2GWLA

Crystal structure of the salmonella spvb atr domain in complex with nadh
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
200
structure length
200
Chain Sequence
SKQIQALRYYSAQGYSVINKYLRGDDYPETQAKETLLSRDYLSTNEPSDEEFKNAMSVYINDIAEGLSSLPETDHRVVYRGLKLDKPALSDVLKEYTTIGNIIIDKAFMSTSPDKAWINDTILNIYLEKGHKGRILGDVAHFKGEAEMLFPPNTKLKIESIVNCGSQDFASQLSKLRLSDDATADTNRIKRIINMRVLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 65 kDa virulence protein
publication title A steric antagonism of actin polymerization by a salmonella virulence protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 61
structure length 200
sequence length 200
ec nomenclature ec 2.4.2.31: NAD(+)--protein-arginine ADP-ribosyltransferase.
pdb deposition date 2006-05-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2gwlA00
5BWMB 1PWPA 2GWLA 4PKRA 2C8BX 4TR5A 2C8EE 2C8GA 4FXQA 1PWUA 2WN5A 2WN7A 1GIQA 3BW8A 4H0TA 1JKYA 4PKVA 4FMLA 4XM7A 1PWWA 2C8DA 4H0YA 4DV8A 1PWVA 1PWQA 3NTSA 1OG1A 2J3ZA 3BUZA 5GTTA 1GZEA 4GF1A 5H03A 2GWMA 1YQYA 4XSGB 2C8FE 4PKQA 4GY2A 4H0VA 2A78B 4PKTA 1GY0A 1J7NA 5H04A 2C8CA 2WN4A 1R4BA 4H03A 5DZQA 1R45A 5D1SA 5D1UA 4XM8A 4PKSA 1OJZA 1OJQA 4H0XA 4ELNA 4FK7A 2WN8A 1ZXVA 4PKUA 1GXZA 2C89A 1OG3A 2J3VA 4XSHB 4XM6A 4WF6A 1QS2A 2J3XA 1OG4A 2C8HA 4PKWA 2WN6A 3U0JA 1GZFA 1GIRA 1QS1A 1UZIA 2A9KB 1GXYA 2C8AA 5D1TA 2BOVB 1G24A
chains in the Genus database with same CATH superfamily
5BWMB 1PWPA 2GWLA 4PKRA 2C8BX 4TR5A 2C8EE 2C8GA 4FXQA 1PWUA 2WN5A 2WN7A 1GIQA 3BW8A 4H0TA 1JKYA 4PKVA 4FMLA 4XM7A 1PWWA 2C8DA 4H0YA 4DV8A 1PWVA 1PWQA 3NTSA 1OG1A 2J3ZA 3BUZA 5GTTA 1GZEA 4GF1A 5H03A 2GWMA 1YQYA 4XSGB 2C8FE 4PKQA 4GY2A 4H0VA 2A78B 4PKTA 1GY0A 1J7NA 5H04A 2C8CA 2WN4A 1R4BA 4H03A 5DZQA 1R45A 5D1SA 5D1UA 4XM8A 4PKSA 1OJZA 1OJQA 4H0XA 4ELNA 4FK7A 2WN8A 1ZXVA 4PKUA 1GXZA 2C89A 1OG3A 2J3VA 4XSHB 4XM6A 4WF6A 1QS2A 2J3XA 1OG4A 2C8HA 4PKWA 2WN6A 3U0JA 1GZFA 1GIRA 1QS1A 1UZIA 2A9KB 1GXYA 2C8AA 5D1TA 2BOVB 1G24A
chains in the Genus database with same CATH topology
5BWMB 1PWPA 2GWLA 4PKRA 2C8BX 4TR5A 2C8EE 2C8GA 4FXQA 1PWUA 2WN5A 2WN7A 1GIQA 3BW8A 4H0TA 1JKYA 4PKVA 4FMLA 4XM7A 1PWWA 2C8DA 4H0YA 4DV8A 1PWVA 1PWQA 3NTSA 1OG1A 2J3ZA 3BUZA 5GTTA 1GZEA 4GF1A 5H03A 2GWMA 1YQYA 4XSGB 2C8FE 4PKQA 4GY2A 4H0VA 2A78B 4PKTA 1GY0A 1J7NA 5H04A 2C8CA 2WN4A 1R4BA 4H03A 5DZQA 1R45A 5D1SA 5D1UA 4XM8A 4PKSA 1OJZA 1OJQA 4H0XA 4ELNA 4FK7A 2WN8A 1ZXVA 4PKUA 1GXZA 2C89A 1OG3A 2J3VA 4XSHB 4XM6A 4WF6A 1QS2A 2J3XA 1OG4A 2C8HA 4PKWA 2WN6A 3U0JA 1GZFA 1GIRA 1QS1A 1UZIA 2A9KB 1GXYA 2C8AA 5D1TA 2BOVB 1G24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BWM