2GX4A

Crystal structure of sars coronavirus 3cl protease inhibitor complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
306
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
molecule tags Hydrolase
source organism Sars coronavirus
publication title Structure-based design of SARS coronavirus 3CL protease inhibitor with potent anti_viral activities
rcsb
total genus 84
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2gx4A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gx4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gx4A02
1EATA 2R3YA 2BD8A 2XBYA 1A0LA 1MZDA 2BVSH 3DUXH 5JYIA 1QJ7B 2IPHA 1KSNA 4Y7BA 1FN6A 3IWMA 1ANDA 1GVLA 1O2XA 1K9OE 1ZYOA 2CV3A 3KL6A 1GJ7B 2ZP0H 3LGVA 1IQGA 3MH6A 2A31A 1GG6C 2W5EA 2THFB 2D8WA 4DVAU 1TBZH 1QNJA 2HVXA 1HAVA 3P8OA 5DKMA 1IQJA 1SQOA 1BHXF 2FZZA 4X8UH 3G01A 5FPTA 4X1NU 1Y3UA 1ELVA 4CBOA 1JRSA 3LGYA 2GKVE 5A2MH 1XMNB 1PPZA 3URCA 5EODA 3LONA 3RXJA 4X2YA 4ABBA 1XXFA 4XBCA 4MPXA 1IQLA 3T26A 2BX4A 2JETC 4Z0KA 3R3GB 1WU1A 5EQRA 5C5OA 2WPJS 1O2RA 2UUJB 1OYTH 1MKWH 1ORFA 2F83A 5BPEA 1O2SA 2VH0A 3MOCA 1H8DH 3FAOA 1Q3XA 4WXIA 1SHHB 1DXWA 1TRNA 1ZLRA 1G3BA 2AGEX 5LPFA 3D62A 1HV7A 1MTNC 1K1OA 1P3CA 2BD3A 2P95A 1ZHRA 4AFSA 3RM0H 2YNBA 2H9HA 1GL1A 5EG4A 1BJUA 1N8OB 4D8NA 5EXMA 4Y8XA 4WMDA 2CJIA 4A1XA 2ZGXH 4NZLA 2C93B 3DFJA 1XUHA 4ZH8A 3ITIA 1SFIA 1TRYA 4RSPA 2J94A 3GCNA 3EA9A 4FVBA 3BTTE 1YP9A 3A89A 2VNTA 1EPTA 2K1QA 4OS7A 3PLKA 2HLCA 1C1MA 2DUCA 1O31A 4R0IA 1ZPBA 2VINA 1TWXB 4GPGA 1HXFH 3VB4A 1S6FA 4OS4A 1P10A 1RGQA 1MKWK 1AVXA 4INHA 2BOKA 2ZQ1A 4YLUA 4HGCA 3QN7A 1P06A 5C3NA 2ZGHA 2HOBA 3E0PB 2XCFA 3ATKA 3E3TA 2C8XB 3PYHA 5H4IB 1O2GH 1S6HA 2A4OA 3BG8A 1FAXA 1OP0A 2EEKA 2EI6A 2ZDKA 1SPJA 1UTJA 1ID5H 3MYWA 1SFQB 2AGIX 2LNCA 1NFXA 2A4RA 1S0RA 3P8GA 1EB1H 3TH2H 1ELEE 1DPOA 1NT1A 1TPOA 3SJKA 1FDPA 2ZIQH 5FCRA 3VPKA 2BDAA 1L2EA 7GCHF 2PKSB 1PPCE 1K21H 4E05H 1SMFE 1GBFA 3KQEA 1C1TA 2Q6GA 1P05A 3LGUA 3Q00A 2A45B 1ZMLA 2ANYA 1D3DB 5T6GA 2A4GA 2R0KA 3GYLB 1WBGB 2SFAA 1C1UH 1F5LA 2ZTYA 1Z6EA 2J9NA 2HNTE 5FBIA 4H6SB 2V35A 3OY6U 1GMDF 2PTCE 1GI2A 1BTHH 4ISIH 1IOEA 1H9IE 1GJ9B 3ELAH 5JDUB 1NM6A 3MNCA 4OS1A 2NWNA 1UTQA 2RA0A 2B0FA 1GI1A 1V2ST 1GDNA 5LH8A 3H5CB 5JBTA 4K5ZA 1ZHPA 1P03A 2V3OH 1O3FA 3PROA 1RTKA 4ABJA 1CA0C 4JZFH 3O8BA 3CS0A 3A7WA 3LPRA 1Y59T 1MCTA 2HRVA 1A3BH 4INLA 5EPNA 1O5GH 1P11E 3QTVH 4UFDH 4CREA 3TJNA 3LU9B 3QO6A 2UUYA 1DWDH 5C20A 4FUGA 1EJAA 1T31A 2KAIA 3M36A 1G30B 1UCYE 1DE7H 4KTUA 2BD9A 1Y8TA 1CSOE 2BQWB 3OYPA 4O3UA 2AMQA 1ZTJA 1WTGH 1C2DA 1SOTA 4DIIH 2OC0A 2VU8E 1AI8H 2FODA 1NU9A 4LK4A 3KN2A 4NIWA 3B8JA 3A7YA 6CHAB 4BAOB 1N8OC 2GDEH 5T6FA 2RCEA 3JZ1B 3RMLH 2FPZA 2FS8A 1C5TA 1XUFA 2Y80A 2ZDAH 1YPHC 4JK5A 1HAPH 2HWLB 2ZPRA 2H5DA 1V2PT 3SU2A 1CHOF 1O32A 1GG6B 3RU4D 1O2KA 4BTUB 1GJDB 4A1VA 4A6LA 4IGDA 1S0QA 1C5VA 3ZVGA 4ISHH 5L2ZH 3PWCA 3NXPA 1TGNA 2XCNA 3BTHE 3V3MA 1VCPA 2F9PA 4IN1A 2GZ8A 1A5IA 1ZGVA 1LQEA 3SU4A 1S5SA 1TA6A 2ZHEH 1HDTH 3GY8A 4DURA 5L2YH 1KY9A 1THRH 1YCPK 3RXGA 3OX7U 3SV2H 1CU1A 4BAHB 2J34A 4ABGA 4CR5A 1GI4A 2ANKH 1JOUB 1FZZA 2OBQA 3F9HA 1YBWA 1KLIH 1BUIA 2C8YB 4I8LA 1P04A 3PMBB 3AAVA 1TNGA 1QRXA 1O2IA 1PYTC 4H6TA 4IW4E 1D9IA 4JMYA 4B75A 4BNRA 1MBQA 2FDAA 1IHTH 2ZFSA 2PSYA 2Z9JA 1UCYH 2Z6BD 2PKAA 3UR6A 5GDSH 4MNWA 1GBMA 4MVNA 3A86A 1Q31A 1XUGA 1ZMNA 1BQYA 1OWDA 5CHAB 2GCHG 1BRAA 3TLOA 3SNAA 1NESE 2PW8H 5HYOA 4Q2KA 1EZUC 1O2UA 3EDXB 1TOMH 2FXRA 1AD8H 2W3KA 3QLPH 1WOFA 1O5AB 3HPTB 1BOQA 1KYNA 5T3HA 2VGCC 3UTUH 1C2KA 3E16B 4MNVA 4OS6A 4M7GA 1AFEH 4UFEH 1BRBE 1PFXC 4I33A 3LT3A 3A7XA 2BDIA 2J38A 4CRDA 1DM4B 1NFUA 4B2CA 4DT7B 5HGGA 1SC8U 1LPZB 2VIPA 3F9EA 1GJCB 1CHOG 2GT7A 2PR3A 1EAIA 3GCTF 5A0BA 1BTXA 3TNTA 4AN7A 4E7RG 3UUZA 3SGBE 2F9BH 4K60A 1BMNH 1OS8A 3LC3A 3UQOA 2AH4X 3DT0H 1K1PA 4QT8C 1AGJA 4SGBE 3V7TA 4FUJA 2ZG0H 2A0QB 2SGAA 3U1JB 3UIRA 1O3GA 1WQSA 1FPCH 1QJ1B 5CE1A 4CH2B 1V2TT 2ZU2A 4KKDA 1L1JA 2GD4B 1NRSH 1K1LA 1ESBA 2UUFB 3SV8A 1GI7B 2TGAA 1OWKA 2HNTF 3D65E 1HAZB 2VVUA 2PUXB 2ZHQH 4UDWH 1AWHB 1QRWA 1K1IA 3RXOA 1ELAA 4BTTB 1MUEB 5F6MA 1C2JA 1NROH 1QL8A 1YF4A 1Z7KA 4NSVA 3RU4T 2TGDA 3JZ2B 5DK1A 1GBDA 2PUQH 2ZEBA 2F9OA 4X1SU 4YT7H 1SL3A 4HZHA 1P0SH 4NIVA 2UWPA 1NY22 1SLWB 4WH8A 4WY3A 1P2OA 2ZC9H 3UR9A 2P94A 1FAKH 1HIAB 3U8OH 4GHTA 1P2JA 3FZDA 1MAYA 3RXKA 1AUTC 3HKJB 2C8WB 2FYRA 1YLDA 2SGDE 1C5SA 3ZZ5A 2SGPE 1GBKA 1O2WA 2AMDA 2BY8X 1JRTA 3FP6E 2HNTC 1GHZA 3TVJB 2ZDNA 3SNBA 2OLGA 1RTFB 1TPPA 3SUDA 2ZQ2A 6GCHF 1ETSH 1MZAA 1TLDA 3ESTA 3E1XB 1TNIA 3ENSB 1W10U 4ABDA 1JXPA 4XOJA 1O0DH 1EZSC 4BAKB 2Q1JA 1A3EH 1C2EA 3O8RA 4RKOB 1N1LA 4K1TA 2YOLA 3T28A 1ELBA 2WUBA 2PKSC 2QGRA 3LC5A 4CHAC 1BT7A 1XUKA 2ANWA 2SNWA 4B76A 2QC2A 3MU5A 3ZVBA 1MCVA 1C2GA 1ZRKA 3UNQA 3ZZDA 2GMTB 2R2WU 1ZTLA 1NFWA 4AYYB 5J4SA 2ZU5A 1HLTH 1GI5A 4ISOA 1DXPA 3MNBA 2O8WA 1MTUA 5JBAS 2F9UA 4ABAA 4JZ1A 4JZDH 3ZV8A 1C9TA 3MFJA 1L4DA 1W12U 3GY4A 2ZDVH 4DOQA 4ZHLU 1H9LB 3PMJA 4B2AA 3TK5A 1HPGA 1T8MA 5DP8A 4D7GA 1DY9A 2BDCA 1MBMA 2C3SA 5LPRA 4K1EA 4NFFA 1Y3YA 1QY6A 1F0UA 1GBBA 3RM2H 3EA8A 4ABEA 1F92A 1V2NT 2BOHB 2TBSA 