2GX4A

Crystal structure of sars coronavirus 3cl protease inhibitor complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Structure-based design of SARS coronavirus 3CL protease inhibitor with potent anti_viral activities
rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 84
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2gx4A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gx4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gx4A02
1O2MA 3ZVAA 1V2PT 2PHBA 4NIYA 2VIPA 4GPGA 2TBSA 2XW9A 3CS0A 1SSXA 1E36B 3SJIA 1GG6C 1XXFA 1DVAH 2AGGX 3SJKA 1SHYA 3UR6A 1BITA 3AASA 5EPNA 4D9RA 4TY6A 1SLWB 1AUJA 2G5VA 1PPEE 1LQEA 1ELDE 3HPTB 1EZQA 2BDYA 1WTHD 1LDTT 1SVPA 1DT2A 2H1UA 1SGNE 1OWEA 2VGCB 5DKMA 2WPHS 1EOLA 1O31A 1C5VA 2FOAA 3RXGA 4A1VA 5CMXH 1KXAA 1XM1A 3URCA 1TPAE 4K8BA 2SNVA 3P92A 2GKVE 3F6UH 3EDXB 4I8KA 4SGBE 3LGYA 2STAE 2FOGA 1UMAH 1QY6A 1O2RA 2VWOA 3MNXA 3ZV8A 1KLIH 3HGNA 1KXBA 2QA9E 3PLPA 1PFXC 1PPGE 3KQCA 4GUXA 2DE8A 2OQUA 1HJ8A 1ZJDA 4JMYA 4LK4A 1ELGA 3A8BA 1UVUH 5ETXA 2BD4A 2ALPA 3M35A 1TRMA 1UHBA 2WV5A 1PQ8A 4MDSA 2CJIA 3LGIA 4TWWA 7GCHG 1CGJE 1EP5A 1Z6EA 4Y71A 2OLGA 1TNJA 4JZEH 2HPQH 4YOGA 2CHAC 1P0SH 5TJXA 1BBRK 1ZPCA 2AFQB 1D3DB 1TQ7B 4FXGH 3VXFH 4MNWA 4CRFA 1KSNA 4R8TB 4AFZA 3B9FH 1LVYA 1AVXA 5JYIA 1H4WA 2ZPQA 5G4BA 3QLPH 3BTGE 1P2KA 3VGCB 2P8OC 2EI8A 2VIVA 2NU3E 3M7TA 1UO6A 4BAQB 1GL1A 2G8TA 1ZSJA 3LC5A 2EA3A 2Z9KA 3TJVA 1YKTA 2BY5X 4HI3A 3A7YA 4D8NA 3Q00A 1P8VC 3ESTA 1P12E 1FUJA 1G37A 3IG6B 2BD5A 1FAXA 2TGPZ 2C4FH 1DY8A 2R9PA 5TCCA 3Q76A 1BTZA 2JETB 1AU8A 1P01A 3HK6B 4Y76A 4RSPA 4A5TS 5GIBA 1VCPA 2ODPA 1DUEA 2ZI2H 1J14A 5F8TA 1WAYB 1GG6B 5C1XA 1E35B 3GCTF 1PYTC 2ZTYA 1SG8B 2PUXB 1GGDC 1L4ZA 2JH6D 3RMMH 3F9FA 1Z8GA 3BTHE 4AFQA 1XXDA 2ANWA 3TJNA 3T26A 1EZXC 4NA7A 3S69A 1T8NA 1SI5H 3SORA 4IN1A 3GCHB 3E8LA 2FESH 1LKBA 1BB0B 3SQHE 1YF4A 4FUHA 3LOXA 1LKAA 2UUFB 1O5CB 3TVJB 3A7VA 1KTTB 3K9XB 4ABBA 8GCHG 1IQNA 2A4QA 3GYMA 2BM2A 2PUQH 1GBKA 2G51A 1S82A 2ESTE 1IQIA 1F0TA 2SFAA 2GZ7A 7ESTE 4NFEA 3A89A 5EODA 3RXAA 1T32A 3ZYEA 1FY5A 4E7RG 2QXHA 1TPSA 1EPTC 2Z9IA 3MH6A 4FUIA 4KELA 1GBTA 1GJ5H 2A5IA 1DSUA 1QBOA 3UNRA 2ZO3H 1RD3B 1YPEH 3MU1A 4MQAA 4BAKB 3LJJA 1X7AC 3ZVFA 1QGFA 2UWOA 3BN9A 4DCDA 4E7NA 3MTYA 5SGAE 3E0NB 3A7ZA 1QJ7B 2VJ1A 3GY2A 2QYIA 2ZGBH 1ZOMA 4MPUA 4AX9H 3BG4C 