2GWLA

Crystal structure of the salmonella spvb atr domain in complex with nadh
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
200
structure length
200
Chain Sequence
SKQIQALRYYSAQGYSVINKYLRGDDYPETQAKETLLSRDYLSTNEPSDEEFKNAMSVYINDIAEGLSSLPETDHRVVYRGLKLDKPALSDVLKEYTTIGNIIIDKAFMSTSPDKAWINDTILNIYLEKGHKGRILGDVAHFKGEAEMLFPPNTKLKIESIVNCGSQDFASQLSKLRLSDDATADTNRIKRIINMRVLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 65 kDa virulence protein
publication title A steric antagonism of actin polymerization by a salmonella virulence protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 61
structure length 200
sequence length 200
ec nomenclature ec 2.4.2.31: NAD(+)--protein-arginine ADP-ribosyltransferase.
pdb deposition date 2006-05-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2gwlA00
4FMLA 4PKVA 2C8EE 1YQYA 2GWMA 4XM6A 1QS1A 1UZIA 1QS2A 1OG1A 2J3VA 2WN8A 1GIQA 2J3ZA 1GZEA 1J7NA 2C8BX 1GIRA 4XSHB 5H04A 4H0YA 5H03A 2C8HA 4DV8A 2J3XA 4GY2A 2C8GA 5D1UA 1R45A 2WN6A 2C8AA 4H0TA 1ZXVA 1PWPA 2GWLA 3BUZA 4PKTA 5D1TA 4PKUA 4PKRA 4XM8A 2WN7A 4XM7A 4PKSA 2A78B 1R4BA 4FXQA 1GXZA 2WN5A 4H0VA 2C89A 5D1SA 5BWMB 4ELNA 2C8FE 3U0JA 1PWQA 3BW8A 4FK7A 4H0XA 1GY0A 5DZQA 4XSGB 4H03A 1PWWA 2A9KB 4GF1A 1OJQA 4TR5A 4PKWA 4PKQA 1OJZA 1G24A 1OG4A 1GXYA 1OG3A 1GZFA 2WN4A 2BOVB 1JKYA 5GTTA 1PWUA 1PWVA 4WF6A 2C8DA 3NTSA 2C8CA
chains in the Genus database with same CATH superfamily
4FMLA 4PKVA 2C8EE 1YQYA 2GWMA 4XM6A 1QS1A 1UZIA 1QS2A 1OG1A 2J3VA 2WN8A 1GIQA 2J3ZA 1GZEA 1J7NA 2C8BX 1GIRA 4XSHB 5H04A 4H0YA 5H03A 2C8HA 4DV8A 2J3XA 4GY2A 2C8GA 5D1UA 1R45A 2WN6A 2C8AA 4H0TA 1ZXVA 1PWPA 2GWLA 3BUZA 4PKTA 5D1TA 4PKUA 4PKRA 4XM8A 2WN7A 4XM7A 4PKSA 2A78B 1R4BA 4FXQA 1GXZA 2WN5A 4H0VA 2C89A 5D1SA 5BWMB 4ELNA 2C8FE 3U0JA 1PWQA 3BW8A 4FK7A 4H0XA 1GY0A 5DZQA 4XSGB 4H03A 1PWWA 2A9KB 4GF1A 1OJQA 4TR5A 4PKWA 4PKQA 1OJZA 1G24A 1OG4A 1GXYA 1OG3A 1GZFA 2WN4A 2BOVB 1JKYA 5GTTA 1PWUA 1PWVA 4WF6A 2C8DA 3NTSA 2C8CA
chains in the Genus database with same CATH topology
4FMLA 4PKVA 2C8EE 1YQYA 2GWMA 4XM6A 1QS1A 1UZIA 1QS2A 1OG1A 2J3VA 2WN8A 1GIQA 2J3ZA 1GZEA 1J7NA 2C8BX 1GIRA 4XSHB 5H04A 4H0YA 5H03A 2C8HA 4DV8A 2J3XA 4GY2A 2C8GA 5D1UA 1R45A 2WN6A 2C8AA 4H0TA 1ZXVA 1PWPA 2GWLA 3BUZA 4PKTA 5D1TA 4PKUA 4PKRA 4XM8A 2WN7A 4XM7A 4PKSA 2A78B 1R4BA 4FXQA 1GXZA 2WN5A 4H0VA 2C89A 5D1SA 5BWMB 4ELNA 2C8FE 3U0JA 1PWQA 3BW8A 4FK7A 4H0XA 1GY0A 5DZQA 4XSGB 4H03A 1PWWA 2A9KB 4GF1A 1OJQA 4TR5A 4PKWA 4PKQA 1OJZA 1G24A 1OG4A 1GXYA 1OG3A 1GZFA 2WN4A 2BOVB 1JKYA 5GTTA 1PWUA 1PWVA 4WF6A 2C8DA 3NTSA 2C8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FML