3PO1B 2K7XA 4Y7AA 3M7UA 1O33A 1S81A 3ZZ9A 1PYTD 1J9CH 2QXIA 1A0JA 1QJ6B 4TWWA 3T25A 1E34B 1BBRK 3EE0B 1DDJA 1H4WA 4YOGA 1NU7B 1DT2A 3W95A 5FXLA 5C5NA 2QV1A 2QCYA 1TPAE 4PROA 1FMGA 1C5OH 2F9NA 1RFNA 2ODYB 1UTKA 3L6PA 1EJMA 1GGDC 4CRAA 1MD7A 1HYLA 2WV5A 1TABE 5DPAA 1RIWB 2UWLA 1O2TA 2WYJA 1YCPH 2BY6X 3RMOH 1AZ8A 1Y3WA 2YNAA 1BTUA 5GJ4B 2DE8A 2TGTA 4ZROA 4GCHF 3BTKE 1C9PA 1OWHA 2P3TB 2WPIS 2D26C 5FPYA 4NFEA 3VB3A 5A0AE 2A5KA 1A5GH 5E0JA 3GICB 1F0TA 2ALPA 1XKBC 1L4ZA 2Y5GA 2QAAA 1AVWA 3BEIB 1YPKH 3STJA 2ZO3H 5JPMH 4JCNA 4Y10E 4MDSA 4CRFA 5IYTA 4FU7A 4X8TH 1O5BB 3RXVA 9ESTA 1O37A 4Y8YA 2ODQA 1B7XB 1KXCA 3F9GA 2Z9GA 2FI5E 1E35B 1LVMA 3MO3A 3A88A 1W7XH 3GISB 2D2DA 1BMLA 1HJ9A 1J14A 4UEHH 1V2MT 1TMTH 5E0GA 2OC7A 4MPUA 5F8ZA 4I32A 3LH1A 4YT6H 3KQCA 2GCTB 5JB8S 2OCVB 2XRCA 1ETRH 1UTMA 4E7NA 1C5YB 1ELDE 1RJXB 5ABWA 1ZPZA 4O9VA 3E6PH 1F0RA 3FFGA 4X2VA 4AZ2B 1MTNB 1UO6A 1FLEE 4MLFB 5F8TA 1ESTA 2FYQA 3UY9A 2ZU3A 1VITG 3IITA 3S9CA 1M9UA 3VGCB 1IQEA 4DGJA 5I46H 1CGJE 1SB1H 4Z6AH 2OUAA 1NO9H 5HXFA 3SI4H 1O5CB 1G32B 3GY7A 1EXFA 1OX1A 2GP9B 2FWWA 1GHAG 2Q6FA 1NPMA 2XXLA 4J1YA 7ESTE 3UWIA 2LPRA 2J92A 1FY1A 3CS7A 3SJIA 4NZQA 1SR5C 5EW1H 2ASUB 3LGTA 4D7FA 2FOAA 4WMEA 1A2CH 2TGPZ 1KIGH 2XNIA 2EC9H 1L1NA 4AGJA 2JKHA 5C67A 3P92A 3E91A 3U69H 3RU4E 1FJSA 1P2MA 3HATH 3L3TA 2CMYA 2BY5X 2BY7X 3P70B 4H42U 3BTEE 5EU8A 1Z8JB 5C1XA 3QGNB 3SU1A 1GHWH 3SV6A 1KLJH 1AZZA 4YZUA 3RMMH 4MQAA 3RXAA 2FX6A 4CR9A 1GVKB 1AKSA 1ZGIA 4Y11E 5GCHG 4JZEH 1LPGB 1S82A 3ATWA 2WPLS 1C2MA 3LKWA 4CRGA 1SBWA 4X1QU 1XVOA 2ZF0H 2QIQA 1E0FD 1ELGA 1SGEE 3OTJE 1ZSJA 2NU1E 1HRTH 1ELCA 5A09A 5A8XA 1XX9A 1GHXH 2WV4A 5EW2H 2CXVA 5FCKA 2PKAB 2WPMS 1SG8B 1CHGA 2IJOB 2ZFTA 3TH4H 1C1RA 4O97A 3A8DA 1HJAC 2SNVA 3MH5A 1EKBB 2WPKS 2BDBA 5EQSA 1CQQA 1GBAA 1YPJH 1O3NA 3O8DA 5HM9A 1FY5A 3NK8A 1WSSH 3ZZ6A 4NGAH 1TNJA 4JYVH 1P01A 4RKJB 2M5TA 1ABIH 3EQ0H 2W7SA 1X7AC 1A4WH 1RD3B 3P17H 1QBOA 1QHRB 4WMFA 2VJ1A 2FI4E 4WJG2 2XBWA 1VCWA 2FX4A 1CBWB 3MWIU 3I29A 1ZOMA 1LHGH 3U8TH 1C5QA 2AERH 2FESH 3MU8A 4KGAA 1UTNA 1UTOA 3KHVA 1G3EA 3K2UA 2ZZUH 4TPYA 5GIBA 1AWFH 3M3SA 1ANEA 4X0WU 2ZNKH 3UREA 4FU8A 4CBNA 5E8EH 1O3AA 2Z3EA 1C1PA 3R0FA 6LPRA 1IQMA 2G4UA 1BIOA 3DHKH 1DVAH 5EQQA 1K1MA 4FXGH 1UK2A 1C5UA 4YOJA 3MO9A 3LOXA 1C2HA 2F9VA 2QF3A 1JBUH 3VB5A 3EGKH 2QXHA 1YPLH 1EZXC 1SGPE 4I8JA 1FY4A 4OGXA 1VJ9U 2A7HA 2WPHS 4FUEA 4GCHG 3K65B 1GHVH 1G9IE 4GUXA 1O3LA 1LHDH 3A8BA 3BIUH 6ESTA 4J2YB 1TNHA 2CHAB 2G51A 3E0NB 2P16A 4THNH 1KXEA 1SVPA 2VH6A 2FEQH 1PPHE 4AFQA 2FOEA 1T4VH 3MMGA 3C1KA 1NRRH 2NU0E 3A81A 1F0SA 4ABIA 4DJZB 2FM2A 2BD4A 1YLCA 2Y7ZA 1GBLA 1C5WB 4MPVA 1UVSH 4AG2A 2VIOA 4WH6A 1TGCA 5DP9A 1DY8A 5C1YA 2W26A 2RG3A 1UVTH 1MTVA 5AFZH 1B5GH 1GMHF 1HAXB 3V0XA 1OWJA 3N7OA 1UK3A 3TNSA 5C1UA 3MU4A 5A8ZA 3LDXH 4BAQB 2FLBH 5HMAA 3A87A 3VXFH 5L30H 2P8OC 2OTVA 3F6UH 2VWOA 4AYVB 1RIWC 1EZQA 4AORA 3ATIA 1P2KA 1GGDB 1GI3A 1P9SA 2A2QH 1G2LA 1P2QA 2FLRH 1O30A 2OQUA 3SUGA 1KXBA 3I77A 1O2ZA 1QQUA 2FOHA 4CRCA 3TGKE 1HJ8A 4FUHA 3KNXA 2GDDA 3CP7A 3P95A 1FXYA 2OP9A 1AHTH 4MPWA 1P3EA 1O2YA 3RLWH 2ZPSA 3E90B 1QB6A 3SHAH 4CRBA 1MU6B 1XXDA 2OINA 2VIQA 2FMJA 3K6ZA 3M5MA 1NC6A 3SNDA 3O8CA 3QK1A 2BZAA 5L6NH 1V2QT 1OYQA 2BD7A 4Y0YE 1AO5A 4F49A 3GCHC 1O35A 4X2XA 2GZ9A 3A7TA 2AS9A 1AKSB 1LHEH 4FUBA 2IN2A 5K0HA 2IOTA 3SORA 5E2PA 2BB4A 2CGAA 2QXGA 1GMCF 5DGJA 1V2LT 2VVVA 5GPIB 4O03A 1O5FH 5BRRE 3UOUA 1O3HA 3MH7A 2HPQH 3ZZAA 1IHSH 2STBE 2BD5A 2OC8A 2AGGX 4D9QA 3L33A 1OKXA 3TPIZ 2B8OH 3RXBA 1B0EA 1VR1H 3URDA 1QB9A 4WWYA 1LQDB 3A83A 4ZMAH 1UVOA 4H4FA 1V2VT 2H2ZA 1LKAA 2EI7A 4K8YA 3MTYA 1TMBH 4R8TB 5F8XA 1GDQA 2VVCA 1O3EA 3SU6A 1QL9A 3SOSA 2AIPA 1IQHA 1F5RA 2SGEE 2GGVB 1FQ3A 3TH3H 5J4QA 4ZXXH 5G4BA 2BM2A 2XC4A 1CT4E 4VGCB 4NG9H 1ARCA 1P12E 1DSTA 4DCDA 4ZKRU 2JH6D 5TCAA 1V2UT 3CENA 4OGYA 1ZPCA 3U8RH 3TJVA 1TPSA 2ZCHP 4AG1A 3RXUA 2CF9H 1T32A 2O8TA 3FP8E 4NA9H 2JETB 1O3JA 8LPRA 3ODFA 4FUIA 1HNEE 1QIXB 1THPB 1AQ7A 3SU0A 4JYTA 3S7KB 5AHGH 1MMJN 1C4U2 3P8FA 4Y6DA 1HAGE 3SBKA 1AB9C 3BV9B 3ZVCA 1YCPM 3VEQB 4ZKNU 4OS5A 3V12A 1PQ7A 1MAXA 1K1NA 1TAWA 4X6MA 2ZTZA 2HALA 2FOCA 4TY7A 4B1TA 2CHAC 3BEUA 3MU1A 2ZDMA 1C4Y2 1KTTB 1O2HA 4Y0ZE 1SGFG 5DJ7A 4XFQA 1TX8A 3HK3B 1F7ZA 4XBDA 4TPIZ 3VB7A 2A2XH 4Y76A 5SGAE 4U01A 1O39A 1EX3A 3FANA 3BSQA 4UE7H 3RXEA 2A1DB 1SGNE 2P3UB 2NU4E 3TITA 2BLOA 4DW2U 1HB0B 5E0HA 3EBNA 3RXMA 1GWAA 4X8VH 4A1TA 1WTHD 2ZHWH 3BTGE 3STIA 4I7YH 1GJ6A 2BVXH 3QTOH 1W8BH 2ZI2H 1ABJH 1OWEA 1DFPA 2FO9A 3P8NA 1P2IA 3U98H 1DWEH 3RXFA 1MKXK 2FOMB 1HIAA 4YOIA 1ZRBA 1C1WH 3GY3A 4I31A 3S7HB 1EP5A 2PSXA 1TALA 2BVRH 3BTME 4NA8A 1FNIA 3RC5A 4B73A 3I78A 4Y8ZA 4ISLA 1TE0A 2ZFQH 1D3QB 4AX9H 3GY2A 5CHAC 4ABHA 1O3DA 1ZTKA 4BXSA 1QURH 1H1BA 1AY6H 2G4TA 1BTWA 2PGBB 1O3KA 2GX4A 3M5NA 2BDYA 2DE9A 3S0NA 1EAUA 3RXDA 3TK9A 1NTPA 1GI0A 1SGDE 2H1UA 5EOKA 1PQAA 4GAWA 3ZZ4A 4KTCA 1GDUA 2AFQB 3A8CA 3TIUA 1MD8A 1WAYB 3QZQA 1HJAB 1LCYA 1AE5A 3BF6H 3VB6A 1CE5A 2G55A 1AB9B 3GCTG 1W3CA 1NRQH 1V2OT 1AFQC 1J16A 2GV7A 3MNXA 4UONA 3EA7A 4YM9A 2VWNA 3M37A 1PPGE 3BG4B 5A0CA 2G00A 1QR3E 1UHBB 5TJXA 1K28D 