2P8OB 1SGTA 3STJA 1MKXK 1TBQH 1PYTD 3R0FA 1GBFA 2BYAX 2A4GA 2K7XA 1SGYE 2YOLA 4YESB 1OS8A 1C5MD 3KEEA 4ZHMU 1QL8A 1TBRH 3MFJA 4ISLA 3RXBA 1K21H 1W2KH 1G3CA 3GOVB 1A5HA 2EEKA 1EKBB 3UY9A 1QA0A 3BTME 3UNQA 3A7WA 4Q7ZA 4Q7XA 4FVBA 3GICB 1P05A 1GGDB 1YLDA 2ZHWH 4FUBA 4Y10E 1S5SA 1FY8E 2ULLA 1WYKA 2QAAA 4Q7YA 1AKSA 4O3TA 3V0XA 1K9OE 1PPBH 1LPZB 1Z8IB 3E16B 4OGXA 2D26C 1MQ6A 1V2OT 1A7SA 3RXKA 4WXIA 3PV4A 1O2VA 1TA6A 2OP9A 3TK9A 3GISB 1AD8H 1C5LH 1T4UH 2BVXH 1EXFA 2VNTA 4UFEH 3PMBB 1S6HA 1THRH 3BEFB 3M5LA 1JWTA 4Y0ZE 3P6ZB 1TFXA 1HPGA 3MU8A 3RXHA 1O38A 1RRKA 4O03A 2O9QA 3RC6A 1C5TA 1RTFB 2FOMB 1Z71A 3MMGA 3TLOA 1PQ5A 4INHA 3M36A 2PKAA 3HKIB 2UUJB 1MUEB 2BQWB 3URDA 3GY4A 1P9UA 5DK1A 3F9HA 3TNSA 1THPB 1JOUB 1DM4B 2FEQH 1PPFE 3RLWH 3E3TA 1TNLA 2A2XH 3A88A 2AIPA 4YTAA 1VITH 1QRXA 1B0FA 1HIAB 1TQ0B 1TYNA 1OWKA 1HFDA 2TGDA 3Q77A 3M5MA 3VB5A 1HAGE 2R3UA 4FUJA 1YCPK 1V6DA 2J9NA 2A0QB 2P59A 5GCHF 2JKHA 1YYY1 3OYPA 2SGAA 4NIVA 1BRCE 1IQEA 5A0AE 1HB0B 1EUFA 3SGBE 3SU2A 4A1XA 3PWBA 2A1DB 1QB9A 2AMDA 1GMDG 1UTPA 2GCTC 3QTOH 2ZDMA 8ESTE 1SFQB 2XC4A 1LQDB 2F83A 3EBNA 1QQUA 4Y6DA 1BBRH 1QB1A 1QB6A 1QRZA 1GBIA 1GDUA 3DFLA 4X8TH 2PR3A 5HYOA 5DP7A 3MWIU 4X6MA 3U1JB 1O30A 1VGCC 1TB6H 2B9LA 1FIWA 2A32A 1O2KA 3SNAA 3TU7H 4ABHA 2P3FH 3RXDA 4TYDA 1NFUA 1O2QA 1C5PA 4AB9A 1GJ6A 3MI4A 5J4QA 2ZTZA 4BTIB 4IBLH 3ZZ6A 3A7TA 5DP8A 4VGCB 1DFPA 4NWKA 3K6ZA 1MQ5A 4X1QU 3ATIA 1IQLA 1ZMNA 2F9PA 2WPJS 3RXJA 1TNKA 1C5OH 1P11E 1QURH 5EPYA 2UWPA 2GGVB 4GHQA 4OS5A 3SU4A 1L4DA 1UTLM 1O3PB 2M5TA 1P09A 3EA8A 3CENA 1BRAA 1UTNA 3W95A 2QXJA 1O34A 1BMAA 1ESTA 3QUMP 3V7TA 1Z1IA 3P8NA 4D7GA 6LPRA 7LPRA 2KAIA 1CT0E 1C9PA 1AHTH 1XVOA 2QN5T 1UTKA 4B76A 1H9HE 2BDCA 2PV9B 1C2IA 2OTVA 1GJAB 4OS4A 1GHYH 1O3EA 2ZQ2A 1SR5C 3GY7A 1KIGH 1WBGB 1RTKA 1ZR0A 4LXBH 2FZZA 4CR5A 1HXEH 1L1JA 2ZU5A 2O8MA 2BLOA 3H7TA 3TK5A 2PW8H 1D3TB 1OYQA 2HALA 1O39A 2QV1A 2ZU3A 2ZCHP 1AFQC 1TRNA 2Y7ZA 3DT0H 3A8DA 1LO6A 1GBHA 5BPEA 1IQFA 5C20A 4CHAC 1XX9A 1NPMA 4H6SB 1BZXE 1DICA 3MOCA 1QL7A 3FP7E 3M5NA 1VGCB 2VWLA 2C8ZB 4MG3A 5JB8S 3K2UA 1DWEH 1MKXH 1P04A 1TGBA 2BY8X 2VWMA 2V0BA 1GCTC 4JYTA 4OS2A 3RXMA 1TPOA 2SNWA 2GCHF 2JH5D 1SC8U 1Y3VA 4ASHA 2F9VA 1JIRA 1AWHB 2BQ6B 1HAVA 1K1OA 1TIOA 2VB0A 2WINI 2H5CA 5I46H 5HM2A 3S0NA 4IMQA 5E2OA 1Y3XA 2GP9B 1LHEH 1EB1H 2A7CA 1CGIE 3BSQA 