B;  1PWP A;  2GWL A;  4PKR A;  2C8B X;  4TR5 A;  2C8E E;  2C8G A;  4FXQ A;  1PWU A;  2WN5 A;  2WN7 A;  1GIQ A;  3BW8 A;  4H0T A;  1JKY A;  4PKV A;  4FML A;  4XM7 A;  1PWW A;  2C8D A;  4H0Y A;  4DV8 A;  1PWV A;  1PWQ A;  3NTS A;  1OG1 A;  2J3Z A;  3BUZ A;  5GTT A;  1GZE A;  4GF1 A;  5H03 A;  2GWM A;  1YQY A;  4XSG B;  2C8F E;  4PKQ A;  4GY2 A;  4H0V A;  2A78 B;  4PKT A;  1GY0 A;  1J7N A;  5H04 A;  2C8C A;  2WN4 A;  1R4B A;  4H03 A;  5DZQ A;  1R45 A;  5D1S A;  5D1U A;  4XM8 A;  4PKS A;  1OJZ A;  1OJQ A;  4H0X A;  4ELN A;  4FK7 A;  2WN8 A;  1ZXV A;  4PKU A;  1GXZ A;  2C89 A;  1OG3 A;  2J3V A;  4XSH B;  4XM6 A;  4WF6 A;  1QS2 A;  2J3X A;  1OG4 A;  2C8H A;  4PKW A;  2WN6 A;  3U0J A;  1GZF A;  1GIR A;  1QS1 A;  1UZI A;  2A9K B;  1GXY A;  2C8A A;  5D1T A;  2BOV B;  1G24 A; 
#chains in the Genus database with same CATH topology
 5BWM B;  1PWP A;  2GWL A;  4PKR A;  2C8B X;  4TR5 A;  2C8E E;  2C8G A;  4FXQ A;  1PWU A;  2WN5 A;  2WN7 A;  1GIQ A;  3BW8 A;  4H0T A;  1JKY A;  4PKV A;  4FML A;  4XM7 A;  1PWW A;  2C8D A;  4H0Y A;  4DV8 A;  1PWV A;  1PWQ A;  3NTS A;  1OG1 A;  2J3Z A;  3BUZ A;  5GTT A;  1GZE A;  4GF1 A;  5H03 A;  2GWM A;  1YQY A;  4XSG B;  2C8F E;  4PKQ A;  4GY2 A;  4H0V A;  2A78 B;  4PKT A;  1GY0 A;  1J7N A;  5H04 A;  2C8C A;  2WN4 A;  1R4B A;  4H03 A;  5DZQ A;  1R45 A;  5D1S A;  5D1U A;  4XM8 A;  4PKS A;  1OJZ A;  1OJQ A;  4H0X A;  4ELN A;  4FK7 A;  2WN8 A;  1ZXV A;  4PKU A;  1GXZ A;  2C89 A;  1OG3 A;  2J3V A;  4XSH B;  4XM6 A;  4WF6 A;  1QS2 A;  2J3X A;  1OG4 A;  2C8H A;  4PKW A;  2WN6 A;  3U0J A;  1GZF A;  1GIR A;  1QS1 A;  1UZI A;  2A9K B;  1GXY A;  2C8A A;  5D1T A;  2BOV B;  1G24 A; 
#chains in the Genus database with same CATH homology
 5BWM B;  1PWP A;  2GWL A;  4PKR A;  2C8B X;  4TR5 A;  2C8E E;  2C8G A;  4FXQ A;  1PWU A;  2WN5 A;  2WN7 A;  1GIQ A;  3BW8 A;  4H0T A;  1JKY A;  4PKV A;  4FML A;  4XM7 A;  1PWW A;  2C8D A;  4H0Y A;  4DV8 A;  1PWV A;  1PWQ A;  3NTS A;  1OG1 A;  2J3Z A;  3BUZ A;  5GTT A;  1GZE A;  4GF1 A;  5H03 A;  2GWM A;  1YQY A;  4XSG B;  2C8F E;  4PKQ A;  4GY2 A;  4H0V A;  2A78 B;  4PKT A;  1GY0 A;  1J7N A;  5H04 A;  2C8C A;  2WN4 A;  1R4B A;  4H03 A;  5DZQ A;  1R45 A;  5D1S A;  5D1U A;  4XM8 A;  4PKS A;  1OJZ A;  1OJQ A;  4H0X A;  4ELN A;  4FK7 A;  2WN8 A;  1ZXV A;  4PKU A;  1GXZ A;  2C89 A;  1OG3 A;  2J3V A;  4XSH B;  4XM6 A;  4WF6 A;  1QS2 A;  2J3X A;  1OG4 A;  2C8H A;  4PKW A;  2WN6 A;  3U0J A;  1GZF A;  1GIR A;  1QS1 A;  1UZI A;  2A9K B;  1GXY A;  2C8A A;  5D1T A;  2BOV B;  1G24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...