3GOVB 5AF9H 4TWYA 1GCTC 3MI4A 3Q3YA 1YC0A 2J95A 1ARBA 3F1SB 3NKKA 3PTNA 4ISNA 3SN8A 8GCHG 2B9LA 3KQBA 2ZGJA 2I6SA 4HI3A 1GBCA 1J15A 1Z8RA 1AMHA 4X6OA 1DICA 5DP6A 5HM2A 1DLKB 3BTDE 2BQ6B 1YPEH 1W0ZU 2JH0D 2BHGA 1YPHE 1V2WT 1O3PB 3SU3A 1TGBA 1ANBA 1G3DA 1OXGA 1GJAB 2R0LA 1LHCH 2XC0A 3Q3XA 2WINI 2V0BA 3FZZA 1TA2A 3HGPA 4GLYA 1MQ5A 1IQFA 1YKTA 1HUTH 3B9FH 2F91A 1PJPA 1IQKA 3A8AA 1TMUH 2XTTB 2VIVA 1AU8A 3MU0A 3T27A 1SLVB 4UFFH 1RXPA 1NFYA 1BMAA 2J4IA 1CT2E 1WV7H 2OXSA 4NWLA 3PTBA 2ZDLA 1LVBA 3W94A 1Y5UT 4BANB 3PMAB 2W7UA 5FX6A 1ZHMA 2GCTC 3SV7A 4UD9H 2AIQA 2GCHF 3B23B 3RXCA 1XVMA 1SQAA 4ESTE 2TIOA 1O3BA 2ILNA 3GCHB 4I8GA 4K69A 2Z3CA 1IQIA 2ZCKP 1YPGH 3D23A 2ZFPH 4KP0A 3UWJH 1A61H 1A46H 1O38A 1E37B 1DWBH 1HAIH 3UNRA 3VFEA 1S85A 3BTWE 3Q77A 1A1RA 3GDUA 1SGTA 1W7GH 1L1GA 1TX6A 1LHFH 1YM0A 3GDVA 1IQNA 3M5OA 4IC5A 4X6PA 2PV9B 1NS3A 1TRMA 1C5ZB 1CA8B 2XYAA 5DP3A 2STAE 2BTCE 4NIXA 3DD2H 3BTFE 3SW2B 9LPRA 1F2SE 1ZSKA 2FS9A 3ZVFA 3T29A 1EOJA 1T8LA 1KXFA 3M3TA 4Q7YA 5AFYH 3SO3A 3SJ9A 1AUJA 3F9FA 1GI8B 1C2LA 4ZKSU 2XC5A 4RN6A 1GPZA 2P59A 2BLWA 1DWCH 1TYNA 1SI5H 1UJ1A 1INCA 4MNXA 4MNYA 2OQ5A 4U2WA 2ZWLH 3UPEA 1DS2E 1P8VC 3MNSA 4X8SH 2O8LA 3T5FH 3UNSA 1NRNH 3M7QA 1Z1JA 3RXHA 5DO4H 1FONA 1V3XA 1BHXB 4DG4A 1LMWB 4WVPE 1FPHH 1FUJA 1O2MA 1QA0A 5F03A 2PWXA 2JH5D 3M61U 1QB1A 1VGCC 4U30A 4XSKU 3UOPA 3Q3KA 1C5RA 1GVZA 1S84A 2A4QA 1V2RT 1QL7A 4ZHMU 1C5LH 4X6NA 3GY6A 1DUAA 1QTFA 5GWZA 1BDAA 1ACBE 1AVGH 3SUEA 2NU2E 1C5XB 1TX7A 2G5VA 4XDEA 1P02A 1TBRH 3SU5A 2ZCLP 1ZR0A 3BIVH 3RC6A 5FX5A 3SGQE 4FUCA 1PPEE 1KTSB 2Z7FE 2VB0A 8GCHF 1WCZA 1BTPA 1ELFA 4IMQA 1YPMH 1V2KT 1EOLA 4MTBA 4LZ4B 2Z9KA 1KDQA 1SGQE 1NN6A 1CGIE 1ETTH 7KMEH 3LJJA 1GBEA 4CH8B 3MO6A 2GVFA 4ZXYH 2GZ7A 2ESTE 1AFQB 4BOHA 1HBTH 3OU0A 1UTPA 2XWBI 3SZNA 1ANCA 4KTSA 1BCUH 1BRCE 2R3UA 2BXUH 1EQ9A 3SHCH 3GDSA 1LVYA 2R9PA 4XBBA 4AB9A 2F3CE 1A0HB 1FIZA 5EPYA 2OC1A 2QYIA 2KAIB 1YGCH 5I25A 3PV4A 1BITA 1PPFE 1N6XA 1K22H 3OY5U 4X2WA 2ZHDA 5CMXH 1GJ4H 4NCYA 1HAHH 4YO9A 1GHBF 1P2NA 2CN0H 5T6DA 2EI8A 2LIZA 1VJAU 1E36B 1FIWA 2ZECA 2Y5FA 1D6WA 2BQ7B 4BXWA 4FVDA 4ABFA 1GBIA 4ZUHA 3HGNA 7GCHG 1C4V2 1FV9A 3T62A 1TGTA 3PB1E 1T8NA 3PM3A 4TY6A 1G3CA 3WY8A 1OP8A 2H9EH 1EAWA 3LH3A 3UQVA 1UCYK 1UVPA 3PLPA 1BMMH 2VGCB 1O34A 4LXBH 3H7TA 3T2NA 1TB6H 3RP2A 1ESAA 1J8AA 3GY5A 1QCPA 3A80A 2Z94A 2P93A 1H8IH 5FBEA 1GBTA 3QX5H 1EASA 2ZGBH 5EXNA 1SLUB 3S9BA 4D76A 1MH0A 1MQ6A 1W0YH 3MHWU 1CBWC 3TGIE 1G37A 1UMAH 1GI6A 2VIDA 1BB0B 2BMGB 3NZIA 2Y6TA 2I6QA 3PWBA 2H5CA 1TOCB 3ZVDA 3RMNH 2B7DH 2OBOA 5PTPA 2G8TA 2XWAA 1DOJA 2J2UA 1Z71A 1HAYB 2FOGA 3S69A 1VITH 4KELA 1GCDA 1C5MD 2GTBA 1GMHG 3KEEA 3NCLA 1O3IA 1P9UA 1CT0E 4ASHA 4UFGH 2ZKSA 4YESB 1GL0E 3H7OA 4K2YA 1SGIB 1C2IA 3TK6A 2ANMH 3A82A 1XUJA 1TIOA 1BTZA 4Q80A 1G36A 1O5DH 7LPRA 2BLVA 2C8ZB 2ZTXA 1Y3XA 1P57B 3TU7H 1CVWH 1HAVB 1Z6JH 1TGSZ 1L0ZA 3RXIA 5ESTE 1O2QA 2H6MA 4FUFA 2BDGA 1BBRE 2O8MA 4DIHH 4GVUA 1GHBG 2GV6A 3A84A 3HKIB 2QXJA 2UWOA 3GCOA 3LGIA 4IC6A 2Y7XA 4ZAEA 1ELTA 4ZKOU 2A7JA 3SUFA 1GBJA 2G52A 1GJBB 2PTNA 1TNKA 2QY0B 4K1SA 2PGQB 1SHYA 3MH4A 5JB9S 5JBBS 3ZZBA 3DA9B 1DUEA 4VGCC 3SQHE 4IMZA 4B74A 6CHAC 4AGKA 1S83A 1DANH 3IG6B 3ZZCA 3ZYEA 3GYMA 1C1QA 2W3IA 4BAMB 3A7VA 3SJ8A 3AAUA 2AEIH 1BTYA 3ZZ7A 4BTIB 3KCGH 3SJOA 3QUMP 1TNLA 2ZA5A 1OSSA 4GHQA 4A7IB 2Q6DA 3RXTA 1BZXE 3OSYA 1JMOH 3SNCA 1RRKA 2XBVA 3D49H 4JZIA 1GJ8B 1QA7A 1B0FA 3LIWA 1K2I1 2A7CA 8KME2 1O3OA 1E38B 3ATLA 1YYY1 1LVOA 1FY3A 2FIRH 3ATMA 1DITH 2Y5HA 1EAXA 1C2FA 1C5NH 3LJOA 2A32A 1CA0B 1Y3VA 2QF0A 3RXQA 1W14U 4HTCH 8ESTE 1WQVH 2NU3E 4Q7XA 1LO6A 2VWLA 1D4PB 2HPPH 5DP4A 4U32A 2ZPQA 3BN9A 1F5KU 3ZZ3A 6GCHG 1C1SA 1AE8H 3AASA 4F4OC 3RLYH 1SSXA 1OOKB 2BZ6H 4YLQH 1UTLM 1SGFA 2G81E 5EXLA 3U9AH 1ZSLA 2BD2A 3RUOA 1O36A 4AOQA 1UK4A 5FAHA 1VGCB 2XBXA 4NSYA 2RDLA 1ZJDA 3RXPA 1EUFA 1ZJKA 2TPIZ 2VIWA 3RC4A 4YTAA 1HXEH 5FHTA 5C2ZA 1CO7E 1V2JT 1VZQH 1C5PA 5EGMA 1OP2A 5AVDA 3TJUA 1KXAA 1HCGA 1DSUA 4X1RU 1EPTC 1O3CA 2OD3B 1D3PB 2ALVA 4WF8A 2BYAX 3E8LA 2P8OB 1OWIA 2ZU1A 2H9TH 3A7ZA 2TRMA 1WYKA 2FI3E 1BJVA 3RXSA 1JIMA 1LKBA 2FTLE 1SGCA 3AW0A 2SGQE 1GHAF 1GJ5H 1SLXB 1O2LA 2GMTC 3F68H 1TQ7B 3LGWA 2A5IA 1Q2WA 1AIXH 1EPTB 5K7RA 4I8HA 3M3VA 3M35A 1Z8IB 1LTOA 3BTQE 1Y5AT 2Y82A 1THSH 1WUNH 3FP7E 3NUMA 1D3TB 3PO1C 3TGJE 4IBLH 2B5TB 4GSOA 1SOZA 4JYUH 1C1VH 3UFAA 2UUKB 3QWCH 3VXEH 1CGHA 1AN1E 4Y71A 1O3MA 1BRUP 3EYDA 5JBCS 2WUCA 3AW1A 1G2MA 3ZYDA 4LZ1H 5DP5A 5TCCA 5E2OA 1DX5M 2GT8A 1O5EH 3M7TA 1OPHB 5DP7A 1FY8E 4B71A 3NWUA 2R2MB 1NZQH 3RXRA 1UHBA 2AYWA 5IDKA 2V6NA 3NPSA 1KLTA 3K9XB 1TQ0B 1T8OA 1T4UH 4SGAE 4NIYA 2ZGCA 2Z3DA 1W11U 2Z9IA 3U1IB 5LPEA 3RXLA 1C1OA 2FOBA 3ZVEA 4IS5A 4Q7ZA 3RDZA 4NA7A 3SQEE 1D6RA 1EJNA 1W13U 2VWMA 3KGPA 4CHAB 2QN5T 1O2NA 1HAOH 1EP6A 2D1JA 4I8KA 2BLQA 1XM1A 4AFUA 3V13A 1FN8A 2Y81A 5GCHF 4K3JA 2O9QA 3ZZ8A 4AB8A 1KDQB 1KXDA 3PLBA 1GMDG 2P3FH 4A92A 1VITF 1N6YA 1O2PA 3S9AA 3HK6B 4XE4A 1VCQA 4O3TA 1IAUA 1FI8A 3SNEA 4HFPB 1QGFA 2ULLA 1DLEA 1JIRA 3KF2A 1K1JA 1MU8B 3KQDA 2FTMA 1XKAC 3P6ZB 1H9HE 1TONA 3ODDA 2Z9LA 1Y5BT 3DFLA 3TJOA 3QDZB 2AMPA 3ZVAA 