2ZF0H 5EXLA 4DJZB 1O3HA 1BHXF 2ZDVH 5JBAS 2FX4A 3KGPA 1ZLRA 3TH3H 3RXVA 1TWXB 2BDAA 1DDJA 4AZ2B 2R2MB 1V2WT 3QGJA 1VZQH 1C1PA 4NZQA 3T62A 3V13A 4X8UH 2AYWA 3W94A 2XNIA 3BTEE 1TNHA 2R3YA 2ZWLH 1BT7A 1ZHRA 2WV4A 4X2YA 4XFQA 2W5EA 4H4FA 2ZFFH 1MBQA 1HDTH 1OX1A 1W7GH 1EZSC 1WSSH 3H5CB 4AYVB 3O8CA 2LPRA 3RP2A 3TJOA 2FX6A 4HZHA 5I25A 3D62A 5E2PA 3ZVEA 2ZA5A 1K1JA 5A8ZA 3GCOA 4JYUH 2Y80A 4ZKRU 5FBIA 4MNXA 2D1JA 2B7DH 1HAZB 2FM2A 1UK3A 2WPMS 2JH0D 4CRAA 5A09A 1NRSH 1OXGA 4X1PU 2XBXA 3E1XB 2TPIZ 1AUTC 1RFNA 3LONA 1L0ZA 4FUGA 4XE4A 3O8DA 3FANA 3SUEA 1AQ7A 1LHDH 1ARCA 1AFQB 1D6WA 3MHWU 1S0QA 1L1GA 5F03A 1O5FH 4NCYA 1YBWA 3TGJE 2ZDAH 2TGAA 4X6OA 4ABJA 3BTQE 1A5GH 4GVUA 1WUNH 1OP0A 1LHFH 3D49H 1ZPBA 1ELBA 2AS9A 3EA9A 4KP0A 4CRGA 1YCPH 1AE5A 3TNTA 4MLFB 1DXWA 1GCTB 2PSXA 1AVGH 2FTLE 3MU4A 1IQMA 3LH3A 4ABAA 1HJAC 4BAOB 4O3UA 2IOTA 1DANH 1M9UA 2OC1A 1Z8JB 3I29A 3EGKH 1DWCH 4K3JA 3O8RA 4BOHA 2QXGA 1A46H 4UE7H 2Y81A 4X8SH 1HGTH 3RC4A 3SU3A 3T5FH 4GAWA 2SGPE 7KMEH 2CN0H 3U1IB 1AZZA 3DUXH 2W7SA 5FX6A 4OS1A 1OWHA 3NK8A 4O97A 1CQQA 2XBVA 3NUMA 1LCYA 1PPCE 3ZZ7A 5B6OA 1C4U2 5EQRA 1D3QB 2STBE 3VPKA 3D23A 2FOCA 4NA8A 1EP6A 1ELAA 4Q2KA 1J9CH 2V6NA 5EQSA 2ANMH 1P2NA 5GWZA 1O2LA 2J4IA 1Z8RA 3GY6A 5L2YH 3LGTA 1TBZH 1YPJH 2A45B 1SGQE 4K5ZA 5E0GA 1C5WB 1OSSA 4WWYA 4ZXXH 2FS9A 5LGOA 3PM3A 3LGVA 2OBQA 2FPZA 1O3BA 1C5XB 4FVDA 1W0YH 1L1NA 3NCLA 2HOBA 1MU8B 4B2AA 3VFEA 3MO3A 4NZLA 1GI6A 1VITG 1KTSB 1ANEA 1GHWH 1NRQH 4IC5A 1HJ9A 3PMJA 3U8TH 1ZZZA 1ELVA 1YPMH 5HMAA 4B75A 1MCVA 1B5GH 2AERH 2GZ8A 1ETRH 2H5DA 1O3CA 1G3BA 3SBKA 1NFWA 5EG4A 3VEQB 1P2QA 1V2KT 4TY7A 2W3IA 4J2YB 1NRNH 2ZFPH 1LHCH 4IS5A 2Q1JA 1D6RA 1O3AA 1OP8A 3EYDA 3SZNA 1GJCB 1Q31A 1A2CH 1GHAG 1ABJH 1SB1H 1K1IA 1INCA 1GMHF 1HJAB 2H2ZA 2BY7X 2XC5A 4BTUB 2BD7A 3GDVA 1GJ8B 1GI8B 2A7HA 3GY3A 4I32A 1ETTH 2W26A 2FTMA 1N6XA 4ZKOU 3LU9B 4AYYB 4PROA 5H4IB 1ORFA 4I31A 1HCGA 1O2WA 1NFYA 3A82A 1A4WH 1KDQB 4CH2B 5EOKA 3S7HB 3P8GA 1YPLH 3SJ8A 3QGNB 4B73A 4XBBA 2GZ9A 2BVRH 2ASUB 1DPOA 2ANKH 2Z3CA 1QFKH 1BMLA 1DSTA 1W0ZU 2OUAA 1HAHH 1SGRE 1Y3WA 1F5RA 3Q3XA 1QR3E 1QL9A 2QF3A 4KTUA 5ESBA 3ZZ8A 2P95A 3UTUH 3PMAB 1HAYB 5DG6A 1N8OC 3LGWA 2Y6TA 4ZKNU 2OXSA 1YPHE 3MNCA 3PO1C 5ESTE 1FI8A 1MTNC 4YM9A 4KKDA 1ESAA 1GPZA 1SGIB 1P3EA 1W11U 3UOPA 4X0WU 1MAYA 1SGEE 3Q3YA 4YLQH 3ZVCA 3P8OA 1H8IH 