2GX0A

Crystal structural and functional analysis of gfp-like fluorescent protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
218
structure length
217
Chain Sequence
SVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTTVFNRVFAKYPENIVDYFKQSFPEGYSWERSMNYEDGGICNATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVLKGDVNMALSLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHHIEIKSHDKDYSNVNLHEHAEAHSELPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fluorescent protein Dronpa
publication title Structural characterization of the photoswitchable fluorescent protein Dronpa-C62S
pubmed doi rcsb
source organism Echinophyllia sp. sc22
molecule tags Luminescent protein
total genus 60
structure length 217
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 2gx0A00
4EMQA 3CGLA 3NT3A 5FVIA 3PJBA 5H89A 3DQCA 4W6GA 2AWKA 1G7KA 4L12A 2FZUA 1XQMA 4W6IA 4DXNA 5AQBB 4W6CA 3OGOA 3SVRA 2OKYA 4W6OA 2AWLA 2Q57A 1XMZA 4W6MA 4LJBA 5HZOA 3SVNA 1YZWA 1KYPA 4ORNA 4H47A 3GL4A 4W7DA 5HBDA 5DTZA 2O24A 4H3LA 2HGYA 5LTRA 1UISA 2GW3A 3AI5A 2IOVA 4W6JA 3TMRA 2EMDA 2EMNA 3LS3A 3PJ5A 3U8CA 5DTYA 2V4EA 2YFPA 4XL5A 3U0LA 2V4EB 1MOUA 3DQMA 3WLCA 4IZNA 3DQ1A 3SG7A 2G6YA 5HZUA 2IE2A 4W73A 3DQ2A 2G3DB 4PPKA 4GOBA 4Z4MA 2ZO7A 3WLDA 3SVOA 3SSKA 2ARLA 2WURA 2YDZA 5DRFA 3SRYA 1W7SA 4N3DA 4ANJA 5EXCI 4KW4A 2GX2A 3UG0A 3EK7A 5DQBA 4DKNA 3SVDA 2DUGA 3H1RA 3NEZA 5T3IA 3O77A 2RH7A 5FHVA 3KCTA 4IK5A 4AS8A 2AH8A 3E5VA 2YE0A 4W7EA 3MGFA 4ZF4A 1W7TA 4J88A 3DQLA 1EMAA 2H5OA 3G9AA 2H5PA 5DY6A 3U0MA 2VADA 4JEOA 5HZTA 4W7RA 4H3MA 1EMMA 1OXDA 4OJ0A 3RWTA 1YHHA 1Z1PA 2O29A 3E5WA 3AKOA 3H1OA 5EBJA 2Y0GA 4XOVA 3DQ8A 3SSYA 3V3DA 4W76A 2G2SB 2GW4B 2ICRA 3DQUA 2OTEA 3TMTA 2Z6ZA 4JRBA 4KEXA 3DQHA 4B30A 3SVSA 1MYWA 1ZGOA 1JBZA 3SVBA 4B30B 2QRFA 1QYFA 3OSRA 3LVCA 3I19A 3GB3A 3IP2A 2YE1A 4HQ9A 2A50B 5BQLA 1GL4A 2A54B 1EMLA 3DQJA 2A53B 2OTBA 3NF0A 2GX0A 3LVDA 1F0BA 1B9CA 2QT2A 2A48A 4P76A 2H5QA 4R6BA 5HZSA 4EDOA 1ZGQA 2OGRA 4ZIOA 1OXEA 3DQAA 1KP5A 2A56B 2A52B 3LA1A 4DXPA 4ZB1A 3AI4A 2G6XA 5LTPA 2PXSA 4W75A 2WISA 4KAGA 1Z1QA 3VHTA 4DXQA 2C9JA 1EMBA 2EMOA 4U2VA 3VHTB 1Q73A 3GJ1A 2HPWA 3SVUA 4OQWA 2ZMWA 3A8SA 3EK4A 3EKJA 4I2YA 3KCSA 1GFLA 1ZUXA 5DPGA 4OGSA 4KF5C 3LSAA 3SG4A 2Q6PA 4W7FA 5LK4A 1XA9A 2VAEA 2Z1OA 4Q7RA 2B3QA 2DUFA 3DQ3A 3P8UA 3RWAA 5DTLA 2DUEA 2H5RA 2Z6YA 4W69A 2WSNA 3ZUJA 5J2OA 3DQKA 4W6KA 3SSPA 4J89A 4OHSA 3DQDA 5HW9A 1YFPA 3S05A 2O2BA 3LF4B 1RMMA 1YHGA 1QYOA 3SV5A 5KTGA 4EULA 3ZULA 3PJ7A 1Q4AA 4GESB 3SSHA 1XSSA 3IR8A 5DRGA 5EB6A 1RRXA 4KGFA 2POXA 1OXFA 1MOVA 2VZXA 2G3OA 4W7XA 2IB6A 4NWSA 2G6EA 4XGYA 4AR7A 3DQOA 3DQ5A 2AWMA 1EMCA 4LW5A 1BFPA 1HUYA 1EMKA 1JC1A 3SG5A 4KGEA 4DXIA 2JADA 2QLGA 3CFFA 4R6DA 2DDCA 2HQKA 3CD9A 4OY4A 5DPJA 2WHTA 2DDDA 2QLGB 3DPXA 3DQIA 2OKWA 1Q4DA 3SS0A 2ZMUA 2P4MA 4JF9A 5DPIA 4Z4KA 1JBYA 3NEDA 2A47A 4UTSA 3DQ7A 3ST4A 1EMFA 2HCGA 3CD1A 2WIQA 2QZ0A 4W6UA 4DXMA 5DQMA 4DXOA 5LTQA 2WSOA 3LF3A 4HE4A 3SSTA 3BX9A 3CB9A 3BXBA 4L1IA 2VVIA 1Q4EA 4XVPA 3SG2A 2IB5A 4KW9A 4LJCA 3VICA 2HRSA 3DQEA 5DPHA 4W7AA 3DPZA 4P1QA 4KF5A 4PFEA 2HFCA 3DPWA 3GEXA 2QLHA 2WHSA 4Q9WA 3M24A 4W6DA 2H6VA 4TZAA 2OJKA 3EVUA 5DTXA 3SG3A 4W72A 4LJDC 4W6PA 4JC2A 4H3NA 5EXBA 4TZGA 5HGEA 2C9IA 4LQTA 1H6RA 3U8PA 1YHIA 1CV7A 4HVFA 4L13A 3K1KA 4PPJA 5BT0A 4RYSA 4W6TA 1QY3A 3DQ6A 3DQ4A 4KPIA 4KA9A 4KF4A 3EK8A 3SG6A 4B5YA 5DU0A 4W6FA 5H87A 