A;  3NQP A;  3UT8 A;  3UUX A;  5KJN A;  5C1D A;  4IYP A;  3S7F A;  2XPI A;  4CGV A;  3RU0 A;  2R17 C;  4I9E A;  4KBQ A;  3CHQ A;  3O4Z A;  4GYY A;  3QNK A;  2VSX E;  1NP7 A;  3TXN A;  1HS6 A;  1QNF A;  5CHE E;  1UW4 B;  3ZYM A;  2WXK A;  2GW1 A;  5FJY A;  3SZ7 A;  4APF A;  4HXI A;  3ASF A;  4CCA A;  2IOS A;  2ION A;  2PM6 A;  2VSY A;  4K0R A;  3DBS A;  2EQX A;  2VGX A;  3ZGQ A;  3TL5 A;  3HVE B;  2GRM A;  4B8A A;  5FTP A;  3FTV A;  2MOW A;  4ILG A;  4U8H A;  2PM7 A;  4BTB A;  4RG9 A;  4FHK A;  4KT6 B;  2IQC A;  2OV8 A;  4A1G A;  2YHC A;  3Q49 B;  5BV0 A;  3IV0 A;  2PZI A;  3FUF A;  3CST A;  3P2B A;  3LVR E;  1WAO 1;  4AXH A;  1WM5 A;  4GZC A;  1ELR A;  4TRQ A;  4XX5 A;  4JA7 A;  3UPV A;  3RO3 A;  3FUD A;  2AW6 A;  3ASG A;  4FLH A;  3R7Q A;  2WVI A;  3QDN A;  5A7D B;  4DI3 A;  3CV0 A;  2YQ8 A;  5E75 A;  3RO2 A;  5DIZ A;  1INZ A;  1ELK A;  3APC A;  2FBN A;  1ZU2 A;  1HE8 A;  3RRN B;  2V8S E;  3SD5 A;  5A6C A;  4N5C A;  2PQN A;  2VJ8 A;  4GMJ A;  5EDS A;  3BG0 B;  3ZVV A;  3FH5 A;  1E90 A;  3ZIM A;  4FJY A;  4WND A;  3L22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...