3SNDA 1ID5H 3FP8E 5JBTA 1AB9C 2CHAB 1GI1A 1JIMA 2B0FA 3ZZCA 1DITH 3SU1A 1GHBG 3ODFA 1UK2A 2VVVA 3PYHA 1O2GH 4YLUA 1NRRH 2AGIX 3R3GB 4AGJA 2F9BH 2BXTH 4JK5A 3PMHB 1BDAA 1WQVH 2VIQA 1OWIA 2VH0A 1DLKB 1TABE 3QZRA 1Y3UA 3TH4H 3AW0A 2LIZA 4K1EA 1IHTH 2SGEE 3DFJA 3ATWA 4O9VA 4CRBA 4ZROA 3S7KB 3V12A 1P2OA 1XUGA 4AGKA 3GYLB 1BTXA 4AG2A 3OU0A 3AAVA 1RS0A 5T6DA 1C2HA 4FUDA 3KQDA 3VB6A 2BDIA 4LZ1H 1FPHH 1W8BH 1O5DH 1MH0A 1O33A 4NIWA 4YZUA 1AN1E 2BX4A 3IWMA 2AH4X 3BTFE 3SW2B 3ZZAA 4IN2A 1O37A 2SGQE 2F9OA 3ZVBA 1OYTH 1DY9A 4FUEA 1S81A 1P2JA 4YT7H 2A2QH 1BMNH 2R0KA 2F9NA 1H9LB 5C5OA 1HNEE 3MH4A 3L3TA 1CHOG 1EJMA 3SHCH 1TX6A 3P95A 4CRDA 3KL6A 1GHXH 3MU5A 3KN2A 1EAUA 2XRCA 1GDQA 5EXNA 2Y5FA 4ABGA 3BTDE 1O5AB 1QJ1B 1UHBB 1GL0E 5E0JA 1V2NT 3UR9A 1WU1A 3QZQA 2H9HA 2BZAA 2WYGA 2FS8A 1K1MA 1O2PA 1C9TA 1D4PB 1WCZA 1Z7KA 5T6GA 1O2JA 3LJOA 3SJOA 1MTNB 1BRUP 1C1RA 1EPTB 5FPTA 1G3EA 3SI4H 1Z6JH 5EW2H 3RLYH 2OD3B 3RXOA 2CMYA 2FXRA 3T29A 1EZUC 4U2WA 3SU6A 2ZHFH 1AE8H 3SHAH 5A2MH 1WTGH 2GV7A 5C2ZA 2PGBB 2UWLA 1F92A 2RA0A 3TJUA 1YCPM 1GVZA 1C5RA 4WMFA 1O3NA 3WY8A 1C1UH 1YM0A 4CRCA 2HVXA 1LHGH 4DGJA 2ZHDA 2F3CE 1A0JA 1DXPA 3BG4B 1P2MA 4WMDA 3RMLH 6GCHG 4GCHF 1DX5M 3ZVDA 2RA3A 1GMCG 1BJVA 1GVLA 2PTNA 4M7GA 5GJ4B 1ACBE 1BUIA 3STIA 1LPKB 4CBNA 3ODDA 2XBWA 3T2NA 2O8UA 1N6YA 2R2WU 1NN6A 1NU9A 3LT3A 1DOJA 1XKAC 2C8WB 4WH8A 2ZHEH 1DWBH 1GWAA 2ZZUH 1CA0C 3VB7A 2OQ5A 1CA8B 1ETSH 2RDLA 3PB1E 5A0BA 4X1SU 4E06H 3T25A 2W3KA 1WOFA 2J94A 1FMGA 3HATH 1BHXB 4ABEA 2J95A 3AVZA 3RXLA 1O2HA 4I33A 1V2RT 3RXIA 1ELCA 3KIDU 2BTCE 1A61H 3UREA 3LDXH 1ABIH 3O8BA 2HGTH 1F5KU 1K2I1 2FDAA 3ELAH 4UONA 3F9EA 1PPHE 3M61U 1RJXB 4FUCA 2EC9H 3PROA 2XWBI 1GVKB 5K0HA 1O3DA 1C1MA 1TOMH 1SQAA 3FP6E 4A6LA 1GI9B 3IITA 9ESTA 1GBLA 3SNBA 2P3TB 1GHVH 2H9TH 1QA7A 4XBCA 3GCTG 1GBMA 3OY5U 4KTSA 1NTPA 4ZHLU 2ZHQH 1SLVB 1Q3XA 3LIWA 1ELTA 2BVSH 1CVWH 1ARBA 1TNGA 3A87A 1C2DA 2ZGXH 2G4TA 1QIXB 3A81A 1CBWC 4K2YA 5E8EH 3I78A 3M3TA 4DOQA 3DHKH 1SOZA 2O8WA 1ANDA 1HRTH 2TGTA 3GY5A 5GDSH 1NC6A 3E91A 1AGJA 1GJ9B 6CHAC 1K22H 7GCHF 1W14U 1PJPA 4WVPE 3M3VA 3G01A 5C5NA 2FI4E 3SU5A 3LPRA 4A7IB 1V2ST 4ESTE 1LVMA 1C5QA 2AIQA 1YC0A 4LZ4B 1SFIA 1ZGVA 3C27B 3U8OH 5C67A 2ZU4A 4RKOB 4OS7A 4DURA 2XXLA 1OP2A 4ISIH 1HAIH 2NU1E 2ZIQH 2GCTB 2TRMA 1WV7H 1D9IA 2J38A 1GI4A 2ZGJA 2EI7A 1CA0B 2BY6X 