2QLEA 1KYRA 3BXCA 3ZTFA 4IK1A 4W74A 4EDSA 1YJFA 5F9GA 3EVVA 3SSVA 3DQNA 4ZF3A 3CFAA 1Q4BA 3VK1A 3PIBA 4RTCA 4LQUA 2HJOA 2FWQA 4W77A 2H9WA 1HCJA 4IK9A 2AWJA 2G16B 3U8AA 3ST3A 5FVFA 2WHUA 3O78A 4H48A 4W6AA 5EHUA 2DD7A 4DKMA 2PXWA 5BTTA 2ZO6A 1EMGA 1GGXA 4JFGA 3ZUFA 5BTTB 1C4FA 4ZF5A 3DQ9A 1H4UA 1Q4CA 4W6NA 4W6SA 2VVHA 3W1DA 4IK8A 1F09A 5EB7A 3UFZA 3NT9A 4ZINA 3E5TA 3GJ2A 3U0NA 1W7UA 2Z6XA 3EVPA 3P28A 3U0KA 2V4EC 3SVEA 1YJ2A 3ST2A 1XAEA 2DUIA 1JC0A 4GF6B 2VVJA 2HGDA 4XOWA 3EKHA 1EMEA 4W6BA 5EJUA 4EN1A 3ADFA 4HQ8A 2G5ZB 3OSQA 2AHAA 3LVAA 2QLIA 2FL1A 1S6ZA 3ED8A 3CBEA 4BDUA 2QU1A 3CFHA 3ST0A 3DQFA 4LJDA 1ZGPA 3M22A 4HQCA 3SSLA 4ZBLA 1RMOA 1RM9A 5FVGA 2BTJA 4Q7TA 4JGEA 2DD9A 4IK3A 4RYWA 4IK4A 1QYQA 4Q9XA 2A46A 2H8QA 4W7CA 4ZFSA 1KYSA 4J8AA 5H88A 3SVCA 2HQZA 4W6LA 2B3PA 4W6HA 3EVRA 3BXAA 3WCKA 4W6RA 4Q7UA 3W1CA 5EXUA 1RMPA 4PPLA 2DUHA 1QXTA 4KW8A
chains in the Genus database with same CATH superfamily
4EMQA 3CGLA 3NT3A 5FVIA 3PJBA 5H89A 3DQCA 4W6GA 2AWKA 1G7KA 4L12A 2FZUA 1XQMA 4W6IA 4DXNA 5AQBB 4W6CA 3OGOA 3SVRA 2OKYA 4W6OA 2AWLA 2Q57A 1XMZA 4W6MA 4LJBA 5HZOA 3SVNA 1YZWA 1KYPA 4ORNA 4H47A 3GL4A 4W7DA 5HBDA 5DTZA 2O24A 4H3LA 2HGYA 5LTRA 1UISA 2GW3A 3AI5A 2IOVA 4W6JA 3TMRA 2EMDA 2EMNA 3LS3A 3PJ5A 3U8CA 5DTYA 2V4EA 2YFPA 4XL5A 3U0LA 2V4EB 1MOUA 3DQMA 3WLCA 4IZNA 3DQ1A 3SG7A 2G6YA 5HZUA 2IE2A 4W73A 3DQ2A 2G3DB 4PPKA 4GOBA 4Z4MA 2ZO7A 3WLDA 3SVOA 3SSKA 2ARLA 2WURA 2YDZA 5DRFA 3SRYA 1W7SA 4N3DA 4ANJA 5EXCI 4KW4A 2GX2A 3UG0A 3EK7A 5DQBA 4DKNA 3SVDA 2DUGA 3H1RA 3NEZA 5T3IA 3O77A 2RH7A 5FHVA 3KCTA 4IK5A 4AS8A 2AH8A 3E5VA 2YE0A 4W7EA 3MGFA 4ZF4A 1W7TA 4J88A 3DQLA 1EMAA 2H5OA 3G9AA 2H5PA 5DY6A 3U0MA 2VADA 4JEOA 5HZTA 4W7RA 4H3MA 1EMMA 1OXDA 4OJ0A 3RWTA 1YHHA 1Z1PA 2O29A 3E5WA 3AKOA 3H1OA 5EBJA 2Y0GA 4XOVA 3DQ8A 3SSYA 3V3DA 4W76A 2G2SB 2GW4B 2ICRA 3DQUA 2OTEA 3TMTA 2Z6ZA 4JRBA 4KEXA 3DQHA 4B30A 3SVSA 1MYWA 1ZGOA 1JBZA 3SVBA 4B30B 2QRFA 1QYFA 3OSRA 3LVCA 3I19A 3GB3A 3IP2A 2YE1A 4HQ9A 2A50B 5BQLA 1GL4A 2A54B 1EMLA 3DQJA 2A53B 2OTBA 3NF0A 2GX0A 3LVDA 1F0BA 1B9CA 2QT2A 2A48A 4P76A 2H5QA 4R6BA 5HZSA 4EDOA 1ZGQA 2OGRA 4ZIOA 1OXEA 3DQAA 1KP5A 2A56B 2A52B 3LA1A 4DXPA 4ZB1A 3AI4A 2G6XA 5LTPA 2PXSA 4W75A 2WISA 4KAGA 1Z1QA 3VHTA 4DXQA 2C9JA 1EMBA 2EMOA 4U2VA 3VHTB 1Q73A 3GJ1A 2HPWA 3SVUA 4OQWA 2ZMWA 3A8SA 3EK4A 3EKJA 4I2YA 3KCSA 1GFLA 1ZUXA 5DPGA 4OGSA 4KF5C 3LSAA 3SG4A 2Q6PA 4W7FA 5LK4A 1XA9A 2VAEA 2Z1OA 4Q7RA 2B3QA 2DUFA 3DQ3A 3P8UA 3RWAA 5DTLA 2DUEA 2H5RA 2Z6YA 4W69A 2WSNA 3ZUJA 5J2OA 3DQKA 4W6KA 3SSPA 4J89A 4OHSA 3DQDA 5HW9A 1YFPA 3S05A 2O2BA 3LF4B 1RMMA 1YHGA 1QYOA 3SV5A 5KTGA 4EULA 3ZULA 3PJ7A 1Q4AA 4GESB 3SSHA 1XSSA 3IR8A 5DRGA 5EB6A 1RRXA 4KGFA 2POXA 1OXFA 1MOVA 2VZXA 2G3OA 4W7XA 2IB6A 4NWSA 2G6EA 4XGYA 4AR7A 3DQOA 3DQ5A 2AWMA 1EMCA 4LW5A 1BFPA 1HUYA 1EMKA 1JC1A 3SG5A 4KGEA 4DXIA 2JADA 2QLGA 3CFFA 4R6DA 2DDCA 2HQKA 3CD9A 4OY4A 5DPJA 2WHTA 2DDDA 2QLGB 3DPXA 3DQIA 2OKWA 1Q4DA 3SS0A 2ZMUA 2P4MA 4JF9A 5DPIA 4Z4KA 1JBYA 3NEDA 2A47A 4UTSA 3DQ7A 3ST4A 1EMFA 2HCGA 3CD1A 2WIQA 2QZ0A 4W6UA 4DXMA 5DQMA 4DXOA 5LTQA 2WSOA 3LF3A 4HE4A 3SSTA 3BX9A 3CB9A 3BXBA 4L1IA 2VVIA 1Q4EA 4XVPA 3SG2A 2IB5A 4KW9A 4LJCA 3VICA 2HRSA 3DQEA 5DPHA 4W7AA 3DPZA 4P1QA 4KF5A 4PFEA 2HFCA 3DPWA 3GEXA 2QLHA 2WHSA 4Q9WA 3M24A 4W6DA 2H6VA 4TZAA 2OJKA 3EVUA 5DTXA 3SG3A 4W72A 4LJDC 4W6PA 4JC2A 4H3NA 5EXBA 4TZGA 5HGEA 2C9IA 4LQTA 1H6RA 3U8PA 