2GWMA

Crystal structure of the salmonella spvb atr domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
ESKQIQALRYYSAQGYSVINKYLRGDDYPETQAKETLLSRDYLSTNEPSDEEFKNAMSVYINDIAEGLSSLPETDHRVVYRGLKLDKPALSDVLKEYTTIGNIIIDKAFMSTSPDKAWINDTILNIYLEKGHKGRILGDVAHFKGEAEMLFPPNTKLKIESIVNCGSQDFASQLSKLRLSDDATADTNRIKRIINMRVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 65 kDa virulence protein
publication title A steric antagonism of actin polymerization by a salmonella virulence protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase, toxin
total genus 60
structure length 200
sequence length 200
ec nomenclature ec 2.4.2.31: NAD(+)--protein-arginine ADP-ribosyltransferase.
pdb deposition date 2006-05-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2gwmA00
1GXZA 2GWMA 5H03A 4TR5A 4PKTA 5H04A 1PWUA 4PKRA 1R45A 1JKYA 2C8GA 1R4BA 4ELNA 4XM8A 1OG1A 1UZIA 1QS2A 4FMLA 4DV8A 2J3XA 1PWVA 1GY0A 4XSGB 1GIRA 2WN8A 1OJQA 2C8DA 4H0TA 3BW8A 5BWMB 1GZFA 2C8AA 4H0XA 4PKUA 4PKSA 1GXYA 1J7NA 2A78B 3NTSA 1ZXVA 4XM7A 4XM6A 1PWWA 2WN7A 1GZEA 5D1UA 1YQYA 5GTTA 5DZQA 4H03A 2WN5A 2WN6A 1PWQA 1GIQA 4H0VA 4GF1A 4WF6A 5D1SA 2A9KB 1PWPA 2C89A 5D1TA 2C8EE 2C8CA 2J3ZA 4PKQA 2GWLA 4H0YA 2C8BX 4PKWA 2C8HA 4XSHB 3U0JA 2J3VA 4FK7A 2WN4A 2C8FE 1QS1A 4GY2A 2BOVB 4PKVA 3BUZA 1G24A 1OG4A 1OJZA 1OG3A 4FXQA
chains in the Genus database with same CATH superfamily
1GXZA 2GWMA 5H03A 4TR5A 4PKTA 5H04A 1PWUA 4PKRA 1R45A 1JKYA 2C8GA 1R4BA 4ELNA 4XM8A 1OG1A 1UZIA 1QS2A 4FMLA 4DV8A 2J3XA 1PWVA 1GY0A 4XSGB 1GIRA 2WN8A 1OJQA 2C8DA 4H0TA 3BW8A 5BWMB 1GZFA 2C8AA 4H0XA 4PKUA 4PKSA 1GXYA 1J7NA 2A78B 3NTSA 1ZXVA 4XM7A 4XM6A 1PWWA 2WN7A 1GZEA 5D1UA 1YQYA 5GTTA 5DZQA 4H03A 2WN5A 2WN6A 1PWQA 1GIQA 4H0VA 4GF1A 4WF6A 5D1SA 2A9KB 1PWPA 2C89A 5D1TA 2C8EE 2C8CA 2J3ZA 4PKQA 2GWLA 4H0YA 2C8BX 4PKWA 2C8HA 4XSHB 3U0JA 2J3VA 4FK7A 2WN4A 2C8FE 1QS1A 4GY2A 2BOVB 4PKVA 3BUZA 1G24A 1OG4A 1OJZA 1OG3A 4FXQA
chains in the Genus database with same CATH topology
1GXZA 2GWMA 5H03A 4TR5A 4PKTA 5H04A 1PWUA 4PKRA 1R45A 1JKYA 2C8GA 1R4BA 4ELNA 4XM8A 1OG1A 1UZIA 1QS2A 4FMLA 4DV8A 2J3XA 1PWVA 1GY0A 4XSGB 1GIRA 2WN8A 1OJQA 2C8DA 4H0TA 3BW8A 5BWMB 1GZFA 2C8AA 4H0XA 4PKUA 4PKSA 1GXYA 1J7NA 2A78B 3NTSA 1ZXVA 4XM7A 4XM6A 1PWWA 2WN7A 1GZEA 5D1UA 1YQYA 5GTTA 5DZQA 4H03A 2WN5A 2WN6A 1PWQA 1GIQA 4H0VA 4GF1A 4WF6A 5D1SA 2A9KB 1PWPA 2C89A 5D1TA 2C8EE 2C8CA 2J3ZA 4PKQA 2GWLA 4H0YA 2C8BX 4PKWA 2C8HA 4XSHB 3U0JA 2J3VA 4FK7A 2WN4A 2C8FE 1QS1A 4GY2A 2BOVB 4PKVA 3BUZA 1G24A 1OG4A 1OJZA 1OG3A 4FXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXZ A;  