2ODPA 1QQ4A 1BBRH 1UVUH 5LGOA 1TBQH 2SGFE 1SGRE 1ZZZA 1GCTB 2FP7B 3QZRA 4K8BA 1QBNA 4LOYH 1QRZA 1V6DA 2RA3A 2ZFRH 3BG4C 1HGTH 1O2VA 2PFEA 3K6YA 1PQ8A 1J17T 5ETXA 5A8YA 3BEFB 3C27B 3ZV9A 3M5LA 3SGAE 1BA8B 4A5TS 2ZU4A 1C1NA 2ZHFH 1QBVH 4MG3A 1XUIA 5GXPA 2CF8H 3KIDU 2BY9X 4NWKA 5FPSA 2BX3A 4OS2A 4WXVA 1LDTT 1PQ5A 2QA9E 5DG6A 2A5AA 3EAJA 1EB2A 1MTSA 3PMHB 1RTLA 2C90B 3AVZA 2PHBA 2PLXA 2ZFFH 1MKXH 3QGJA 1GBHA 3SV9A 1Z8GA 1P09A 5B6OA 1ZMJA 1O2OA 2FOFA 1GHYH 1HFDA 2BDHA 1Z1IA 4IN2A 2XW9A 2EA3A 1U6QA 4B2BA 1SQTA 2HGTH 4X1PU 1RS0A 2V3HH 3SI3H 4INKA 2G5NA 3A85A 4FU9A 2WYGA 2O8UA 4ZHAA 1GI9B 4DY7B 2BXTH 1JWTA 4Y79A 3FVFB 1TFXA 4AFZA 4FUDA 3VGCC 5ESBA 1O2JA 4E06H 1GMCG 4TYDA 1NRPH 1W2KH 1SGYE 4D9RA 1MTWA 3Q76A 4JK6A 1A7SA 1QFKH 2C4FH 1T7CA 1LPKB 1PPBH 1A5HA
chains in the Genus database with same CATH superfamily
1EATA 2R3YA 2BD8A 2XBYA 1A0LA 1MZDA 2BVSH 3DUXH 5JYIA 1QJ7B 2IPHA 1KSNA 4Y7BA 1FN6A 3IWMA 1ANDA 1GVLA 1O2XA 1K9OE 1ZYOA 2CV3A 3KL6A 1GJ7B 2ZP0H 3LGVA 1IQGA 3MH6A 2A31A 1GG6C 2W5EA 4M9FA 2THFB 2D8WA 4DVAU 1TBZH 3PRBA 1QNJA 2HVXA 1HAVA 5HIYA 3P8OA 5DKMA 1IQJA 1SQOA 3CNRA 1BHXF 2FZZA 4X8UH 3G01A 5FPTA 4X1NU 1Y3UA 1ELVA 4CBOA 1JRSA 3LGYA 5DSFA 2GKVE 5A2MH 1XMNB 1PPZA 3URCA 5EODA 3LONA 3RXJA 4X2YA 4ABBA 1XXFA 4XBCA 4MPXA 1IQLA 3T26A 2BX4A 2JETC 4Z0KA 3R3GB 1WU1A 5EQRA 5C5OA 2WPJS 1O2RA 2UUJB 1OYTH 1MKWH 1ORFA 2F83A 5BPEA 1O2SA 2VH0A 3MOCA 1H8DH 3FAOA 1Q3XA 4WXIA 1SHHB 1DXWA 1TRNA 1ZLRA 1G3BA 2AGEX 5LPFA 3D62A 1HV7A 1MTNC 1K1OA 1P3CA 2BD3A 2P95A 1ZHRA 4AFSA 3RM0H 2YNBA 2KCAA 2H9HA 1GL1A 5EG4A 1BJUA 1N8OB 4D8NA 5EXMA 4Y8XA 4WMDA 2CJIA 4A1XA 2ZGXH 4NZLA 2C93B 3DFJA 2YMSB 3MQKC 1XUHA 4ZH8A 3ITIA 1SFIA 1TRYA 4RSPA 3N99A 2J94A 3GCNA 3EA9A 4FVBA 3BTTE 1YP9A 3A89A 2VNTA 1EPTA 2K1QA 4OS7A 3PLKA 2HLCA 2L74A 1C1MA 2DUCA 1O31A 4R0IA 1ZPBA 3OTPA 2VINA 1TWXB 4GPGA 1HXFH 3VB4A 1S6FA 4OS4A 1P10A 1RGQA 1MKWK 1AVXA 4INHA 2BOKA 2ZQ1A 4YLUA 4HGCA 3QN7A 1P06A 5C3NA 2ZGHA 2HOBA 3E0PB 1SQRA 2XCFA 3ATKA 3E3TA 2C8XB 3PYHA 5H4IB 1O2GH 3UAIC 1S6HA 2A4OA 3BG8A 1FAXA 1OP0A 2EEKA 2EI6A 2ZDKA 1SPJA 1UTJA 1ID5H 3MYWA 1SFQB 2AGIX 2LNCA 1NFXA 2A4RA 1S0RA 3P8GA 1EB1H 3TH2H 1ELEE 1DPOA 1NT1A 1TPOA 3SJKA 1FDPA 2ZIQH 5FCRA 3VPKA 2BDAA 1L2EA 7GCHF 2PKSB 1PPCE 1K21H 4E05H 1SMFE 1GBFA 3KQEA 4I86A 1C1TA 5EIYA 2Q6GA 1P05A 3LGUA 3Q00A 2A45B 1ZMLA 2ANYA 2GJGA 1D3DB 5T6GA 2A4GA 2R0KA 3GYLB 3PRDA 1WBGB 2SFAA 1C1UH 1F5LA 2ZTYA 1Z6EA 2J9NA 2HNTE 5FBIA 4H6SB 2V35A 2WSSD 3OY6U 1GMDF 2PTCE 1GI2A 1BTHH 4ISIH 1IOEA 1H9IE 1GJ9B 3ELAH 5JDUB 1NM6A 3MNCA 4OS1A 2NWNA 1UTQA 1UW7A 2RA0A 2B0FA 1GI1A 2W6JD 4HG6A 2JJ2D 1V2ST 1GDNA 5LH8A 3H5CB 5JBTA 4Q4LA 4K5ZA 1ZHPA 1P03A 2V3OH 1YLNA 1O3FA 3PROA 1RTKA 4ABJA 2V3MA 1CA0C 4JZFH 3O8BA 3CS0A 3A7WA 3LPRA 2F4LA 1Y59T 1MCTA 2HRVA 1A3BH 4INLA 5EPNA 1O5GH 1P11E 3QTVH 4UFDH 4CREA 2KZ4A 3LU9B 3TJNA 3QO6A 2UUYA 1DWDH 5C20A 4FUGA 1EJAA 1T31A 2KAIA 3M36A 1G30B 1UCYE 1DE7H 4KTUA 2BD9A 1Y8TA 1CSOE 2BQWB 4TT3D 3OYPA 4O3UA 2AMQA 1ZTJA 1WTGH 1C2DA 1SOTA 4DIIH 2OC0A 2VU8E 1AI8H 4OM9A 2FODA 1NU9A 4LK4A 3KN2A 4NIWA 3B8JA 3A7YA 6CHAB 2HLDD 4BAOB 1N8OC 2GDEH 5T6FA 2RCEA 3JZ1B 3RMLH 2FPZA 2FS8A 1C5TA 1XUFA 2Y80A 2ZDAH 1YPHC 4JK5A 1HAPH 2HWLB 2ZPRA 2H5DA 1V2PT 3SU2A 1CHOF 1O32A 1GG6B 3RU4D 1O2KA 4BTUB 1GJDB 4A1VA 4A6LA 3KYGA 4IGDA 1S0QA 1C5VA 3ZVGA 4ISHH 4ZCNA 5L2ZH 3PWCA 3NXPA 1TGNA 2XCNA 3BTHE 3V3MA 1VCPA 2F9PA 4IN1A 2GZ8A 1A5IA 1ZGVA 1LQEA 3SU4A 5T1VA 1S5SA 1TA6A 2ZHEH 1HDTH 3GY8A 5CDFE 4DURA 5L2YH 1KY9A 1THRH 1YCPK 3RXGA 3OX7U 3SV2H 1CU1A 4BAHB 2J34A 4ABGA 4CR5A 1GI4A 2ANKH 1JOUB 1FZZA 2OBQA 3F9HA 1YBWA 1KLIH 2J5UA 1BUIA 2C8YB 4I8LA 1P04A 3PMBB 3AAVA 1TNGA 1QRXA 1O2IA 1PYTC 2EQNA 4H6TA 4IW4E 1D9IA 4JMYA 4B75A 4BNRA 1MBQA 2FDAA 1IHTH 2ZFSA 2PSYA 2Z9JA 1UCYH 2Z6BD 2PKAA 3UR6A 5GDSH 4MNWA 1GBMA 4MVNA 3A86A 1Q31A 1XUGA 1ZMNA 1BQYA 1OWDA 5CHAB 2GCHG 1BRAA 3TLOA 3SNAA 1NESE 2PW8H 5HYOA 4Q2KA 1EZUC 1O2UA 3EDXB 1TOMH 2FXRA 1AD8H 2W3KA 3QLPH 1WOFA 1O5AB 3HPTB 1BOQA 1KYNA 1NBMD 5T3HA 2VGCC 3UTUH 1C2KA 3E16B 4MNVA 4OS6A 4M7GA 4TSFD 1AFEH 4UFEH 1BRBE 1PFXC 1WDIA 4I33A 3LT3A 3A7XA 2BDIA 2J38A 4CRDA 1DM4B 1NFUA 4B2CA 4DT7B 5HGGA 1SC8U 1LPZB 2VIPA 3F9EA 1GJCB 1CHOG 2GT7A 2PR3A 1EAIA 3GCTF 5A0BA 1BTXA 3TNTA 4AN7A 4E7RG 3UUZA 3SGBE 2F9BH 4K60A 1BMNH 1OS8A 3LC3A 3UQOA 2AH4X 3DT0H 5KECA 1K1PA 4QT8C 1AGJA 4SGBE 3V7TA 4FUJA 2ZG0H 3FKSD 2A0QB 2SGAA 3U1JB 3UIRA 1O3GA 1E79D 1WQSA 1FPCH 1QJ1B 5CE1A 4CH2B 1V2TT 2ZU2A 4KKDA 1L1JA 2GD4B 1NRSH 1K1LA 1ESBA 2UUFB 3SV8A 1GI7B 2TGAA 1OWKA 2HNTF 3D65E 1HAZB 2VVUA 2PUXB 2ZHQH 4UDWH 1AWHB 1QRWA 1K1IA 3RXOA 1ELAA 4BTTB 1MUEB 5F6MA 1C2JA 1NROH 1QL8A 1YF4A 1Z7KA 4NSVA 3RU4T 2TGDA 3JZ2B 5DK1A 1GBDA 2PUQH 2ZEBA 2F9OA 4X1SU 4YT7H 1SL3A 4HZHA 1P0SH 4NIVA 2UWPA 1NY22 1SLWB 4WH8A 4WY3A 1P2OA 2ZC9H 3UR9A 2P94A 1FAKH 1HIAB 3U8OH 4GHTA 1P2JA 3FZDA 1MAYA 3RXKA 4P00A 3VG8A 1AUTC 3HKJB 2C8WB 2FYRA 2EY4C 1YLDA 2SGDE 1C5SA 3ZZ5A 2SGPE 1GBKA 1O2WA 1KMHB 2AMDA 2BY8X 1JRTA 3FP6E 2HNTC 1H8HD 1GHZA 3TVJB 2ZDNA 3SNBA 2OLGA 1RTFB 1TPPA 3SUDA 2ZQ2A 6GCHF 1ETSH 1MZAA 1TLDA 3ESTA 3E1XB 1TNIA 