1NU7B 1UTMA 4K1SA 2O8TA 3A84A 5JDUB 4MNVA 1O3GA 1Y8TA 1FJSA 3M7QA 1SGCA 4UD9H 1F5LA 1EB2A 2FLRH 4FU7A 1ZMLA 1VR1H 3A86A 4CH8B 1H9IE 1K1LA 2EI6A 4JZIA 1XUJA 2FI5E 3FFGA 1GBCA 5IDKA 1PQAA 1SGPE 4OGYA 4AORA 3UOUA 3ZZ5A 5DGJA 3ATLA 1GI3A 1HUTH 5AFYH 3EAJA 1TGSZ 1LVBA 1XVMA 2BDHA 1MD8A 3UNSA 3U8RH 2GV6A 3SGQE 1MTSA 2DE9A 3EQ0H 3KQEA 4K1TA 1K1NA 1S6FA 4ABFA 3VXEH 4D7FA 3FZDA 5J4SA 5C3NA 1J17T 1MTVA 1NO9H 3TGIE 4TPYA 1QRWA 1O2IA 1TLDA 2C90B 1SMFE 2P94A 3D65E 4AN7A 2CF9H 3M5OA 1MAXA 2PSYA 1P2IA 3F9GA 1IQHA 4B2BA 3RU4T 8GCHF 1O0DH 1SOTA 5FPSA 1FN6A 1TAWA 1ZYOA 1SLXB 4E05H 3B8JA 1DLEA 2UUYA 2ANYA 4X2XA 1VJAU 1BQYA 1GBDA 4DIHH 2V3OH 2VINA 1F7ZA 1KXFA 5DP4A 1F2SE 2ZDKA 5EGMA 4BXSA 1FY4A 3BG8A 1SQOA 3SUDA 1ZJKA 2ZFRH 4THNH 3JZ1B 1T4VH 1MBMA 1RTLA 3KHVA 2AMPA 1H1BA 4XBDA 1WQSA 2A4RA 5ABWA 1EJAA 4IGDA 1SPJA 1TOCB 1QHRB 2ZTXA 3BIVH 1B0EA 2WUCA 1TX8A 1XUKA 3OSYA 1TRYA 1T7CA 2FMJA 3RMNH 3SO3A 2FI3E 1C2FA 3A80A 3LKWA 2NU0E 3ZZDA 1O2YA 3MO6A 1S84A 3ZZ9A 2WPLS 4JZ1A 4WXVA 4BTTB 4CHAB 3QN7A 1VJ9U 2ZFSA 1ANBA 2VU8E 1T8MA 5JPMH 4RN6A 3RM2H 3RU4D 2BMGB 5FAHA 1C2MA 3BEUA 1O3JA 3GDUA 3S9CA 2TIOA 3E90B 5C1YA 4D9QA 3MH5A 1FNIA 2QGRA 1NT1A 5GCHG 1VCQA 2FOBA 3KQBA 1GJ4H 2A7JA 2VIOA 1AWFH 2ZFTA 1O2XA 3RU4E 2PTCE 3M7UA 1G36A 1F0SA 5C1UA 1KY9A 5HXFA 2NWNA 2GD4B 3RUOA 2WPIS 5F8XA 3TGKE 1GI2A 1T8LA 2ZFQH 1XKBC 3A85A 1GCDA 1P9SA 1RIWC 1EATA 2Y82A 1UVTH 2ZCLP 3K6YA 1G32B 2VVCA 1P10A 1GI0A 4NGAH 3U69H 1G9IE 1B7XB 2FODA 4UFFH 4J1YA 1BMMH 1TPPA 4INLA 4U30A 4YO9A 2ZKSA 2BLVA 1T8OA 2KAIB 2BY9X 3KNXA 1G3DA 3QK1A 3DD2H 5EXMA 2QCYA 2GMTC 1W3CA 1SQTA 3SN8A 4Y7AA 1UTJA 2BLWA 2HRVA 1ZPZA 2ZEBA 4TPIZ 1MZAA 3QO6A 1C2LA 1CT4E 1QBVH 1OPHB 2FYRA 4K60A 4LOYH 1AY6H 3C1KA 4MVNA 1A0LA 5T6FA 2ZU1A 3L33A 4ZUHA 3NZIA 3ENSB 4JYVH 2PFEA 2P16A 1IQGA 3JZ2B 3GCHC 1P3CA 1EJNA 4AFUA 2BXUH 3A8AA 3RMOH 2G55A 1E38B 1O2ZA 3VB3A 1UK4A 1EX3A 2VH6A 3VB4A 3Q3KA 3ATKA 1QNJA 2Z9JA 1GBEA 5FHTA 6GCHF 1YPHC 1GBBA 1IAUA 1GMCF 8KME2 1O36A 3AAUA 2B5TB 1HAPH 2FOEA 1C1OA 4BXWA 1RGQA 1N1LA 1GMDF 3P17H 2Z9LA 1FONA 4I8HA 1P03A 2ODQA 2VIWA 4XSKU 3UWJH 1HAVB 4GLYA 4SGAE 4YOJA 3SV2H 2VIDA 5L30H 4XDEA 3MU0A 3GCNA 1EPTA 4X8VH 5FX5A 1SBWA 4BNRA 5AF9H 3RXCA 1AIXH 1MTUA 1EOJA 1K28D 2G52A 2A5AA 2BD9A 8LPRA 3UUZA 2SGFE 1V2JT 1RIWB 1FIZA 1IOEA 2ZU2A 5E0HA 2P3UB 1TGNA 1HIAA 4BANB 1V2LT 