2GWM A;  5H03 A;  4TR5 A;  4PKT A;  5H04 A;  1PWU A;  4PKR A;  1R45 A;  1JKY A;  2C8G A;  1R4B A;  4ELN A;  4XM8 A;  1OG1 A;  1UZI A;  1QS2 A;  4FML A;  4DV8 A;  2J3X A;  1PWV A;  1GY0 A;  4XSG B;  1GIR A;  2WN8 A;  1OJQ A;  2C8D A;  4H0T A;  3BW8 A;  5BWM B;  1GZF A;  2C8A A;  4H0X A;  4PKU A;  4PKS A;  1GXY A;  1J7N A;  2A78 B;  3NTS A;  1ZXV A;  4XM7 A;  4XM6 A;  1PWW A;  2WN7 A;  1GZE A;  5D1U A;  1YQY A;  5GTT A;  5DZQ A;  4H03 A;  2WN5 A;  2WN6 A;  1PWQ A;  1GIQ A;  4H0V A;  4GF1 A;  4WF6 A;  5D1S A;  2A9K B;  1PWP A;  2C89 A;  5D1T A;  2C8E E;  2C8C A;  2J3Z A;  4PKQ A;  2GWL A;  4H0Y A;  2C8B X;  4PKW A;  2C8H A;  4XSH B;  3U0J A;  2J3V A;  4FK7 A;  2WN4 A;  2C8F E;  1QS1 A;  4GY2 A;  2BOV B;  4PKV A;  3BUZ A;  1G24 A;  1OG4 A;  1OJZ A;  1OG3 A;  4FXQ A; 
#chains in the Genus database with same CATH topology
 1GXZ A;  2GWM A;  5H03 A;  4TR5 A;  4PKT A;  5H04 A;  1PWU A;  4PKR A;  1R45 A;  1JKY A;  2C8G A;  1R4B A;  4ELN A;  4XM8 A;  1OG1 A;  1UZI A;  1QS2 A;  4FML A;  4DV8 A;  2J3X A;  1PWV A;  1GY0 A;  4XSG B;  1GIR A;  2WN8 A;  1OJQ A;  2C8D A;  4H0T A;  3BW8 A;  5BWM B;  1GZF A;  2C8A A;  4H0X A;  4PKU A;  4PKS A;  1GXY A;  1J7N A;  2A78 B;  3NTS A;  1ZXV A;  4XM7 A;  4XM6 A;  1PWW A;  2WN7 A;  1GZE A;  5D1U A;  1YQY A;  5GTT A;  5DZQ A;  4H03 A;  2WN5 A;  2WN6 A;  1PWQ A;  1GIQ A;  4H0V A;  4GF1 A;  4WF6 A;  5D1S A;  2A9K B;  1PWP A;  2C89 A;  5D1T A;  2C8E E;  2C8C A;  2J3Z A;  4PKQ A;  2GWL A;  4H0Y A;  2C8B X;  4PKW A;  2C8H A;  4XSH B;  3U0J A;  2J3V A;  4FK7 A;  2WN4 A;  2C8F E;  1QS1 A;  4GY2 A;  2BOV B;  4PKV A;  3BUZ A;  1G24 A;  1OG4 A;  1OJZ A;  1OG3 A;  4FXQ A; 
#chains in the Genus database with same CATH homology
 1GXZ A;  2GWM A;  5H03 A;  4TR5 A;  4PKT A;  5H04 A;  1PWU A;  4PKR A;  1R45 A;  1JKY A;  2C8G A;  1R4B A;  4ELN A;  4XM8 A;  1OG1 A;  1UZI A;  1QS2 A;  4FML A;  4DV8 A;  2J3X A;  1PWV A;  1GY0 A;  4XSG B;  1GIR A;  2WN8 A;  1OJQ A;  2C8D A;  4H0T A;  3BW8 A;  5BWM B;  1GZF A;  2C8A A;  4H0X A;  4PKU A;  4PKS A;  1GXY A;  1J7N A;  2A78 B;  3NTS A;  1ZXV A;  4XM7 A;  4XM6 A;  1PWW A;  2WN7 A;  1GZE A;  5D1U A;  1YQY A;  5GTT A;  5DZQ A;  4H03 A;  2WN5 A;  2WN6 A;  1PWQ A;  1GIQ A;  4H0V A;  4GF1 A;  4WF6 A;  5D1S A;  2A9K B;  1PWP A;  2C89 A;  5D1T A;  2C8E E;  2C8C A;  2J3Z A;  4PKQ A;  2GWL A;  4H0Y A;  2C8B X;  4PKW A;  2C8H A;  4XSH B;  3U0J A;  2J3V A;  4FK7 A;  2WN4 A;  2C8F E;  1QS1 A;  4GY2 A;  2BOV B;  4PKV A;  3BUZ A;  1G24 A;  1OG4 A;  1OJZ A;  1OG3 A;  4FXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...