3ENSB 1W10U 4ABDA 1JXPA 4XOJA 1O0DH 1EZSC 4BAKB 3W1EA 2Q1JA 1A3EH 1C2EA 3O8RA 4RKOB 1N1LA 4K1TA 2YOLA 3T28A 1ELBA 2WUBA 2PKSC 2QGRA 3LC5A 4CHAC 1BT7A 1XUKA 2ANWA 2SNWA 4B76A 2QC2A 3MU5A 3ZVBA 1MCVA 1C2GA 1ZRKA 3UNQA 3ZZDA 2GMTB 2R2WU 1ZTLA 1NFWA 4AYYB 5J4SA 2ZU5A 1HLTH 1GI5A 4ISOA 1DXPA 3F2GA 2KCYA 2O8WA 3MNBA 1MTUA 5JBAS 2F9UA 4ABAA 4JZ1A 4JZDH 3ZV8A 1C9TA 3MFJA 1L4DA 1W12U 3GY4A 3PV5A 2ZDVH 4DOQA 4ZHLU 1H9LB 3PMJA 4B2AA 3TK5A 1HPGA 1T8MA 5DP8A 4D7GA 1DY9A 2BDCA 4RT0A 1MBMA 2C3SA 5LPRA 4K1EA 4NFFA 1Y3YA 1QY6A 1F0UA 1GBBA 3RM2H 3EA8A 4ABEA 1F92A 1V2NT 2BOHB 2TBSA 3PO1B 2K7XA 4Y7AA 3M7UA 1O33A 1S81A 3ZZ9A 1PYTD 1J9CH 2QXIA 1A0JA 1QJ6B 4TWWA 3T25A 1E34B 1BBRK 3NRLA 2KFWA 3EE0B 1DDJA 1H4WA 4YOGA 2PP6A 1NU7B 3EE7A 1DT2A 3W95A 5FXLA 5C5NA 2QV1A 2QCYA 1TPAE 4PROA 1FMGA 1C5OH 2F9NA 1RFNA 2ODYB 1UTKA 3L6PA 1EJMA 1GGDC 4CRAA 1MD7A 1HYLA 2WV5A 1TABE 3U28C 5DPAA 1RIWB 2UWLA 1O2TA 2WYJA 1YCPH 2BY6X 3RMOH 1AZ8A 1Y3WA 2YNAA 1BTUA 5GJ4B 2DE8A 2TGTA 4ZROA 4GCHF 3BTKE 1C9PA 1OWHA 2P3TB 2WPIS 2D26C 5FPYA 4NFEA 3VB3A 5A0AE 2A5KA 1A5GH 5IK2D 5E0JA 3GICB 1F0TA 2ALPA 1XKBC 1L4ZA 2J97A 2WV9A 2Y5GA 2QAAA 1AVWA 3BEIB 1YPKH 3STJA 2ZO3H 5JPMH 2QE7D 4JCNA 4Y10E 4MDSA 4CRFA 5IYTA 4FU7A 4X8TH 1O5BB 3RXVA 9ESTA 1O37A 4Y8YA 2ODQA 1B7XB 1KXCA 3F9GA 2Z9GA 2FI5E 1E35B 1LVMA 3MO3A 3A88A 1W7XH 3GISB 2D2DA 1BMLA 1HJ9A 1J14A 4UEHH 1V2MT 1TMTH 5E0GA 2OC7A 4MPUA 5F8ZA 4I32A 3LH1A 4YT6H 3KQCA 2KR7A 2GCTB 5JB8S 2OCVB 2XRCA 1ETRH 1UTMA 4E7NA 1C5YB 1ELDE 1RJXB 5ABWA 1ZPZA 4O9VA 3E6PH 1F0RA 3FFGA 4X2VA 4AZ2B 1MTNB 1UO6A 1FLEE 2KCOA 4MLFB 5F8TA 1ESTA 2FYQA 3UY9A 2ZU3A 1VITG 3IITA 3S9CA 1M9UA 3VGCB 1IQEA 5GNDA 4DGJA 5I46H 1CGJE 1SB1H 4Z6AH 2OUAA 1NO9H 5HXFA 3SI4H 1O5CB 1G32B 3FN8A 3GY7A 1EXFA 1OX1A 2GP9B 2FWWA 1GHAG 2Q6FA 1NPMA 2XXLA 4J1YA 7ESTE 1COWD 3UWIA 2LPRA 2J92A 1FY1A 3CS7A 3SJIA 5DN6D 4NZQA 1SR5C 5EW1H 2ASUB 3LGTA 4D7FA 2FOAA 4WMEA 1A2CH 2TGPZ 1KIGH 1VKYA 2XNIA 2EC9H 1L1NA 4AGJA 2JKHA 5C67A 3P92A 3E91A 3U69H 2K8IA 3RU4E 1FJSA 1P2MA 3HATH 3L3TA 2CMYA 2BY5X 2BY7X 3P70B 4H42U 3BTEE 5EU8A 1Z8JB 5C1XA 3QGNB 3SU1A 1GHWH 3SV6A 1KLJH 1AZZA 2RDEA 4YZUA 3RMMH 4MQAA 3RXAA 2FX6A 4CR9A 1GVKB 1AKSA 1ZGIA 4Y11E 1E1RD 5GCHG 4JZEH 1LPGB 1S82A 3ATWA 2WPLS 1C2MA 3LKWA 1E1QD 1SBWA 4X1QU 4CRGA 1XVOA 2ZF0H 2QIQA 1E0FD 1ELGA 1SGEE 3OTJE 1ZSJA 2NU1E 1HRTH 1ELCA 5A09A 5A8XA 1XX9A 1GHXH 2WV4A 2JIZD 5EW2H 2KM0A 2CXVA 5FCKA 2PKAB 2WPMS 1SG8B 5HIZA 1CHGA 2IJOB 2ZFTA 3TH4H 1C1RA 4O97A 3A8DA 1HJAC 2SNVA 3MH5A 1EKBB 1W0KD 2WPKS 2BDBA 5EQSA 1CQQA 1GBAA 1YPJH 1O3NA 3O8DA 5HM9A 1FY5A 3NK8A 1WSSH 3ZZ6A 4NGAH 1H8ED 1TNJA 4JYVH 1P01A 4RKJB 2M5TA 1ABIH 3F2FA 3EQ0H 2W7SA 1X7AC 1A4WH 1RD3B 3P17H 1QBOA 1QHRB 4WMFA 2VJ1A 2FI4E 4WJG2 2XBWA 1VCWA 2FX4A 1CBWB 3MWIU 3I29A 1ZOMA 1LHGH 3U8TH 1C5QA 2AERH 2FESH 3MU8A 4KGAA 1UTNA 1UTOA 3KHVA 1G3EA 3K2UA 2ZZUH 4TPYA 5GIBA 1AWFH 3M3SA 1ANEA 4X0WU 2ZNKH 3UREA 4FU8A 4CBNA 5E8EH 1O3AA 2Z3EA 1C1PA 3R0FA 6LPRA 1IQMA 2G4UA 1BIOA 3DHKH 1DVAH 5EQQA 1K1MA 4FXGH 1UK2A 1C5UA 4YOJA 3MO9A 3LOXA 1C2HA 2F9VA 4ACBA 2QF3A 1JBUH 3VB5A 3EGKH 2QXHA 1YPLH 1EZXC 1SGPE 4I8JA 1FY4A 4OGXA 1WXRA 1VJ9U 2A7HA 2WPHS 4FUEA 4GCHG 3K65B 1GHVH 1SKYE 1G9IE 4GUXA 1O3LA 1LHDH 3A8BA 3BIUH 6ESTA 4J2YB 1TNHA 2CHAB 2G51A 3E0NB 2P16A 4THNH 1KXEA 1SVPA 2VH6A 2FEQH 3WWBA 1PPHE 4AFQA 2FOEA 1T4VH 3MMGA 3C1KA 2IPQX 1NRRH 2NU0E 3A81A 1F0SA 4ABIA 4DJZB 2FM2A 2BD4A 1YLCA 2Y7ZA 4FETA 1GBLA 1C5WB 4MPVA 1UVSH 4AG2A 2VIOA 4WH6A 1TGCA 2M2AA 1DY8A 5C1YA 2W26A 1UVTH 2RG3A 1MTVA 5AFZH 5DP9A 1B5GH 1GMHF 1HAXB 3V0XA 1K0HA 1OWJA 3N7OA 1UK3A 3TNSA 5C1UA 3MU4A 5A8ZA 3LDXH 4BAQB 2FLBH 5HMAA 3A87A 3VXFH 5L30H 2P8OC 2OTVA 3F6UH 4F55A 2VWOA 4AYVB 1RIWC 1EZQA 4AORA 3ATIA 4B6EA 1P2KA 1GGDB 3DSGA 1GI3A 1P9SA 2A2QH 1G2LA 3OEHD 3OAAD 1P2QA 2FLRH 1O30A 3FO8D 2OQUA 3SUGA 1KXBA 3I77A 1O2ZA 1QQUA 2FOHA 2L6OA 4CRCA 3TGKE 1HJ8A 4FUHA 3KNXA 2GDDA 3CP7A 3P95A 1FXYA 2OP9A 1AHTH 4MPWA 1P3EA 1O2YA 3RLWH 2ZPSA 3E90B 2AHME 1QB6A 3SHAH 4CRBA 1MU6B 1XXDA 2OINA 2VIQA 2FMJA 3K6ZA 3M5MA 1NC6A 3SNDA 3O8CA 3QK1A 2BZAA 5L6NH 1V2QT 1OYQA 2BD7A 4Y0YE 1AO5A 4F49A 3GCHC 1O35A 4X2XA 2GZ9A 3A7TA 2AS9A 1AKSB 1LHEH 4FUBA 2IN2A 5K0HA 4FOUC 2IOTA 3SORA 5E2PA 2BB4A 2CGAA 2QXGA 1GMCF 5DGJA 1V2LT 2VVVA 5GPIB 4O03A 1O5FH 5BRRE 3UOUA 1O3HA 3MH7A 2HPQH 3ZZAA 1IHSH 2STBE 2BD5A 2OC8A 2AGGX 4D9QA 3L33A 1OKXA 3TPIZ 2B8OH 3RXBA 1B0EA 1VR1H 3URDA 1QB9A 2JJ1D 4WWYA 1LQDB 3A83A 4ZMAH 1UVOA 4H4FA 1V2VT 5F53A 2H2ZA 1LKAA 2J98B 2EI7A 4K8YA 3MTYA 1TMBH 4R8TB 5F8XA 1GDQA 2VVCA 1O3EA 3SU6A 1QL9A 3SOSA 2AIPA 1IQHA 1F5RA 2SGEE 2GGVB 2YMSC 1FQ3A 3TH3H 5J4QA 4ZXXH 5G4BA 2BM2A 2XC4A 1CT4E 4VGCB 4NG9H 1ARCA 1P12E 1DSTA 4DCDA 4ZKRU 2JH6D 5TCAA 1V2UT 3CENA 4OGYA 1ZPCA 3U8RH 3TJVA 3PV2A 2XOKD 1TPSA 2ZCHP 4AG1A 3RXUA 2CF9H 1T32A 2O8TA 3FP8E 4NA9H 2JETB 1O3JA 8LPRA 3ODFA 4FUIA 1HNEE 1QIXB 1THPB 1AQ7A 3SU0A 4JYTA 3S7KB 5AHGH 1MMJN 1C4U2 3P8FA 4Y6DA 1HAGE 3SBKA 1AB9C 3BV9B 3ZVCA 1YCPM 3VEQB 4ZKNU 4OS5A 3V12A 1PQ7A 1MAXA 1K1NA 1TAWA 4X6MA 2ZTZA 1MABB 2HALA 2KX4A 2FOCA 4TY7A 4B1TA 2CHAC 3BEUA 3MU1A 2ZDMA 1C4Y2 1KTTB 