4ABIA 1MZDA 1Y59T 1BTPA 1W10U 1UTOA 1BTUA 2BX3A 3BTKE 1V2MT 3AW1A 1O2TA 1W13U 4ZMAH 2XCFA 1XUFA 2J34A 1C1VH 2DUCA 3RXQA 1GJBB 4MPWA 5L2ZH 2D8WA 4WH6A 4X1RU 4Z6AH 1O5EH 2GMTB 5HGGA 2ZPSA 1TGTA 2GCHG 1HLTH 2ZGHA 3S9BA 5HM9A 1MCTA 2Y5GA 2Z3DA 1T31A 2BD3A 2YNAA 3ITIA 1O2SA 4Y0YE 3CP7A 4IW4E 2QF0A 5CHAC 1MKWK 1GI5A 2K1QA 3RXFA 2HNTF 2ALVA 3EE0B 4AB8A 2Q6FA 2CXVA 4MPVA 3HKJB 1A3EH 4NIXA 2LNCA 3PLKA 1FZZA 1TE0A 4NSVA 1TMUH 3V3MA 1O3IA 1O2OA 2V3HH 2ZNKH 3RDZA 1AZ8A 2C8YB 2FOFA 4F4OC 1BIOA 1W7XH 1CSOE 1BRBE 1AO5A 1FLEE 1BOQA 5EU8A 3NPSA 1XUIA 1CHGA 2WYJA 1FN8A 3F1SB 1JBUH 1FY3A 5JB9S 2Q6DA 2J2UA 1DS2E 2G81E 3PTBA 3SOSA 2OC7A 3LH1A 3SV9A 1P06A 1NY22 5AHGH 1A3BH 1V2QT 3KF2A 4H6TA 1EQ9A 1IQJA 1L2EA 3A8CA 3F68H 3SNCA 2XTTB 1OWDA 3RXSA 2PGQB 2G4UA 2AMQA 3SJ9A 5L6NH 1YPKH 1NS3A 1UVPA 3ZV9A 2WPKS 2SGDE 4OS6A 2F9UA 2J92A 1TMTH 3FZZA 1LVOA 1K1PA 2VVUA 1O32A 2AEIH 1IHSH 1ZTLA 1KXCA 1C2JA 3L6PA 2UUKB 1JXPA 4KTCA 5K7RA 1BTYA 2PLXA 1EAXA 1C5NH 2RCEA 1CU1A 5JBCS 2Z94A 1AMHA 3BV9B 5DP6A 4DT7B 1UCYK 4IC6A 4K69A 1CGHA 3TK6A 4MNYA 3U9AH 3K65B 4ZHAA 4K8YA 1THSH 1OKXA 1C5SA 2VWNA 1A0HB 1C2GA 1DE7H 3SV6A 1XUHA 5LPEA 4F49A 2O8LA 1HXFH 2G5NA 5CHAB 3RXEA 3RXUA 3U98H 2Z7FE 1W12U 1BA8B 2BDBA 4Y8XA 1C2KA 5BRRE 3UQOA 1FQ3A 1QTFA 5EQQA 5FCKA 1N8OB 1BCUH 3MYWA 1Y5UT 4NA9H 1DUAA 1ZHMA 3B23B 3PO1B 2YNBA 3QTVH 3TIUA 1ZRBA 4VGCC 9LPRA 2GDDA 3SUFA 2QY0B 1O3FA 1TMBH 3UFAA 1E0FD 3FVFB 1VCWA 5GPIB 4JZDH 1QQ4A 5FPYA 4A1TA 1ZGIA 1TGCA 1JRSA 3OTJE 1BBRE 1FY1A 3BIUH 1AB9B 4X6PA 4NG9H 4WY3A 3T28A 1J16A 2PWXA 1O3LA 2BOKA 4BAMB 2C8XB 3N7OA 1O3OA 1A1RA 5DPAA 4CBOA 2ZDLA 1ELFA 1BTHH 2XWAA 3RM0H 1FV9A 4CREA 1KXEA 2CGAA 3SI3H 2GTBA 1AFEH 2BD2A 3ZZBA 2BQ7B 5FCRA 1MD7A 4UFDH 3MNSA 1KXDA 4NFFA 1SGDE 2ZP0H 1TALA 1TX7A 4ABDA 1GBJA 1E37B 1QBNA 4FUFA 4ISOA 4ISHH 3RC5A 3BTTE 1BTWA 1FPCH 5IYTA 3NWUA 1C5YB 2FO9A 4AFSA 3PLBA 5DP5A 4DW2U 2W7UA 3MNBA 2C3SA 4X2WA 3SV7A 1UVOA 5A8YA 1G2MA 1U6QA 1Y3YA 3EA7A 3UIRA 2Z3EA 1EAWA 1C4Y2 4B71A 2F91A 2QIQA 1UTQA 1A5IA 3TPIZ 1DWDH 1EAIA 2ZCKP 2C93B 3UPEA 4Z0KA 2BHGA 3M37A 2GT8A 1P02A 3RXRA 1OOKB 2BOHB 3ZVGA 2A31A 2IPHA 4Y8YA 1GMHG 3T27A 3OX7U 2PKSC 1RXPA 3FAOA 1G30B 1SHHB 1ZSLA 3UWIA 1LPGB 1NROH 1S0RA 1SGFG 1SGFA 2FP7B 1V3XA 1GJDB 3QDZB 2D2DA 1LMWB 1UVSH 2XYAA 4I8GA 5FXLA 2IN2A 5DP9A 1F0RA 1QCPA 6ESTA 4UEHH 4D76A 4UFGH 