1YHIA 1CV7A 4HVFA 4L13A 3K1KA 4PPJA 5BT0A 4RYSA 4W6TA 1QY3A 3DQ6A 3DQ4A 4KPIA 4KA9A 4KF4A 3EK8A 3SG6A 4B5YA 5DU0A 4W6FA 5H87A 2QLEA 1KYRA 3BXCA 3ZTFA 4IK1A 4W74A 4EDSA 1YJFA 5F9GA 3EVVA 3SSVA 3DQNA 4ZF3A 3CFAA 1Q4BA 3VK1A 3PIBA 4RTCA 4LQUA 2HJOA 2FWQA 4W77A 2H9WA 1HCJA 4IK9A 2AWJA 2G16B 3U8AA 3ST3A 5FVFA 2WHUA 3O78A 4H48A 4W6AA 5EHUA 2DD7A 4DKMA 2PXWA 5BTTA 2ZO6A 1EMGA 1GGXA 4JFGA 3ZUFA 5BTTB 1C4FA 4ZF5A 3DQ9A 1H4UA 1Q4CA 4W6NA 4W6SA 2VVHA 3W1DA 4IK8A 1F09A 5EB7A 3UFZA 3NT9A 4ZINA 3E5TA 3GJ2A 3U0NA 1W7UA 2Z6XA 3EVPA 3P28A 3U0KA 2V4EC 3SVEA 1YJ2A 3ST2A 1XAEA 2DUIA 1JC0A 4GF6B 2VVJA 2HGDA 4XOWA 3EKHA 1EMEA 4W6BA 5EJUA 4EN1A 3ADFA 4HQ8A 2G5ZB 3OSQA 2AHAA 3LVAA 2QLIA 2FL1A 1S6ZA 3ED8A 3CBEA 4BDUA 2QU1A 3CFHA 3ST0A 3DQFA 4LJDA 1ZGPA 3M22A 4HQCA 3SSLA 4ZBLA 1RMOA 1RM9A 5FVGA 2BTJA 4Q7TA 4JGEA 2DD9A 4IK3A 4RYWA 4IK4A 1QYQA 4Q9XA 2A46A 2H8QA 4W7CA 4ZFSA 1KYSA 4J8AA 5H88A 3SVCA 2HQZA 4W6LA 2B3PA 4W6HA 3EVRA 3BXAA 3WCKA 4W6RA 4Q7UA 3W1CA 5EXUA 1RMPA 4PPLA 2DUHA 1QXTA 4KW8A
chains in the Genus database with same CATH topology
4EMQA 3CGLA 3NT3A 5FVIA 3PJBA 5H89A 3DQCA 4W6GA 2AWKA 1G7KA 4L12A 2FZUA 1XQMA 4W6IA 4DXNA 5AQBB 4W6CA 3OGOA 3SVRA 2OKYA 4W6OA 2AWLA 2Q57A 1XMZA 4W6MA 4LJBA 5HZOA 3SVNA 1YZWA 1KYPA 4ORNA 4H47A 3GL4A 4W7DA 5HBDA 5DTZA 2O24A 4H3LA 2HGYA 5LTRA 1UISA 2GW3A 3AI5A 2IOVA 4W6JA 3TMRA 2EMDA 2EMNA 3LS3A 3PJ5A 3U8CA 5DTYA 2V4EA 2YFPA 4XL5A 3U0LA 2V4EB 1MOUA 3DQMA 3WLCA 4IZNA 3DQ1A 3SG7A 2G6YA 5HZUA 2IE2A 4W73A 3DQ2A 2G3DB 4PPKA 4GOBA 4Z4MA 2ZO7A 3WLDA 3SVOA 3SSKA 2ARLA 2WURA 2YDZA 5DRFA 3SRYA 1W7SA 4N3DA 4ANJA 5EXCI 4KW4A 2GX2A 3UG0A 3EK7A 5DQBA 4DKNA 3SVDA 2DUGA 3H1RA 3NEZA 5T3IA 3O77A 2RH7A 5FHVA 3KCTA 4IK5A 4AS8A 2AH8A 3E5VA 2YE0A 4W7EA 3MGFA 4ZF4A 1W7TA 4J88A 3DQLA 1EMAA 2H5OA 3G9AA 2H5PA 5DY6A 3U0MA 2VADA 4JEOA 5HZTA 4W7RA 4H3MA 1EMMA 1OXDA 4OJ0A 3RWTA 1YHHA 1Z1PA 2O29A 3E5WA 3AKOA 3H1OA 5EBJA 2Y0GA 4XOVA 3DQ8A 3SSYA 3V3DA 4W76A 2G2SB 2GW4B 2ICRA 3DQUA 2OTEA 3TMTA 2Z6ZA 4JRBA 4KEXA 3DQHA 4B30A 3SVSA 1MYWA 1ZGOA 1JBZA 3SVBA 4B30B 2QRFA 1QYFA 3OSRA 3LVCA 3I19A 3GB3A 3IP2A 2YE1A 4HQ9A 2A50B 5BQLA 1GL4A 2A54B 1EMLA 3DQJA 2A53B 2OTBA 3NF0A 2GX0A 3LVDA 1F0BA 1B9CA 2QT2A 2A48A 4P76A 2H5QA 4R6BA 5HZSA 4EDOA 1ZGQA 2OGRA 4ZIOA 1OXEA 3DQAA 1KP5A 2A56B 2A52B 3LA1A 4DXPA 4ZB1A 3AI4A 2G6XA 5LTPA 2PXSA 4W75A 2WISA 4KAGA 1Z1QA 3VHTA 4DXQA 2C9JA 1EMBA 2EMOA 4U2VA 3VHTB 1Q73A 3GJ1A 2HPWA 3SVUA 4OQWA 2ZMWA 3A8SA 3EK4A 3EKJA 4I2YA 3KCSA 1GFLA 1ZUXA 5DPGA 4OGSA 4KF5C 3LSAA 3SG4A 2Q6PA 4W7FA 5LK4A 1XA9A 2VAEA 2Z1OA 4Q7RA 2B3QA 2DUFA 3DQ3A 3P8UA 3RWAA 5DTLA 2DUEA 2H5RA 2Z6YA 4W69A 2WSNA 3ZUJA 5J2OA 3DQKA 4W6KA 3SSPA 4J89A 4OHSA 3DQDA 5HW9A 1YFPA 3S05A 2O2BA 3LF4B 1RMMA 1YHGA 1QYOA 3SV5A 5KTGA 4EULA 3ZULA 3PJ7A 1Q4AA 4GESB 3SSHA 1XSSA 3IR8A 5DRGA 5EB6A 1RRXA 4KGFA 2POXA 1OXFA 1MOVA 2VZXA 2G3OA 4W7XA 2IB6A 4NWSA 2G6EA 4XGYA 4AR7A 3DQOA 3DQ5A 2AWMA 1EMCA 4LW5A 1BFPA 1HUYA 1EMKA 1JC1A 3SG5A 4KGEA 4DXIA 2JADA 2QLGA 3CFFA 4R6DA 2DDCA 2HQKA 3CD9A 4OY4A 5DPJA 2WHTA 2DDDA 2QLGB 3DPXA 3DQIA 2OKWA 1Q4DA 3SS0A 2ZMUA 2P4MA 4JF9A 5DPIA 4Z4KA 1JBYA 3NEDA 2A47A 4UTSA 3DQ7A 3ST4A 1EMFA 2HCGA 3CD1A 2WIQA 2QZ0A 4W6UA 4DXMA 5DQMA 4DXOA 5LTQA 2WSOA 3LF3A 4HE4A 3SSTA 3BX9A 3CB9A 3BXBA 4L1IA 2VVIA 1Q4EA 4XVPA 3SG2A 2IB5A 4KW9A 4LJCA 3VICA 2HRSA 3DQEA 5DPHA 4W7AA 3DPZA 4P1QA 4KF5A 4PFEA 2HFCA 3DPWA 3GEXA 2QLHA 2WHSA 4Q9WA 