1O2HA 4Y0ZE 1SGFG 5DJ7A 5B6LA 4XFQA 1TX8A 3HK3B 1F7ZA 4XBDA 4TPIZ 3VB7A 2A2XH 4Y76A 5SGAE 4U01A 1O39A 1EX3A 3FANA 3BSQA 4UE7H 3RXEA 2A1DB 1SGNE 2P3UB 2NU4E 3TITA 2BLOA 4DW2U 1HB0B 5E0HA 3EBNA 3RXMA 1GWAA 4X8VH 4A1TA 1WTHD 2ZHWH 3BTGE 3STIA 4I7YH 1GJ6A 2BVXH 3QTOH 1W8BH 2ZI2H 1ABJH 1OWEA 1DFPA 2FO9A 3P8NA 1P2IA 3U98H 1DWEH 3RXFA 1MKXK 2FOMB 1HIAA 4YOIA 1ZRBA 1C1WH 3GY3A 4I31A 3S7HB 1EP5A 1TALA 2PSXA 2BVRH 3BTME 4NA8A 3ZIAD 1FNIA 3RC5A 4B73A 3I78A 4Y8ZA 4ISLA 1TE0A 2ZFQH 3GS9A 1D3QB 4AX9H 3GY2A 5CHAC 4ABHA 1O3DA 1ZTKA 4BXSA 1QURH 1H1BA 1AY6H 2G4TA 1BTWA 2PGBB 3DCLA 1O3KA 2GX4A 3M5NA 2BDYA 2DE9A 3S0NA 1EAUA 3RXDA 3TK9A 1NTPA 1EFRD 1GI0A 1SGDE 2H1UA 5EOKA 3WW7A 1PQAA 4GAWA 3ZZ4A 4KTCA 1GDUA 2AFQB 3A8CA 3TIUA 1MD8A 1WAYB 3QZQA 1HJAB 1LCYA 1AE5A 3BF6H 3VB6A 1CE5A 2G55A 1AB9B 3GCTG 1W3CA 1NRQH 1V2OT 3KQ5A 1AFQC 1J16A 2GV7A 3MNXA 4UONA 2JDID 3EA7A 4YM9A 2VWNA 3M37A 1PPGE 3BG4B 5A0CA 2G00A 1QR3E 4F48B 1UHBB 5TJXA 1K28D 3GOVB 5AF9H 4TWYA 1GCTC 3MI4A 3Q3YA 1YC0A 2J95A 1ARBA 3F1SB 3NKKA 3PTNA 4ISNA 3SN8A 8GCHG 2B9LA 3KQBA 2ZGJA 2I6SA 4HI3A 1GBCA 1J15A 1Z8RA 1AMHA 4X6OA 1DICA 5DP6A 5HM2A 1DLKB 3BTDE 2BQ6B 1YPEH 1W0ZU 2JH0D 1BMFD 2BHGA 1YPHE 1V2WT 1O3PB 3SU3A 1TGBA 1ANBA 1G3DA 1OXGA 1GJAB 2R0LA 1LHCH 2XC0A 3Q3XA 2WINI 2V0BA 3FZZA 1TA2A 3HGPA 4GLYA 1MQ5A 1IQFA 1YKTA 1HUTH 3B9FH 2RFKC 2F91A 1PJPA 2QF5A 1IQKA 1OHHD 3A8AA 1TMUH 2CK3D 2XTTB 2VIVA 1AU8A 3MU0A 3T27A 2J98A 1SLVB 2QF4A 4UFFH 1RXPA 1NFYA 1BMAA 2J4IA 1CT2E 1WV7H 2OXSA 4NWLA 3PTBA 2ZDLA 1LVBA 3W94A 1Y5UT 4BANB 3PMAB 2W7UA 5FX6A 1ZHMA 5KGOA 2GCTC 3SV7A 4UD9H 2AIQA 2GCHF 2WHXA 3B23B 3RXCA 2V7QD 1XVMA 1SQAA 4ESTE 2TIOA 1O3BA 2ILNA 3GCHB 4I8GA 4K69A 2Z3CA 1IQIA 2ZCKP 1YPGH 3D23A 2ZFPH 4KP0A 3UWJH 1A61H 4DT4A 1A46H 1O38A 1E37B 1DWBH 1HAIH 3UNRA 3VFEA 1S85A 3BTWE 3Q77A 1A1RA 3N7EA 3GDUA 1SGTA 1W7GH 1L1GA 1TX6A 1LHFH 1YM0A 3GDVA 1IQNA 3M5OA 4IC5A 4X6PA 2PV9B 1NS3A 1TRMA 1C5ZB 1CA8B 2XYAA 5DP3A 2STAE 2BTCE 4NIXA 3DD2H 4ACAA 3BTFE 3SW2B 9LPRA 1F2SE 1ZSKA 2FS9A 3ZVFA 3UB0A 3T29A 1EOJA 1T8LA 4RI0A 1KXFA 3M3TA 4Q7YA 5AFYH 5EJLA 3SO3A 3SJ9A 1AUJA 3F9FA 1GI8B 1C2LA 4Z1MD 3DSPA 4ZKSU 2XC5A 4RN6A 1GPZA 2P59A 2BLWA 1DWCH 1TYNA 1SI5H 1UJ1A 1INCA 4MNXA 4MNYA 2OQ5A 3FOAA 3DSOA 4U2WA 2ZWLH 3UPEA 1DS2E 1P8VC 3MNSA 4X8SH 2O8LA 3T5FH 3UNSA 1NRNH 3M7QA 1Z1JA 3RXHA 5C94A 5DO4H 1FONA 1V3XA 4XD7D 1S6LA 1BHXB 4DG4A 1LMWB 4WVPE 1FPHH 1FUJA 1O2MA 1QA0A 5F03A 3WWFA 2PWXA 2JH5D 1YWUA 3M61U 1QB1A 1VGCC 4U30A 4XSKU 3UOPA 3Q3KA 1C5RA 1GVZA 1S84A 2A4QA 1V2RT 1QL7A 4ZHMU 1C5LH 4X6NA 3GY6A 1DUAA 1QTFA 5GWZA 1BDAA 1ACBE 1AVGH 3SUEA 2NU2E 1C5XB 1TX7A 2F43B 2G5VA 4XDEA 1P02A 1TBRH 3SU5A 2ZCLP 1ZR0A 3BIVH 3RC6A 5FX5A 3SGQE 4FUCA 1PPEE 1KTSB 2Z7FE 2VB0A 8GCHF 1WCZA 1BTPA 1ELFA 4IMQA 1YPMH 4ASUD 1V2KT 1EOLA 4MTBA 4LZ4B 2Z9KA 1KDQA 1SGQE 1NN6A 1CGIE 1ETTH 7KMEH 3LJJA 1GBEA 4CH8B 3MO6A 2GVFA 4ZXYH 2GZ7A 2ESTE 1AFQB 4BOHA 1HBTH 3OU0A 1UTPA 2XWBI 3SZNA 1ANCA 2IJD1 4KTSA 1BCUH 1BRCE 2R3UA 2BXUH 1EQ9A 3SHCH 3GDSA 1LVYA 2R9PA 5HKKD 4XBBA 4AB9A 2F3CE 1A0HB 1FIZA 5EPYA 2OC1A 2QYIA 2KAIB 1YGCH 5I25A 3PV4A 1BITA 1PPFE 1N6XA 1K22H 3OY5U 4X2WA 2ZHDA 5CMXH 1GJ4H 5C0UA 4NCYA 1HAHH 4YO9A 1GHBF 1P2NA 2CN0H 5FL7D 5T6DA 2EI8A 2LIZA 1VJAU 1E36B 1FIWA 2ZECA 2Y5FA 1D6WA 2BQ7B 4BXWA 4FVDA 4ABFA 1GBIA 4ZUHA 3HGNA 7GCHG 1C4V2 1FV9A 3T62A 1TGTA 3PB1E 1T8NA 3PM3A 4TY6A 1G3CA 3WY8A 1OP8A 2H9EH 1EAWA 3LH3A 3UQVA 1UCYK 1UVPA 3PLPA 1BMMH 2VGCB 1O34A 4LXBH 3H7TA 3T2NA 1TB6H 3RP2A 1ESAA 1J8AA 3GY5A 1QCPA 3A80A 2Z94A 2P93A 1H8IH 5FBEA 1GBTA 3QX5H 1EASA 2ZGBH 5EXNA 1SLUB 3S9BA 4D76A 1MH0A 1MQ6A 1W0YH 3MHWU 1CBWC 3TGIE 1G37A 1UMAH 1GI6A 2VIDA 1BB0B 2BMGB 3NZIA 2Y6TA 2I6QA 3PWBA 2H5CA 1TOCB 3ZVDA 3RMNH 2B7DH 2OBOA 5PTPA 2G8TA 2XWAA 5KEDA 1DOJA 2J2UA 1Z71A 1HAYB 2FOGA 3S69A 1VITH 4KELA 1GCDA 1C5MD 2GTBA 1GMHG 3KEEA 3NCLA 1O3IA 1P9UA 1CT0E 4ASHA 4UFGH 2ZKSA 4YESB 3SYJA 1GL0E 3H7OA 1FX0B 4K2YA 1SGIB 1C2IA 3TK6A 2ANMH 3A82A 1XUJA 1TIOA 1BTZA 4Q80A 1G36A 1O5DH 7LPRA 2BLVA 2C8ZB 2ZTXA 1Y3XA 1P57B 3F2HA 3TU7H 1CVWH 1HAVB 1Z6JH 1TGSZ 1L0ZA 3RXIA 5ESTE 1O2QA 2H6MA 4FUFA 2BDGA 1BBRE 2O8MA 4DIHH 4GVUA 1GHBG 2GV6A 3A84A 3HKIB 2QXJA 2UWOA 3GCOA 3LGIA 4IC6A 2Y7XA 4ZAEA 1ELTA 4ZKOU 4YXWD 2A7JA 3SUFA 1GBJA 2G52A 1GJBB 2PTNA 1TNKA 2QY0B 4K1SA 2PGQB 3OFND 1SHYA 3MH4A 5JB9S 5JBBS 3ZZBA 3DA9B 1DUEA 4VGCC 3SQHE 4IMZA 4B74A 6CHAC 4AGKA 1S83A 1DANH 3IG6B 3ZZCA 3ZYEA 3GYMA 1C1QA 2W3IA 4BAMB 3A7VA 3SJ8A 3H09A 3AAUA 3KYFA 2AEIH 1BTYA 3ZZ7A 4BTIB 3KCGH 3SJOA 3QUMP 1TNLA 2ZA5A 1OSSA 4GHQA 4A7IB 2Q6DA 3RXTA 1BZXE 2VBCA 3AK5A 3OSYA 1JMOH 3SNCA 1RRKA 2XBVA 3D49H 4JZIA 1GJ8B 1QA7A 1B0FA 3LIWA 1K2I1 2A7CA 8KME2 1O3OA 1E38B 3ATLA 1YYY1 2XNDD 1LVOA 1FY3A 2FIRH 3ATMA 1DITH 2Y5HA 1EAXA 1C2FA 1C5NH 3LJOA 2A32A 1CA0B 1Y3VA 2QF0A 3RXQA 1W14U 4HTCH 8ESTE 1WQVH 2NU3E 4Q7XA 1LO6A 2VWLA 1D4PB 2HPPH 5DP4A 4U32A 2ZPQA 3BN9A 1F5KU 3ZZ3A 6GCHG 2LP6A 1C1SA 1AE8H 3AASA 4F4OC 3RLYH 1SSXA 1OOKB 2W6ID 2BZ6H 4YLQH 4Q63A 1UTLM 5EJ1A 1SGFA 2G81E 5EXLA 3U9AH 1ZSLA 2BD2A 3RUOA 1O36A 4AOQA 1UK4A 5FAHA 1VGCB 2XBXA 4NSYA 2RDLA 1ZJDA 