1ELEE 4Y79A 4MTBA 1YGCH 1C1SA 1QJ6B 3E0PB 1HYLA 2XCNA 3LGUA 1S85A 3RXPA 2THFB 4MPXA 1VITF 1C1WH 2XC0A 1HBTH 1MKWH 1C1QA 1C4V2 4ZAEA 1NZQH 3GY8A 1HV7A 2BB4A 1CO7E 2Y7XA 4X1NU 1O3MA 1YPGH 4X6NA 2ZDNA 1D3PB 1NFXA 3KCGH 4GSOA 3GDSA 1PQ7A 4IMZA 3ZZ4A 2QXIA 2FYQA 2CF8H 1E34B 3BEIB 3RXTA 1Z1JA 2R0LA 2A4OA 3SUGA 2RG3A 3H7OA 3NKKA 1UCYE 2FWWA 5A0CA 1C1TA 1ZSKA 4DY7B 2BD8A 5FBEA 1TA2A 2GT7A 2HWLB 4WF8A 4ISNA 2ZECA 2ODYB 1MU6B 1AKSB 1V2TT 4GHTA 3SV8A 2NU4E 3LC3A 1GHAF 2Z6BD 1GI7B 5LH8A 1O3KA 4YT6H 3TITA 1ZRKA 4B74A 4UDWH 1KLJH 3I77A 3BF6H 1FDPA 2H9EH 4HTCH 3PTNA 1ZMJA 4A92A 1O5BB 5EW1H 1O5GH 2I6SA 4ZXYH 2H6MA 2ILNA 3OY6U 5TCAA 5LPRA 3ZZ3A 4JZFH 1HAXB 3MO9A 1TONA 2Z9GA 2I6QA 5A8XA 3NXPA 1GJ7B 1C1NA 5CE1A 2G00A 2PKAB 4U32A 4Y11E 1CE5A 1O35A 2PKSB 5LPFA 4YOIA 2BLQA 1OWJA 1FAKH 1ANCA 2ZPRA 5DO4H 1NRPH 2BDGA 1Y5BT 1G2LA 1JMOH 2HNTC 5DP3A 3DA9B 3M3SA 1HAOH 3CS7A 4NWLA 4I8LA 2AGEX 2P93A 2OC8A 4R0IA 1AVWA 1BJUA 1UCYH 1UJ1A 1V2UT 2GVFA 2ZQ1A 4CR9A 4ZH8A 5F8ZA 1Q2WA 4I8JA 1ZTJA 2OCVB 1NM6A 2GX4A 4WMEA 2OC0A 1CBWB 1GHZA 3TH2H 3PWCA 4TWYA 3SNEA 1F0UA 2HPPH 2ZG0H 1C5ZB 1FXYA 4AOQA 2ZGCA 4DIIH 4QT8C 4I7YH 1ZTKA 2IJOB 6CHAB 2OINA 3HK3B 3SU0A 1AI8H 1NESE 1O2NA 2VGCC 1KYNA 1KDQA 4JCNA 4BAHB 4XOJA 5T3HA 1O2UA 1IQKA 1ESBA 2FOHA 2GDEH 3A7XA 3SGAE 4KGAA 4DG4A 1LTOA 3UQVA 1GHBF 3QWCH 3E6PH 5PTPA 4B2CA 5AVDA 1KLTA 1J15A 2FLBH 1SLUB 1V2VT 3QX5H 4X2VA 2OBOA 2B8OH 2Y5HA 1H8DH 3A83A 4HGCA 1EASA 1JRTA 2ZC9H 2QC2A 1S83A 1GDNA 4B1TA 2V35A 4ZKSU 1J8AA 3MH7A 4FU8A 3HGPA 4FU9A 3P8FA 4Y7BA 2FIRH 2BZ6H 1CT2E 1SL3A 1TNIA 4WJG2 2CV3A 5JBBS 4GCHG 2WUBA 1C5UA 3P70B 4RKJB 3SQEE 1PPZA 2NU2E 1C2EA 4INKA 3BTWE 5AFZH 2Q6GA 4HFPB 5GXPA 3ZYDA 4Q80A 2HNTE 3ATMA 1XMNB 4NSYA 3VGCC 2XBYA 4DVAU 1GBAA 1MMJN 2A5KA 1MTWA 1CHOF 1P57B 4AG1A 2HLCA 4Y8ZA 1YP9A 1ZHPA 5DJ7A 1YLCA 1Y5AT 5F6MA 4JK6A 3S9AA 4H42U 2JETC 4U01A
chains in the Genus database with same CATH superfamily
1O2MA 3ZVAA 1V2PT 2PHBA 4NIYA 2VIPA 4GPGA 2TBSA 2XW9A 3CS0A 1SSXA 1E36B 3SJIA 1GG6C 1XXFA 1DVAH 2AGGX 3SJKA 1SHYA 3UR6A 1BITA 3PRBA 3AASA 5EPNA 4D9RA 4TY6A 1SLWB 1AUJA 2G5VA 1PPEE 3DCLA 1LQEA 1ELDE 3HPTB 1EZQA 2BDYA 8LPRA 1WTHD 1LDTT 1SVPA 1DT2A 2H1UA 1SGNE 1OWEA 2VGCB 5DKMA 2WPHS 1EOLA 1O31A 1C5VA 2FOAA 3RXGA 4A1VA 5CMXH 1KXAA 1XM1A 3URCA 1TPAE 4K8BA 2SNVA 3P92A 2GKVE 3F6UH 3EDXB 