3M24A 4W6DA 2H6VA 4TZAA 2OJKA 3EVUA 5DTXA 3SG3A 4W72A 4LJDC 4W6PA 4JC2A 4H3NA 5EXBA 4TZGA 5HGEA 2C9IA 4LQTA 1H6RA 3U8PA 1YHIA 1CV7A 4HVFA 4L13A 3K1KA 4PPJA 5BT0A 4RYSA 4W6TA 1QY3A 3DQ6A 3DQ4A 4KPIA 4KA9A 4KF4A 3EK8A 3SG6A 4B5YA 5DU0A 4W6FA 5H87A 2QLEA 1KYRA 3BXCA 3ZTFA 4IK1A 4W74A 4EDSA 1YJFA 5F9GA 3EVVA 3SSVA 3DQNA 4ZF3A 3CFAA 1Q4BA 3VK1A 3PIBA 4RTCA 4LQUA 2HJOA 2FWQA 4W77A 2H9WA 1HCJA 4IK9A 2AWJA 2G16B 3U8AA 3ST3A 5FVFA 2WHUA 3O78A 4H48A 4W6AA 5EHUA 2DD7A 4DKMA 2PXWA 5BTTA 2ZO6A 1EMGA 1GGXA 4JFGA 3ZUFA 5BTTB 1C4FA 4ZF5A 3DQ9A 1H4UA 1Q4CA 4W6NA 4W6SA 2VVHA 3W1DA 4IK8A 1F09A 5EB7A 3UFZA 3NT9A 4ZINA 3E5TA 3GJ2A 3U0NA 1W7UA 2Z6XA 3EVPA 3P28A 3U0KA 2V4EC 3SVEA 1YJ2A 3ST2A 1XAEA 2DUIA 1JC0A 4GF6B 2VVJA 2HGDA 4XOWA 3EKHA 1EMEA 4W6BA 5EJUA 4EN1A 3ADFA 4HQ8A 2G5ZB 3OSQA 2AHAA 3LVAA 2QLIA 2FL1A 1S6ZA 3ED8A 3CBEA 4BDUA 2QU1A 3CFHA 3ST0A 3DQFA 4LJDA 1ZGPA 3M22A 4HQCA 3SSLA 4ZBLA 1RMOA 1RM9A 5FVGA 2BTJA 4Q7TA 4JGEA 2DD9A 4IK3A 4RYWA 4IK4A 1QYQA 4Q9XA 2A46A 2H8QA 4W7CA 4ZFSA 1KYSA 4J8AA 5H88A 3SVCA 2HQZA 4W6LA 2B3PA 4W6HA 3EVRA 3BXAA 3WCKA 4W6RA 4Q7UA 3W1CA 5EXUA 1RMPA 4PPLA 2DUHA 1QXTA 4KW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMQ A;  3CGL A;  3NT3 A;  5FVI A;  3PJB A;  5H89 A;  3DQC A;  4W6G A;  2AWK A;  1G7K A;  4L12 A;  2FZU A;  1XQM A;  4W6I A;  4DXN A;  5AQB B;  4W6C A;  3OGO A;  3SVR A;  2OKY A;  4W6O A;  2AWL A;  2Q57 A;  1XMZ A;  4W6M A;  4LJB A;  5HZO A;  3SVN A;  1YZW A;  1KYP A;  4ORN A;  4H47 A;  3GL4 A;  4W7D A;  5HBD A;  5DTZ A;  2O24 A;  4H3L A;  2HGY A;  5LTR A;  1UIS A;  2GW3 A;  3AI5 A;  2IOV A;  4W6J A;  3TMR A;  2EMD A;  2EMN A;  3LS3 A;  3PJ5 A;  3U8C A;  5DTY A;  2V4E A;  2YFP A;  4XL5 A;  3U0L A;  2V4E B;  1MOU A;  3DQM A;  3WLC A;  4IZN A;  3DQ1 A;  3SG7 A;  2G6Y A;  5HZU A;  2IE2 A;  4W73 A;  3DQ2 A;  2G3D B;  4PPK A;  4GOB A;  4Z4M A;  2ZO7 A;  3WLD A;  3SVO A;  3SSK A;  2ARL A;  2WUR A;  2YDZ A;  5DRF A;  3SRY A;  1W7S A;  4N3D A;  4ANJ A;  5EXC I;  4KW4 A;  2GX2 A;  3UG0 A;  3EK7 A;  5DQB A;  4DKN A;  3SVD A;  2DUG A;  3H1R A;  3NEZ A;  5T3I A;  3O77 A;  2RH7 A;  5FHV A;  3KCT A;  4IK5 A;  4AS8 A;  2AH8 A;  3E5V A;  2YE0 A;  4W7E A;  3MGF A;  4ZF4 A;  1W7T A;  4J88 A;  3DQL A;  1EMA A;  2H5O A;  3G9A A;  2H5P A;  5DY6 A;  3U0M A;  2VAD A;  4JEO A;  5HZT A;  4W7R A;  4H3M A;  1EMM A;  1OXD A;  4OJ0 A;  3RWT A;  1YHH A;  1Z1P A;  2O29 A;  3E5W A;  3AKO A;  3H1O A;  5EBJ A;  2Y0G A;  4XOV A;  3DQ8 A;  3SSY A;  3V3D A;  4W76 A;  2G2S B;  2GW4 B;  2ICR A;  3DQU A;  2OTE A;  3TMT A;  2Z6Z A;  4JRB A;  4KEX A;  3DQH A;  4B30 A;  3SVS A;  1MYW A;  1ZGO A;  1JBZ A;  3SVB A;  4B30 B;  2QRF A;  1QYF A;  3OSR A;  3LVC A;  3I19 A;  3GB3 A;  3IP2 A;  2YE1 A;  4HQ9 A;  2A50 B;  5BQL A;  1GL4 A;  2A54 B;  1EML A;  3DQJ A;  2A53 B;  2OTB A;  3NF0 A;  2GX0 A;  3LVD A;  1F0B A;  1B9C A;  2QT2 A;  2A48 A;  4P76 A;  2H5Q A;  4R6B A;  5HZS A;  4EDO A;  1ZGQ A;  2OGR A;  4ZIO A;  1OXE A;  3DQA A;  1KP5 A;  2A56 B;  2A52 B;  3LA1 A;  4DXP A;  4ZB1 A;  3AI4 A;  2G6X A;  5LTP A;  2PXS A;  4W75 A;  2WIS A;  4KAG A;  1Z1Q A;  3VHT A;  4DXQ A;  2C9J A;  1EMB A;  2EMO A;  4U2V A;  3VHT B;  1Q73 A;  3GJ1 A;  2HPW A;  3SVU A;  4OQW A;  2ZMW A;  3A8S A;  3EK4 A;  3EKJ A;  4I2Y A;  3KCS A;  1GFL A;  1ZUX A;  5DPG A;  4OGS A;  4KF5 C;  3LSA A;  3SG4 A;  2Q6P A;  4W7F A;  5LK4 A;  