4AC9A 3RXPA 1EUFA 1ZJKA 2TPIZ 2VIWA 3RC4A 4YTAA 1HXEH 5FHTA 1YY3A 5C2ZA 1CO7E 1V2JT 1VZQH 1C5PA 5EGMA 1OP2A 5AVDA 3TJUA 1KXAA 1HCGA 5C0TA 1DSUA 4X1RU 1EPTC 1W0JD 1O3CA 2OD3B 1D3PB 2ALVA 4WF8A 2BYAX 3E8LA 2P8OB 1OWIA 2ZU1A 2H9TH 3A7ZA 2TRMA 3N7DA 1WYKA 2FI3E 3OEED 1BJVA 3RXSA 1JIMA 1LKBA 2FTLE 2YMSD 1SGCA 3AW0A 2SGQE 1GHAF 1GJ5H 1SLXB 1O2LA 3SZEA 2GMTC 3F68H 1TQ7B 3LGWA 2A5IA 1QZ8A 1Q2WA 1AIXH 1EPTB 5K7RA 4I8HA 3M3VA 3M35A 1Z8IB 1LTOA 3BTQE 1Y5AT 2Y82A 1THSH 2OK5A 1WUNH 3FP7E 3NUMA 1D3TB 3PO1C 3TGJE 4IBLH 2B5TB 4GSOA 1SOZA 4JYUH 1C1VH 3UFAA 2UUKB 3QWCH 3VXEH 1CGHA 1AN1E 4Y71A 1O3MA 1BRUP 3EYDA 5JBCS 2WUCA 3AW1A 1G2MA 3ZYDA 4LZ1H 5DP5A 5TCCA 5E2OA 1DX5M 2GT8A 1O5EH 3M7TA 1OPHB 5DP7A 1FY8E 4B71A 3NWUA 2R2MB 1NZQH 3RXRA 1UHBA 2AYWA 5IDKA 2V6NA 3NPSA 1KLTA 3K9XB 1TQ0B 1T8OA 1T4UH 4SGAE 4NIYA 2ZGCA 2Z3DA 1W11U 2Z9IA 3U1IB 5LPEA 3RXLA 2WPDD 1C1OA 2FOBA 3ZVEA 2K0QA 4IS5A 4Q7ZA 3RDZA 4NA7A 3SQEE 1D6RA 1EJNA 1W13U 2VWMA 3KGPA 4CHAB 2QN5T 1O2NA 1HAOH 1EP6A 2D1JA 4I8KA 5CHBA 2BLQA 1XM1A 4AFUA 3V13A 1FN8A 2Y81A 5EJZA 5GCHF 4K3JA 2O9QA 4XRNA 3ZZ8A 4AB8A 1KDQB 1KXDA 3PLBA 1GMDG 2P3FH 4A92A 4B6FA 1VITF 1N6YA 1O2PA 3S9AA 3HK6B 4XE4A 1VCQA 4O3TA 1IAUA 1FI8A 3SNEA 4HFPB 1QGFA 2ULLA 1DLEA 1JIRA 3KF2A 1K1JA 1MU8B 3KQDA 3OE7D 2FTMA 1XKAC 3P6ZB 1H9HE 1TONA 3ODDA 2Z9LA 1Y5BT 3DFLA 3TJOA 3QDZB 2AMPA 3F0OA 3ZVAA 2ODPA 1QQ4A 1BBRH 1UVUH 5LGOA 1TBQH 1SGRE 1ZZZA 2SGFE 1GCTB 2FP7B 3QZRA 4K8BA 1QBNA 4LOYH 1QRZA 1V6DA 2RA3A 2ZFRH 3BG4C 4RT1A 1HGTH 1O2VA 2PFEA 3K6YA 1PQ8A 1J17T 2KCPA 5ETXA 5A8YA 3BEFB 3C27B 3ZV9A 3M5LA 3SGAE 1BA8B 4A5TS 2ZU4A 1C1NA 2ZHFH 1QBVH 4P02A 4MG3A 1XUIA 5GXPA 2CF8H 3KIDU 2BY9X 4NWKA 5FPSA 2BX3A 1NBME 4OS2A 4WXVA 1LDTT 1PQ5A 2QA9E 5DG6A 2A5AA 3EAJA 1EB2A 5C17A 1MTSA 3PMHB 2HVYB 1RTLA 3F0PA 2C90B 3AVZA 2PHBA 2PLXA 2ZFFH 1MKXH 3QGJA 1GBHA 3SV9A 1Z8GA 1P09A 5B6OA 1ZMJA 1O2OA 2FOFA 1GHYH 1HFDA 2BDHA 1Z1IA 4IN2A 2XW9A 2EA3A 1U6QA 4B2BA 1SQTA 2HGTH 4X1PU 1RS0A 2V3HH 3SI3H 4INKA 2G5NA 3A85A 2WZQA 4FU9A 2WYGA 3F3BA 2O8UA 4ZHAA 1GI9B 4DY7B 2BXTH 1JWTA 4Y79A 2LELA 3FVFB 1TFXA 4AFZA 4FUDA 3VGCC 5ESBA 1O2JA 4E06H 1GMCG 4TYDA 1NRPH 1W2KH 1SGYE 4D9RA 1MTWA 3Q76A 4JK6A 1A7SA 1QFKH 2C4FH 1T7CA 1LPKB 1PPBH 1A5HA
chains in the Genus database with same CATH topology
1EATA 2R3YA 2BD8A 2XBYA 1A0LA 1MZDA 2BVSH 3DUXH 5JYIA 1QJ7B 2IPHA 1KSNA 4Y7BA 1FN6A 3IWMA 1ANDA 1GVLA 1O2XA 1K9OE 1ZYOA 2CV3A 3KL6A 1GJ7B 2ZP0H 3LGVA 1IQGA 3MH6A 2A31A 1GG6C 2W5EA 2THFB 2D8WA 4DVAU 1TBZH 1QNJA 2HVXA 1HAVA 3P8OA 5DKMA 1IQJA 1SQOA 1BHXF 2FZZA 4X8UH 3G01A 5FPTA 4X1NU 1Y3UA 1ELVA 4CBOA 1JRSA 3LGYA 2GKVE 5A2MH 1XMNB 1PPZA 3URCA 5EODA 3LONA 3RXJA 4X2YA 4ABBA 1XXFA 4XBCA 4MPXA 1IQLA 3T26A 2BX4A 2JETC 4Z0KA 3R3GB 1WU1A 5EQRA 5C5OA 2WPJS 1O2RA 2UUJB 1OYTH 1MKWH 1ORFA 2F83A 5BPEA 1O2SA 2VH0A 3MOCA 1H8DH 3FAOA 1Q3XA 4WXIA 1SHHB 1DXWA 1TRNA 1ZLRA 1G3BA 2AGEX 5LPFA 3D62A 1HV7A 1MTNC 1K1OA 1P3CA 2BD3A 2P95A 1ZHRA 4AFSA 3RM0H 2YNBA 2H9HA 1GL1A 5EG4A 1BJUA 1N8OB 4D8NA 5EXMA 4Y8XA 4WMDA 2CJIA 4A1XA 2ZGXH 4NZLA 2C93B 3DFJA 1XUHA 4ZH8A 3ITIA 1SFIA 1TRYA 4RSPA 2J94A 3GCNA 3EA9A 4FVBA 3BTTE 1YP9A 3A89A 2VNTA 1EPTA 2K1QA 4OS7A 3PLKA 2HLCA 1C1MA 2DUCA 1O31A 4R0IA 1ZPBA 2VINA 1TWXB 4GPGA 1HXFH 3VB4A 1S6FA 4OS4A 1P10A 1RGQA 1MKWK 1AVXA 4INHA 2BOKA 2ZQ1A 4YLUA 4HGCA 3QN7A 1P06A 5C3NA 2ZGHA 2HOBA 3E0PB 2XCFA 3ATKA 3E3TA 2C8XB 3PYHA 5H4IB 1O2GH 1S6HA 2A4OA 3BG8A 1FAXA 1OP0A 2EEKA 2EI6A 2ZDKA 1SPJA 1UTJA 1ID5H 3MYWA 1SFQB 2AGIX 2LNCA 1NFXA 2A4RA 1S0RA 3P8GA 1EB1H 3TH2H 1ELEE 1DPOA 1NT1A 1TPOA 3SJKA 1FDPA 2ZIQH 5FCRA 3VPKA 2BDAA 1L2EA 7GCHF 2PKSB 1PPCE 1K21H 4E05H 1SMFE 1GBFA 3KQEA 1C1TA 2Q6GA 1P05A 3LGUA 3Q00A 2A45B 1ZMLA 2ANYA 1D3DB 5T6GA 2A4GA 2R0KA 3GYLB 1WBGB 2SFAA 1C1UH 1F5LA 2ZTYA 1Z6EA 2J9NA 2HNTE 5FBIA 4H6SB 2V35A 3OY6U 1GMDF 2PTCE 1GI2A 1BTHH 4ISIH 1IOEA 1H9IE 1GJ9B 3ELAH 5JDUB 1NM6A 3MNCA 4OS1A 2NWNA 1UTQA 2RA0A 2B0FA 1GI1A 1V2ST 1GDNA 5LH8A 3H5CB 5JBTA 4K5ZA 1ZHPA 1P03A 2V3OH 1O3FA 3PROA 1RTKA 4ABJA 1CA0C 4JZFH 3O8BA 3CS0A 3A7WA 3LPRA 1Y59T 1MCTA 2HRVA 1A3BH 4INLA 5EPNA 1O5GH 1P11E 3QTVH 4UFDH 4CREA 3TJNA 3LU9B 3QO6A 2UUYA 1DWDH 5C20A 4FUGA 1EJAA 1T31A 2KAIA 3M36A 1G30B 1UCYE 1DE7H 4KTUA 2BD9A 1Y8TA 1CSOE 2BQWB 3OYPA 4O3UA 2AMQA 1ZTJA 1WTGH 1C2DA 1SOTA 4DIIH 2OC0A 2VU8E 1AI8H 2FODA 1NU9A 4LK4A 3KN2A 4NIWA 3B8JA 3A7YA 6CHAB 4BAOB 1N8OC 2GDEH 5T6FA 2RCEA 3JZ1B 3RMLH 2FPZA 2FS8A 1C5TA 1XUFA 2Y80A 2ZDAH 1YPHC 4JK5A 1HAPH 2HWLB 2ZPRA 2H5DA 1V2PT 3SU2A 1CHOF 1O32A 1GG6B 3RU4D 1O2KA 4BTUB 1GJDB 4A1VA 4A6LA 4IGDA 1S0QA 1C5VA 3ZVGA 4ISHH 5L2ZH 3PWCA 3NXPA 1TGNA 2XCNA 3BTHE 3V3MA 1VCPA 2F9PA 4IN1A 2GZ8A 1A5IA 1ZGVA 1LQEA 3SU4A 1S5SA 1TA6A 2ZHEH 1HDTH 3GY8A 4DURA 5L2YH 1KY9A 1THRH 1YCPK 3RXGA 3OX7U 3SV2H 1CU1A 4BAHB 2J34A 4ABGA 4CR5A 1GI4A 2ANKH 1JOUB 1FZZA 2OBQA 3F9HA 1YBWA 1KLIH 1BUIA 2C8YB 4I8LA 1P04A 3PMBB 3AAVA 1TNGA 1QRXA 1O2IA 1PYTC 4H6TA 4IW4E 1D9IA 4JMYA 4B75A 4BNRA 1MBQA 2FDAA 1IHTH 2ZFSA 2PSYA 2Z9JA 1UCYH 2Z6BD 2PKAA 3UR6A 5GDSH 4MNWA 1GBMA 4MVNA 3A86A 1Q31A 1XUGA 1ZMNA 1BQYA 1OWDA 5CHAB 2GCHG 1BRAA 