A;  4PKV A;  2C8E E;  1YQY A;  2GWM A;  4XM6 A;  1QS1 A;  1UZI A;  1QS2 A;  1OG1 A;  2J3V A;  2WN8 A;  1GIQ A;  2J3Z A;  1GZE A;  1J7N A;  2C8B X;  1GIR A;  4XSH B;  5H04 A;  4H0Y A;  5H03 A;  2C8H A;  4DV8 A;  2J3X A;  4GY2 A;  2C8G A;  5D1U A;  1R45 A;  2WN6 A;  2C8A A;  4H0T A;  1ZXV A;  1PWP A;  2GWL A;  3BUZ A;  4PKT A;  5D1T A;  4PKU A;  4PKR A;  4XM8 A;  2WN7 A;  4XM7 A;  4PKS A;  2A78 B;  1R4B A;  4FXQ A;  1GXZ A;  2WN5 A;  4H0V A;  2C89 A;  5D1S A;  5BWM B;  4ELN A;  2C8F E;  3U0J A;  1PWQ A;  3BW8 A;  4FK7 A;  4H0X A;  1GY0 A;  5DZQ A;  4XSG B;  4H03 A;  1PWW A;  2A9K B;  4GF1 A;  1OJQ A;  4TR5 A;  4PKW A;  4PKQ A;  1OJZ A;  1G24 A;  1OG4 A;  1GXY A;  1OG3 A;  1GZF A;  2WN4 A;  2BOV B;  1JKY A;  5GTT A;  1PWU A;  1PWV A;  4WF6 A;  2C8D A;  3NTS A;  2C8C A; 
#chains in the Genus database with same CATH topology
 4FML A;  4PKV A;  2C8E E;  1YQY A;  2GWM A;  4XM6 A;  1QS1 A;  1UZI A;  1QS2 A;  1OG1 A;  2J3V A;  2WN8 A;  1GIQ A;  2J3Z A;  1GZE A;  1J7N A;  2C8B X;  1GIR A;  4XSH B;  5H04 A;  4H0Y A;  5H03 A;  2C8H A;  4DV8 A;  2J3X A;  4GY2 A;  2C8G A;  5D1U A;  1R45 A;  2WN6 A;  2C8A A;  4H0T A;  1ZXV A;  1PWP A;  2GWL A;  3BUZ A;  4PKT A;  5D1T A;  4PKU A;  4PKR A;  4XM8 A;  2WN7 A;  4XM7 A;  4PKS A;  2A78 B;  1R4B A;  4FXQ A;  1GXZ A;  2WN5 A;  4H0V A;  2C89 A;  5D1S A;  5BWM B;  4ELN A;  2C8F E;  3U0J A;  1PWQ A;  3BW8 A;  4FK7 A;  4H0X A;  1GY0 A;  5DZQ A;  4XSG B;  4H03 A;  1PWW A;  2A9K B;  4GF1 A;  1OJQ A;  4TR5 A;  4PKW A;  4PKQ A;  1OJZ A;  1G24 A;  1OG4 A;  1GXY A;  1OG3 A;  1GZF A;  2WN4 A;  2BOV B;  1JKY A;  5GTT A;  1PWU A;  1PWV A;  4WF6 A;  2C8D A;  3NTS A;  2C8C A; 
#chains in the Genus database with same CATH homology
 4FML A;  4PKV A;  2C8E E;  1YQY A;  2GWM A;  4XM6 A;  1QS1 A;  1UZI A;  1QS2 A;  1OG1 A;  2J3V A;  2WN8 A;  1GIQ A;  2J3Z A;  1GZE A;  1J7N A;  2C8B X;  1GIR A;  4XSH B;  5H04 A;  4H0Y A;  5H03 A;  2C8H A;  4DV8 A;  2J3X A;  4GY2 A;  2C8G A;  5D1U A;  1R45 A;  2WN6 A;  2C8A A;  4H0T A;  1ZXV A;  1PWP A;  2GWL A;  3BUZ A;  4PKT A;  5D1T A;  4PKU A;  4PKR A;  4XM8 A;  2WN7 A;  4XM7 A;  4PKS A;  2A78 B;  1R4B A;  4FXQ A;  1GXZ A;  2WN5 A;  4H0V A;  2C89 A;  5D1S A;  5BWM B;  4ELN A;  2C8F E;  3U0J A;  1PWQ A;  3BW8 A;  4FK7 A;  4H0X A;  1GY0 A;  5DZQ A;  4XSG B;  4H03 A;  1PWW A;  2A9K B;  4GF1 A;  1OJQ A;  4TR5 A;  4PKW A;  4PKQ A;  1OJZ A;  1G24 A;  1OG4 A;  1GXY A;  1OG3 A;  1GZF A;  2WN4 A;  2BOV B;  1JKY A;  5GTT A;  1PWU A;  1PWV A;  4WF6 A;  2C8D A;  3NTS A;  2C8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...