1XA9 A;  2VAE A;  2Z1O A;  4Q7R A;  2B3Q A;  2DUF A;  3DQ3 A;  3P8U A;  3RWA A;  5DTL A;  2DUE A;  2H5R A;  2Z6Y A;  4W69 A;  2WSN A;  3ZUJ A;  5J2O A;  3DQK A;  4W6K A;  3SSP A;  4J89 A;  4OHS A;  3DQD A;  5HW9 A;  1YFP A;  3S05 A;  2O2B A;  3LF4 B;  1RMM A;  1YHG A;  1QYO A;  3SV5 A;  5KTG A;  4EUL A;  3ZUL A;  3PJ7 A;  1Q4A A;  4GES B;  3SSH A;  1XSS A;  3IR8 A;  5DRG A;  5EB6 A;  1RRX A;  4KGF A;  2POX A;  1OXF A;  1MOV A;  2VZX A;  2G3O A;  4W7X A;  2IB6 A;  4NWS A;  2G6E A;  4XGY A;  4AR7 A;  3DQO A;  3DQ5 A;  2AWM A;  1EMC A;  4LW5 A;  1BFP A;  1HUY A;  1EMK A;  1JC1 A;  3SG5 A;  4KGE A;  4DXI A;  2JAD A;  2QLG A;  3CFF A;  4R6D A;  2DDC A;  2HQK A;  3CD9 A;  4OY4 A;  5DPJ A;  2WHT A;  2DDD A;  2QLG B;  3DPX A;  3DQI A;  2OKW A;  1Q4D A;  3SS0 A;  2ZMU A;  2P4M A;  4JF9 A;  5DPI A;  4Z4K A;  1JBY A;  3NED A;  2A47 A;  4UTS A;  3DQ7 A;  3ST4 A;  1EMF A;  2HCG A;  3CD1 A;  2WIQ A;  2QZ0 A;  4W6U A;  4DXM A;  5DQM A;  4DXO A;  5LTQ A;  2WSO A;  3LF3 A;  4HE4 A;  3SST A;  3BX9 A;  3CB9 A;  3BXB A;  4L1I A;  2VVI A;  1Q4E A;  4XVP A;  3SG2 A;  2IB5 A;  4KW9 A;  4LJC A;  3VIC A;  2HRS A;  3DQE A;  5DPH A;  4W7A A;  3DPZ A;  4P1Q A;  4KF5 A;  4PFE A;  2HFC A;  3DPW A;  3GEX A;  2QLH A;  2WHS A;  4Q9W A;  3M24 A;  4W6D A;  2H6V A;  4TZA A;  2OJK A;  3EVU A;  5DTX A;  3SG3 A;  4W72 A;  4LJD C;  4W6P A;  4JC2 A;  4H3N A;  5EXB A;  4TZG A;  5HGE A;  2C9I A;  4LQT A;  1H6R A;  3U8P A;  1YHI A;  1CV7 A;  4HVF A;  4L13 A;  3K1K A;  4PPJ A;  5BT0 A;  4RYS A;  4W6T A;  1QY3 A;  3DQ6 A;  3DQ4 A;  4KPI A;  4KA9 A;  4KF4 A;  3EK8 A;  3SG6 A;  4B5Y A;  5DU0 A;  4W6F A;  5H87 A;  2QLE A;  1KYR A;  3BXC A;  3ZTF A;  4IK1 A;  4W74 A;  4EDS A;  1YJF A;  5F9G A;  3EVV A;  3SSV A;  3DQN A;  4ZF3 A;  3CFA A;  1Q4B A;  3VK1 A;  3PIB A;  4RTC A;  4LQU A;  2HJO A;  2FWQ A;  4W77 A;  2H9W A;  1HCJ A;  4IK9 A;  2AWJ A;  2G16 B;  3U8A A;  3ST3 A;  5FVF A;  2WHU A;  3O78 A;  4H48 A;  4W6A A;  5EHU A;  2DD7 A;  4DKM A;  2PXW A;  5BTT A;  2ZO6 A;  1EMG A;  1GGX A;  4JFG A;  3ZUF A;  5BTT B;  1C4F A;  4ZF5 A;  3DQ9 A;  1H4U A;  1Q4C A;  4W6N A;  4W6S A;  2VVH A;  3W1D A;  4IK8 A;  1F09 A;  5EB7 A;  3UFZ A;  3NT9 A;  4ZIN A;  3E5T A;  3GJ2 A;  3U0N A;  1W7U A;  2Z6X A;  3EVP A;  3P28 A;  3U0K A;  2V4E C;  3SVE A;  1YJ2 A;  3ST2 A;  1XAE A;  2DUI A;  1JC0 A;  4GF6 B;  2VVJ A;  2HGD A;  4XOW A;  3EKH A;  1EME A;  4W6B A;  5EJU A;  4EN1 A;  3ADF A;  4HQ8 A;  2G5Z B;  3OSQ A;  2AHA A;  3LVA A;  2QLI A;  2FL1 A;  1S6Z A;  3ED8 A;  3CBE A;  4BDU A;  2QU1 A;  3CFH A;  3ST0 A;  3DQF A;  4LJD A;  1ZGP A;  3M22 A;  4HQC A;  3SSL A;  4ZBL A;  1RMO A;  1RM9 A;  5FVG A;  2BTJ A;  4Q7T A;  4JGE A;  2DD9 A;  4IK3 A;  4RYW A;  4IK4 A;  1QYQ A;  4Q9X A;  2A46 A;  2H8Q A;  4W7C A;  4ZFS A;  1KYS A;  4J8A A;  5H88 A;  3SVC A;  2HQZ A;  4W6L A;  2B3P A;  4W6H A;  3EVR A;  3BXA A;  3WCK A;  4W6R A;  4Q7U A;  3W1C A;  5EXU A;  1RMP A;  4PPL A;  2DUH A;  1QXT A;  4KW8 A; 
#chains in the Genus database with same CATH topology