3TLOA 3SNAA 1NESE 2PW8H 5HYOA 4Q2KA 1EZUC 1O2UA 3EDXB 1TOMH 2FXRA 1AD8H 2W3KA 3QLPH 1WOFA 1O5AB 3HPTB 1BOQA 1KYNA 5T3HA 2VGCC 3UTUH 1C2KA 3E16B 4MNVA 4OS6A 4M7GA 1AFEH 4UFEH 1BRBE 1PFXC 4I33A 3LT3A 3A7XA 2BDIA 2J38A 4CRDA 1DM4B 1NFUA 4B2CA 4DT7B 5HGGA 1SC8U 1LPZB 2VIPA 3F9EA 1GJCB 1CHOG 2GT7A 2PR3A 1EAIA 3GCTF 5A0BA 1BTXA 3TNTA 4AN7A 4E7RG 3UUZA 3SGBE 2F9BH 4K60A 1BMNH 1OS8A 3LC3A 3UQOA 2AH4X 3DT0H 1K1PA 4QT8C 1AGJA 4SGBE 3V7TA 4FUJA 2ZG0H 2A0QB 2SGAA 3U1JB 3UIRA 1O3GA 1WQSA 1FPCH 1QJ1B 5CE1A 4CH2B 1V2TT 2ZU2A 4KKDA 1L1JA 2GD4B 1NRSH 1K1LA 1ESBA 2UUFB 3SV8A 1GI7B 2TGAA 1OWKA 2HNTF 3D65E 1HAZB 2VVUA 2PUXB 2ZHQH 4UDWH 1AWHB 1QRWA 1K1IA 3RXOA 1ELAA 4BTTB 1MUEB 5F6MA 1C2JA 1NROH 1QL8A 1YF4A 1Z7KA 4NSVA 3RU4T 2TGDA 3JZ2B 5DK1A 1GBDA 2PUQH 2ZEBA 2F9OA 4X1SU 4YT7H 1SL3A 4HZHA 1P0SH 4NIVA 2UWPA 1NY22 1SLWB 4WH8A 4WY3A 1P2OA 2ZC9H 3UR9A 2P94A 1FAKH 1HIAB 3U8OH 4GHTA 1P2JA 3FZDA 1MAYA 3RXKA 1AUTC 3HKJB 2C8WB 2FYRA 1YLDA 2SGDE 1C5SA 3ZZ5A 2SGPE 1GBKA 1O2WA 2AMDA 2BY8X 1JRTA 3FP6E 2HNTC 1GHZA 3TVJB 2ZDNA 3SNBA 2OLGA 1RTFB 1TPPA 3SUDA 2ZQ2A 6GCHF 1ETSH 1MZAA 1TLDA 3ESTA 3E1XB 1TNIA 3ENSB 1W10U 4ABDA 1JXPA 4XOJA 1O0DH 1EZSC 4BAKB 2Q1JA 1A3EH 1C2EA 3O8RA 4RKOB 1N1LA 4K1TA 2YOLA 3T28A 1ELBA 2WUBA 2PKSC 2QGRA 3LC5A 4CHAC 1BT7A 1XUKA 2ANWA 2SNWA 4B76A 2QC2A 3MU5A 3ZVBA 1MCVA 1C2GA 1ZRKA 3UNQA 3ZZDA 2GMTB 2R2WU 1ZTLA 1NFWA 4AYYB 5J4SA 2ZU5A 1HLTH 1GI5A 4ISOA 1DXPA 3MNBA 2O8WA 1MTUA 5JBAS 2F9UA 4ABAA 4JZ1A 4JZDH 3ZV8A 1C9TA 3MFJA 1L4DA 1W12U 3GY4A 2ZDVH 4DOQA 4ZHLU 1H9LB 3PMJA 4B2AA 3TK5A 1HPGA 1T8MA 5DP8A 4D7GA 1DY9A 2BDCA 1MBMA 2C3SA 5LPRA 4K1EA 4NFFA 1Y3YA 1QY6A 1F0UA 1GBBA 3RM2H 3EA8A 4ABEA 1F92A 1V2NT 2BOHB 2TBSA 3PO1B 2K7XA 4Y7AA 3M7UA 1O33A 1S81A 3ZZ9A 1PYTD 1J9CH 2QXIA 1A0JA 1QJ6B 4TWWA 3T25A 1E34B 1BBRK 3EE0B 1DDJA 1H4WA 4YOGA 1NU7B 1DT2A 3W95A 5FXLA 5C5NA 2QV1A 2QCYA 1TPAE 4PROA 1FMGA 1C5OH 2F9NA 1RFNA 2ODYB 1UTKA 3L6PA 1EJMA 1GGDC 4CRAA 1MD7A 1HYLA 2WV5A 1TABE 5DPAA 1RIWB 2UWLA 1O2TA 2WYJA 1YCPH 2BY6X 3RMOH 1AZ8A 1Y3WA 2YNAA 1BTUA 5GJ4B 2DE8A 2TGTA 4ZROA 4GCHF 3BTKE 1C9PA 1OWHA 2P3TB 2WPIS 2D26C 5FPYA 4NFEA 3VB3A 5A0AE 2A5KA 1A5GH 5E0JA 3GICB 1F0TA 2ALPA 1XKBC 1L4ZA 2Y5GA 2QAAA 1AVWA 3BEIB 1YPKH 3STJA 2ZO3H 5JPMH 4JCNA 4Y10E 4MDSA 4CRFA 5IYTA 4FU7A 4X8TH 1O5BB 3RXVA 9ESTA 1O37A 4Y8YA 2ODQA 1B7XB 1KXCA 3F9GA 2Z9GA 2FI5E 1E35B 1LVMA 3MO3A 3A88A 1W7XH 3GISB 2D2DA 1BMLA 1HJ9A 1J14A 4UEHH 1V2MT 1TMTH 5E0GA 2OC7A 4MPUA 5F8ZA 4I32A 3LH1A 4YT6H 3KQCA 2GCTB 5JB8S 2OCVB 2XRCA 1ETRH 1UTMA 4E7NA 1C5YB 1ELDE 1RJXB 5ABWA 1ZPZA 4O9VA 3E6PH 1F0RA 3FFGA 4X2VA 4AZ2B 1MTNB 1UO6A 1FLEE 4MLFB 5F8TA 1ESTA 2FYQA 3UY9A 2ZU3A 1VITG 3IITA 3S9CA 1M9UA 3VGCB 1IQEA 4DGJA 5I46H 1CGJE 1SB1H 4Z6AH 2OUAA 1NO9H 5HXFA 3SI4H 1O5CB 1G32B 3GY7A 1EXFA 1OX1A 2GP9B 2FWWA 1GHAG 2Q6FA 1NPMA 2XXLA 4J1YA 7ESTE 3UWIA 2LPRA 2J92A 1FY1A 3CS7A 3SJIA 4NZQA 1SR5C 5EW1H 2ASUB 3LGTA 4D7FA 2FOAA 4WMEA 1A2CH 2TGPZ 1KIGH 2XNIA 2EC9H 1L1NA 4AGJA 2JKHA 5C67A 3P92A 3E91A 3U69H 3RU4E 1FJSA 1P2MA 3HATH 3L3TA 2CMYA 2BY5X 2BY7X 3P70B 4H42U 3BTEE 5EU8A 1Z8JB 5C1XA 3QGNB 3SU1A 1GHWH 3SV6A 1KLJH 1AZZA 4YZUA 3RMMH 4MQAA 3RXAA 2FX6A 4CR9A 1GVKB 1AKSA 1ZGIA 4Y11E 5GCHG 4JZEH 1LPGB 1S82A 3ATWA 2WPLS 1C2MA 3LKWA 4CRGA 1SBWA 4X1QU 1XVOA 2ZF0H 2QIQA 1E0FD 1ELGA 1SGEE 3OTJE 1ZSJA 2NU1E 1HRTH 1ELCA 5A09A 5A8XA 1XX9A 1GHXH 2WV4A 5EW2H 2CXVA 5FCKA 2PKAB 2WPMS 1SG8B 1CHGA 2IJOB 2ZFTA 3TH4H 1C1RA 4O97A 3A8DA 1HJAC 2SNVA 3MH5A 1EKBB 2WPKS 2BDBA 5EQSA 1CQQA 1GBAA 1YPJH 1O3NA 3O8DA 5HM9A 1FY5A 3NK8A 1WSSH 3ZZ6A 4NGAH 1TNJA 4JYVH 1P01A 4RKJB 2M5TA 1ABIH 3EQ0H 2W7SA 1X7AC 1A4WH 1RD3B 3P17H 1QBOA 1QHRB 4WMFA 2VJ1A 2FI4E 4WJG2 2XBWA 1VCWA 2FX4A 1CBWB 3MWIU 3I29A 1ZOMA 1LHGH 3U8TH 1C5QA 2AERH 2FESH 3MU8A 4KGAA 1UTNA 1UTOA 3KHVA 1G3EA 3K2UA 2ZZUH 4TPYA 5GIBA 1AWFH 3M3SA 1ANEA 4X0WU 2ZNKH 3UREA 4FU8A 4CBNA 5E8EH 1O3AA 2Z3EA 1C1PA 3R0FA 6LPRA 1IQMA 2G4UA 1BIOA 3DHKH 1DVAH 5EQQA 1K1MA 4FXGH 1UK2A 1C5UA 4YOJA 3MO9A 3LOXA 1C2HA 2F9VA 2QF3A 1JBUH 3VB5A 3EGKH 2QXHA 1YPLH 1EZXC 1SGPE 4I8JA 1FY4A 4OGXA 1VJ9U 2A7HA 2WPHS 4FUEA 4GCHG 3K65B 1GHVH 1G9IE 4GUXA 1O3LA 1LHDH 3A8BA 3BIUH 6ESTA 4J2YB 1TNHA 2CHAB 2G51A 3E0NB 2P16A 4THNH 1KXEA 1SVPA 2VH6A 2FEQH 1PPHE 4AFQA 2FOEA 1T4VH 3MMGA 3C1KA 1NRRH 2NU0E 3A81A 1F0SA 4ABIA 4DJZB 2FM2A 2BD4A 1YLCA 2Y7ZA 1GBLA 1C5WB 4MPVA 1UVSH 4AG2A 2VIOA 4WH6A 1TGCA 5DP9A 1DY8A 5C1YA 2W26A 2RG3A 1UVTH 1MTVA 5AFZH 1B5GH 1GMHF 1HAXB 3V0XA 1OWJA 3N7OA 1UK3A 3TNSA 5C1UA 3MU4A 5A8ZA 3LDXH 4BAQB 2FLBH 5HMAA 3A87A 3VXFH 5L30H 2P8OC 2OTVA 3F6UH 2VWOA 4AYVB 1RIWC 1EZQA 4AORA 3ATIA 1P2KA 1GGDB 1GI3A 1P9SA 2A2QH 1G2LA 1P2QA 2FLRH 1O30A 2OQUA 3SUGA 1KXBA 3I77A 1O2ZA 1QQUA 2FOHA 4CRCA 3TGKE 1HJ8A 4FUHA 3KNXA 2GDDA 3CP7A 3P95A 1FXYA 2OP9A 1AHTH 4MPWA 1P3EA 1O2YA 3RLWH 2ZPSA 3E90B 1QB6A 3SHAH 4CRBA 1MU6B 1XXDA 2OINA 2VIQA 2FMJA 3K6ZA 3M5MA 1NC6A 3SNDA 3O8CA 3QK1A 2BZAA 5L6NH 1V2QT 1OYQA 2BD7A 4Y0YE 1AO5A 4F49A 3GCHC 1O35A 4X2XA 2GZ9A 3A7TA 2AS9A 1AKSB 1LHEH 4FUBA 2IN2A 5K0HA 2IOTA 3SORA 5E2PA 2BB4A 2CGAA 2QXGA 1GMCF 5DGJA 1V2LT 2VVV