 4EMQ A;  3CGL A;  3NT3 A;  5FVI A;  3PJB A;  5H89 A;  3DQC A;  4W6G A;  2AWK A;  1G7K A;  4L12 A;  2FZU A;  1XQM A;  4W6I A;  4DXN A;  5AQB B;  4W6C A;  3OGO A;  3SVR A;  2OKY A;  4W6O A;  2AWL A;  2Q57 A;  1XMZ A;  4W6M A;  4LJB A;  5HZO A;  3SVN A;  1YZW A;  1KYP A;  4ORN A;  4H47 A;  3GL4 A;  4W7D A;  5HBD A;  5DTZ A;  2O24 A;  4H3L A;  2HGY A;  5LTR A;  1UIS A;  2GW3 A;  3AI5 A;  2IOV A;  4W6J A;  3TMR A;  2EMD A;  2EMN A;  3LS3 A;  3PJ5 A;  3U8C A;  5DTY A;  2V4E A;  2YFP A;  4XL5 A;  3U0L A;  2V4E B;  1MOU A;  3DQM A;  3WLC A;  4IZN A;  3DQ1 A;  3SG7 A;  2G6Y A;  5HZU A;  2IE2 A;  4W73 A;  3DQ2 A;  2G3D B;  4PPK A;  4GOB A;  4Z4M A;  2ZO7 A;  3WLD A;  3SVO A;  3SSK A;  2ARL A;  2WUR A;  2YDZ A;  5DRF A;  3SRY A;  1W7S A;  4N3D A;  4ANJ A;  5EXC I;  4KW4 A;  2GX2 A;  3UG0 A;  3EK7 A;  5DQB A;  4DKN A;  3SVD A;  2DUG A;  3H1R A;  3NEZ A;  5T3I A;  3O77 A;  2RH7 A;  5FHV A;  3KCT A;  4IK5 A;  4AS8 A;  2AH8 A;  3E5V A;  2YE0 A;  4W7E A;  3MGF A;  4ZF4 A;  1W7T A;  4J88 A;  3DQL A;  1EMA A;  2H5O A;  3G9A A;  2H5P A;  5DY6 A;  3U0M A;  2VAD A;  4JEO A;  5HZT A;  4W7R A;  4H3M A;  1EMM A;  1OXD A;  4OJ0 A;  3RWT A;  1YHH A;  1Z1P A;  2O29 A;  3E5W A;  3AKO A;  3H1O A;  5EBJ A;  2Y0G A;  4XOV A;  3DQ8 A;  3SSY A;  3V3D A;  4W76 A;  2G2S B;  2GW4 B;  2ICR A;  3DQU A;  2OTE A;  3TMT A;  2Z6Z A;  4JRB A;  4KEX A;  3DQH A;  4B30 A;  3SVS A;  1MYW A;  1ZGO A;  1JBZ A;  3SVB A;  4B30 B;  2QRF A;  1QYF A;  3OSR A;  3LVC A;  3I19 A;  3GB3 A;  3IP2 A;  2YE1 A;  4HQ9 A;  2A50 B;  5BQL A;  1GL4 A;  2A54 B;  1EML A;  3DQJ A;  2A53 B;  2OTB A;  3NF0 A;  2GX0 A;  3LVD A;  1F0B A;  1B9C A;  2QT2 A;  2A48 A;  4P76 A;  2H5Q A;  4R6B A;  5HZS A;  4EDO A;  1ZGQ A;  2OGR A;  4ZIO A;  1OXE A;  3DQA A;  1KP5 A;  2A56 B;  2A52 B;  3LA1 A;  4DXP A;  4ZB1 A;  3AI4 A;  2G6X A;  5LTP A;  2PXS A;  4W75 A;  2WIS A;  4KAG A;  1Z1Q A;  3VHT A;  4DXQ A;  2C9J A;  1EMB A;  2EMO A;  4U2V A;  3VHT B;  1Q73 A;  3GJ1 A;  2HPW A;  3SVU A;  4OQW A;  2ZMW A;  3A8S A;  3EK4 A;  3EKJ A;  4I2Y A;  3KCS A;  1GFL A;  1ZUX A;  5DPG A;  4OGS A;  4KF5 C;  3LSA A;  3SG4 A;  2Q6P A;  4W7F A;  5LK4 A;  1XA9 A;  2VAE A;  2Z1O A;  4Q7R A;  2B3Q A;  2DUF A;  3DQ3 A;  3P8U A;  3RWA A;  5DTL A;  2DUE A;  2H5R A;  2Z6Y A;  4W69 A;  2WSN A;  3ZUJ A;  5J2O A;  3DQK A;  4W6K A;  3SSP A;  4J89 A;  4OHS A;  3DQD A;  5HW9 A;  1YFP A;  3S05 A;  2O2B A;  3LF4 B;  1RMM A;  1YHG A;  1QYO A;  3SV5 A;  5KTG A;  4EUL A;  3ZUL A;  3PJ7 A;  1Q4A A;  4GES B;  3SSH A;  1XSS A;  3IR8 A;  5DRG A;  5EB6 A;  1RRX A;  4KGF A;  2POX A;  1OXF A;  1MOV A;  2VZX A;  2G3O A;  4W7X A;  2IB6 A;  4NWS A;  2G6E A;  4XGY A;  4AR7 A;  3DQO A;  3DQ5 A;  2AWM A;  1EMC A;  4LW5 A;  1BFP A;  1HUY A;  1EMK A;  1JC1 A;  3SG5 A;  4KGE A;  4DXI A;  2JAD A;  2QLG A;  3CFF A;  4R6D A;  2DDC A;  2HQK A;  3CD9 A;  4OY4 A;  5DPJ A;  2WHT A;  2DDD A;  2QLG B;  3DPX A;  3DQI A;  2OKW A;  1Q4D A;  3SS0 A;  2ZMU A;  2P4M A;  4JF9 A;  5DPI A;  4Z4K A;  1JBY A;  3NED A;  2A47 A;  4UTS A;  3DQ7 A;  3ST4 A;  1EMF A;  2HCG A;  3CD1 A;  2WIQ A;  2QZ0 A;  4W6U A;  4DXM A;  5DQM A;  4DXO A;  5LTQ A;  2WSO A;  3LF3 A;  4HE4 A;  3SST A;  3BX9 A;  3CB9 A;  3BXB A;  4L1I A;  2VVI A;  1Q4E A;  4XVP A;  3SG2 A;  2IB5 A;  4KW9 A;  4LJC A;  3VIC A;  2HRS A;  3DQE A;  5DPH A;  4W7A A;  3DPZ A;  4P1Q A;  4KF5 A;  4PFE A;  2HFC A;  3DPW A;  3GEX A;  2QLH A;  2WHS A;  4Q9W A;  3M24 A;  4W6D A;  2H6V A;  4TZA A;  2OJK A;  3EVU A;  5DTX A;  3SG3 A;  4W72 A;  4LJD C;  4W6P A;  4JC2 A;  4H3N A;  5EXB A;  4TZG A;  5HGE A;  2C9I A;  4LQT A;  1H6R A;  3U8P A;  1YHI A;  1CV7 A;  4HVF A;  4L13 A;  3K1K A;  4PPJ A;  5BT0 A;  4RYS A;  4W6T A;  1QY3 A;  3DQ6 A;  3DQ4 A;  4KPI A;  4KA9 A;  4KF4 A;  3EK8 A;  3SG6 A;  4B5Y A;  5DU0 A;  4W6F A;  5H87 A;  2QLE A;  1KYR A;  3BXC A;  3ZTF A;  4IK1 A;  4W74 A;  4EDS A;  1YJF A;  5F9G A;  3EVV A;  3SSV A;  3DQN A;  4ZF3 A;  3CFA A;  1Q4B A;  3VK1 A;  3PIB A;  4RTC A;  4LQU A;  2HJO A;  2FWQ A;  4W77 A;  2H9W A;  1HCJ A;  4IK9 A;  2AWJ A;  2G16 B;  3U8A A;  3ST3 A;  5FVF A;  2WHU A;  3O78 A;  4H48 A;  4W6A A;  5EHU A;  2DD7 A;  4DKM A;  2PXW A;  5BTT A;  2ZO6 A;  1EMG A;  1GGX A;  4JFG A;  3ZUF A;  5BTT B;  1C4F A;  4ZF5 A;  3DQ9 A;  1H4U A;  1Q4C A;  4W6N A;  4W6S A;  2VVH A;  3W1D A;  4IK8 A;  1F09 A;  5EB7 A;  3UFZ A;  3NT9 A;  4ZIN A;  3E5T A;  3GJ2 A;  3U0N A;  1W7U A;  2Z6X A;  3EVP A;  3P28 A;  3U0K A;  2V4E C;  3SVE A;  1YJ2 A;  3ST2 A;  1XAE A;  2DUI A;  1JC0 A;  4GF6 B;  2VVJ A;  2HGD A;  4XOW A;  3EKH A;  1EME A;  4W6B A;  5EJU A;  4EN1 A;  3ADF A;  4HQ8 A;  2G5Z B;  3OSQ A;  2AHA A;  3LVA A;  2QLI A;  2FL1 A;  1S6Z A;  3ED8 A;  3CBE A;  4BDU A;  2QU1 A;  3CFH A;  3ST0 A;  3DQF A;  4LJD A;  1ZGP A;  3M22 A;  4HQC A;  3SSL A;  4ZBL A;  1RMO A;  1RM9 A;  5FVG A;  2BTJ A;  4Q7T A;  4JGE A;  2DD9 A;  4IK3 A;  4RYW A;  4IK4 A;  1QYQ A;  4Q9X A;  2A46 A;  2H8Q A;  4W7C A;  4ZFS A;  1KYS A;  4J8A A;  5H88 A;  3SVC A;  2HQZ A;  4W6L A;  2B3P A;  4W6H A;  3EVR A;  3BXA A;  3WCK A;  4W6R A;  4Q7U A;  3W1C A;  5EXU A;  1RMP A;  4PPL A;  2DUH A;  1QXT A;  4KW8 A; 
#chains in the Genus database with same CATH homology
 4EMQ A;  3CGL A;  3NT3 A;  5FVI A;  3PJB A;  5H89 A;  3DQC A;  4W6G A;  2AWK A;  1G7K A;  4L12 A;  2FZU A;  1XQM A;  4W6I A;  4DXN A;  5AQB B;  4W6C A;  3OGO A;  3SVR A;  2OKY A;  4W6O A;  2AWL A;  2Q57 A;  1XMZ A;  4W6M A;  4LJB A;  5HZO A;  3SVN A;  1YZW A;  1KYP A;  4ORN A;  4H47 A;  3GL4 A;  4W7D A;  5HBD A;  5DTZ A;  2O24 A;  4H3L A;  2HGY A;  5LTR A;  1UIS A;  2GW3 A;  3AI5 A;  2IOV A;  4W6J A;  3TMR A;  2EMD A;  2EMN A;  3LS3 A;  3PJ5 A;  3U8C A;  5DTY A;  2V4E A;  2YFP A;  4XL5 A;  3U0L A;  2V4E B;  1MOU A;  3DQM A;  3WLC A;  4IZN A;  3DQ1 A;  3SG7 A;  2G6Y A;  5HZU A;  2IE2 A;  4W73 A;  3DQ2 A;  2G3D B;  4PPK A;  4GOB A;  4Z4M A;  2ZO7 A;  3WLD A;  3SVO A;  3SSK A;  2ARL A;  2WUR A;  2YDZ A;  5DRF A;  3SRY A;  1W7S A;  4N3D A;  4ANJ A;  5EXC I;  4KW4 A;  2GX2 A;  3UG0 A;  3EK7 A;  5DQB A;  4DKN A;  3SVD A;  2DUG A;  3H1R A;  3NEZ A;  5T3I A;  3O77 A;  2RH7 A;  5FHV A;  3KCT A;  4IK5 A;  4AS8 A;  2AH8 A;  3E5V A;  2YE0 A;  4W7E A;  3MGF A;  4ZF4 A;  1W7T A;  4J88 A;  3DQL A;  1EMA A;  2H5O A;  3G9A A;  2H5P A;  5DY6 A;  3U0M A;  2VAD A;  4JEO A;  5HZT A;  4W7R A;  4H3M A;  1EMM A;  1OXD A;  4OJ0 A;  3RWT A;  1YHH A;  1Z1P A;  2O29 A;  3E5W A;  3AKO A;  3H1O A;  5EBJ A;  2Y0G A;  4XOV A;  3DQ8 A;  3SSY A;  3V3D A;  4W76 A;  2G2S B;  2GW4 B;  2ICR A;  3DQU A;  2OTE A;  3TMT A;  2Z6Z A;  4JRB A;  4KEX A;  3DQH A;  4B30 A;  3SVS A;  1MYW A;  1ZGO A;  1JBZ A;  3SVB A;  4B30 B;  2QRF A;  1QYF A;  3OSR A;  3LVC A;  3I19 A;  3GB3 A;  3IP2 A;  2YE1 A;  4HQ9 A;  2A50 B;  5BQL A;  1GL4 A;  2A54 B;  1EML A;  3DQJ A;  2A53 B;  2OTB A;  3NF0 A;  2GX0 A;  3LVD A;  1F0B A;  1B9C A;  2QT2 A;  2A48 A;  4P76 A;  2H5Q A;  4R6B A;  5HZS A;  4EDO A;  1ZGQ A;  2OGR A;  4ZIO A;  1OXE A;  3DQA A;  1KP5 A;  2A56 B;  2A52 B;  3LA1 A;  4DXP A;  4ZB1 A;  3AI4 A;  2G6X A;  5LTP A;  2PXS A;  4W75 A;  2WIS A;  4KAG A;  1Z1Q A;  3VHT A;  4DXQ A;  2C9J A;  1EMB A;  2EMO A;  4U2V A;  3VHT B;  1Q73 A;  3GJ1 A;  2HPW A;  3SVU A;  4OQW A;  2ZMW A;  3A8S A;  3EK4 A;  3EKJ A;  4I2Y A;  3KCS A;  1GFL A;  1ZUX A;  5DPG A;  4OGS A;  4KF5 C;  3LSA A;  3SG4 A;  2Q6P A;  4W7F A;  5LK4 A;  1XA9 A;  2VAE A;  2Z1O A;  4Q7R A;  2B3Q A;  2DUF A;  3DQ3 A;  3P8U A;  3RWA A;  5DTL A;  2DUE A;  2H5R A;  2Z6Y A;  4W69 A;  2WSN A;  3ZUJ A;  5J2O A;  3DQK A;  4W6K A;  3SSP A;  4J89 A;  4OHS A;  3DQD A;  5HW9 A;  1YFP A;  3S05 A;  2O2B A;  3LF4 B;  1RMM A;  1YHG A;  1QYO A;  3SV5 A;  5KTG A;  4EUL A;  3ZUL A;  3PJ7 A;  1Q4A A;  4GES B;  3SSH A;  1XSS A;  3IR8 A;  5DRG A;  5EB6 A;  1RRX A;  4KGF A;  2POX A;  1OXF A;  1MOV A;  2VZX A;  2G3O A;  4W7X A;  2IB6 A;  4NWS A;  2G6E A;  4XGY A;  4AR7 A;  3DQO A;  3DQ5 A;  2AWM A;  1EMC A;  4LW5 A;  1BFP A;  1HUY A;  1EMK A;  1JC1 A;  3SG5 A;  4KGE A;  4DXI A;  2JAD A;  2QLG A;  3CFF A;  4R6D A;  2DDC A;  2HQK A;  3CD9 A;  4OY4 A;  5DPJ A;  2WHT A;  2DDD A;  2QLG B;  3DPX A;  3DQI A;  2OKW A;  1Q4D A;  3SS0 A;  2ZMU A;  2P4M A;  4JF9 A;  5DPI A;  4Z4K A;  1JBY A;  3NED A;  2A47 A;  4UTS A;  3DQ7 A;  3ST4 A;  1EMF A;  2HCG A;  3CD1 A;  2WIQ A;  2QZ0 A;  4W6U A;  4DXM A;  5DQM A;  4DXO A;  5LTQ A;  2WSO A;  3LF3 A;  4HE4 A;  3SST A;  3BX9 A;  3CB9 A;  3BXB A;  4L1I A;  2VVI A;  1Q4E A;  4XVP A;  3SG2 A;  2IB5 A;  4KW9 A;  4LJC A;  3VIC A;  2HRS A;  3DQE A;  5DPH A;  4W7A A;  3DPZ A;  4P1Q A;  4KF5 A;  4PFE A;  2HFC A;  3DPW A;  3GEX A;  2QLH A;  2WHS A;  4Q9W A;  3M24 A;  4W6D A;  2H6V A;  4TZA A;  2OJK A;  3EVU A;  5DTX A;  3SG3 A;  4W72 A;  4LJD C;  4W6P A;  4JC2 A;  4H3N A;  5EXB A;  4TZG A;  5HGE A;  2C9I A;  4LQT A;  1H6R A;  3U8P A;  1YHI A;  1CV7 A;  4HVF A;  4L13 A;  3K1K A;  4PPJ A;  5BT0 A;  4RYS A;  4W6T A;  1QY3 A;  3DQ6 A;  3DQ4 A;  4KPI A;  4KA9 A;  4KF4 A;  3EK8 A;  3SG6 A;  4B5Y A;  5DU0 A;  4W6F A;  5H87 A;  2QLE A;  1KYR A;  3BXC A;  3ZTF A;  4IK1 A;  4W74 A;  4EDS A;  1YJF A;  5F9G A;  3EVV A;  3SSV A;  3DQN A;  4ZF3 A;  3CFA A;  1Q4B A;  3VK1 A;  3PIB A;  4RTC A;  4LQU A;  2HJO A;  2FWQ A;  4W77 A;  2H9W A;  1HCJ A;  4IK9 A;  2AWJ A;  2G16 B;  3U8A A;  3ST3 A;  5FVF A;  2WHU A;  3O78 A;  4H48 A;  4W6A A;  5EHU A;  2DD7 A;  4DKM A;  2PXW A;  5BTT A;  2ZO6 A;  1EMG A;  1GGX A;  4JFG A;  3ZUF A;  5BTT B;  1C4F A;  4ZF5 A;  3DQ9 A;  1H4U A;  1Q4C A;  4W6N A;  4W6S A;  2VVH A;  3W1D A;  4IK8 A;  1F09 A;  5EB7 A;  3UFZ A;  3NT9 A;  4ZIN A;  3E5T A;  3GJ2 A;  3U0N A;  1W7U A;  2Z6X A;  3EVP A;  3P28 A;  3U0K A;  2V4E C;  3SVE A;  1YJ2 A;  3ST2 A;  1XAE A;  2DUI A;  1JC0 A;  4GF6 B;  2VVJ A;  2HGD A;  4XOW A;  3EKH A;  1EME A;  4W6B A;  5EJU A;  4EN1 A;  3ADF A;  4HQ8 A;  2G5Z B;  3OSQ A;  2AHA A;  3LVA A;  2QLI A;  2FL1 A;  1S6Z A;  3ED8 A;  3CBE A;  4BDU A;  2QU1 A;  3CFH A;  3ST0 A;  3DQF A;  4LJD A;  1ZGP A;  3M22 A;  4HQC A;  3SSL A;  4ZBL A;  1RMO A;  1RM9 A;  5FVG A;  2BTJ A;  4Q7T A;  4JGE A;  2DD9 A;  4IK3 A;  4RYW A;  4IK4 A;  1QYQ A;  4Q9X A;  2A46 A;  2H8Q A;  4W7C A;  4ZFS A;  1KYS A;  4J8A A;  5H88 A;  3SVC A;  2HQZ A;  4W6L A;  2B3P A;  4W6H A;  3EVR A;  3BXA A;  3WCK A;  4W6R A;  4Q7U A;  3W1C A;  5EXU A;  1RMP A;  4PPL A;  2DUH A;  1QXT A;  4KW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...