5B6LA 4I8KA 4SGBE 3LGYA 2STAE 2FOGA 1UMAH 1QY6A 2IJD1 1O2RA 2VWOA 3MNXA 3ZV8A 1KLIH 3HGNA 1KXBA 2QA9E 3PLPA 1PFXC 1PPGE 3KQCA 4GUXA 2DE8A 2OQUA 1HJ8A 1ZJDA 4JMYA 4LK4A 1ELGA 3A8BA 1UVUH 5ETXA 2BD4A 2ALPA 3M35A 1TRMA 1UHBA 2WV5A 1PQ8A 4MDSA 2CJIA 3LGIA 4TWWA 7GCHG 1CGJE 1EP5A 1Z6EA 4Y71A 2OLGA 1TNJA 2J5UA 4JZEH 2HPQH 4YOGA 2CHAC 1P0SH 5TJXA 1BBRK 1ZPCA 2AFQB 1D3DB 1TQ7B 4FXGH 3VXFH 4MNWA 4CRFA 1KSNA 4R8TB 4AFZA 3B9FH 1LVYA 1AVXA 5JYIA 1H4WA 2ZPQA 5G4BA 3QLPH 4XRNA 3BTGE 1P2KA 3VGCB 2P8OC 2EI8A 2VIVA 2NU3E 3M7TA 1UO6A 4BAQB 1GL1A 2G8TA 1ZSJA 3LC5A 2EA3A 2Z9KA 3TJVA 1YKTA 2BY5X 3AK5A 4HI3A 3A7YA 4D8NA 3Q00A 1E1RD 1P8VC 3ESTA 1P12E 1FUJA 1G37A 3WWBA 3IG6B 2BD5A 1FAXA 2TGPZ 2C4FH 1DY8A 2R9PA 5TCCA 3Q76A 1BTZA 2JETB 1AU8A 1P01A 3HK6B 2OK5A 4Y76A 4RSPA 4A5TS 5GIBA 1VCPA 2ODPA 1DUEA 2ZI2H 1J14A 5F8TA 1WAYB 1GG6B 5C1XA 1E35B 3GCTF 1PYTC 2ZTYA 1SG8B 2PUXB 1GGDC 1L4ZA 2JH6D 3RMMH 4ZCNA 3F9FA 1Z8GA 3BTHE 4AFQA 1XXDA 2ANWA 4FOUC 3DSOA 3TJNA 3T26A 1EZXC 4NA7A 3S69A 1T8NA 1SI5H 3SORA 4IN1A 3GCHB 3E8LA 2FESH 1LKBA 1BB0B 3SQHE 1YF4A 4FUHA 3LOXA 1LKAA 3OE7D 2UUFB 1O5CB 3TVJB 3A7VA 1KTTB 3K9XB 4ABBA 8GCHG 1IQNA 2A4QA 3GYMA 2BM2A 2PUQH 1GBKA 2G51A 1S82A 2ESTE 1VKYA 1IQIA 1F0TA 2SFAA 2GZ7A 7ESTE 4NFEA 3A89A 5EODA 3RXAA 1T32A 3ZYEA 1FY5A 4E7RG 2QXHA 1TPSA 1EPTC 2Z9IA 3MH6A 4FUIA 4KELA 1GBTA 1GJ5H 2HLDD 2J97A 2A5IA 1DSUA 1QBOA 3UNRA 2ZO3H 1RD3B 1YPEH 3MU1A 4MQAA 4BAKB 3LJJA 1X7AC 3ZVFA 1QGFA 2QF4A 2UWOA 3BN9A 4DCDA 4E7NA 3MTYA 5SGAE 3E0NB 3A7ZA 1QJ7B 2VJ1A 2EY4C 3GY2A 2QYIA 2ZGBH 1ZOMA 4MPUA 4AX9H 3BG4C 2P8OB 1SGTA 3STJA 1MKXK 1TBQH 1PYTD 2PP6A 3R0FA 1GBFA 2BYAX 2A4GA 2K7XA 1SGYE 2YOLA 4YESB 1OS8A 1C5MD 3KEEA 4ZHMU 1QL8A 1TBRH 3MFJA 4ISLA 3RXBA 1K21H 1W2KH 1G3CA 3GOVB 1A5HA 2EEKA 1EKBB 3UY9A 1QA0A 3BTME 3UNQA 3A7WA 4Q7ZA 4Q7XA 4FVBA 3GICB 1P05A 1GGDB 1YLDA 2ZHWH 4FUBA 4Y10E 1S5SA 1FY8E 2ULLA 1WYKA 2L74A 2QAAA 4Q7YA 1AKSA 4O3TA 3V0XA 1K9OE 1PPBH 1LPZB 1Z8IB 3E16B 4OGXA 2D26C 2JDID 1MQ6A 1V2OT 1A7SA 3RXKA 4WXIA 3PV4A 1O2VA 1TA6A 2OP9A 3TK9A 3GISB 1AD8H 1C5LH 1T4UH 2BVXH 2HVYB 1EXFA 2VNTA 4UFEH 3PMBB 1S6HA 1THRH 3BEFB 4XD7D 3M5LA 1JWTA 4Y0ZE 3P6ZB 1TFXA 1HPGA 3MU8A 3RXHA 1O38A 1RRKA 4O03A 2O9QA 3RC6A 1C5TA 1RTFB 2FOMB 1Z71A 3MMGA 3TLOA 1PQ5A 4INHA 3M36A 2PKAA 3HKIB 2UUJB 1MUEB 2BQWB 3URDA 3GY4A 1P9UA 5DK1A 3F9HA 3TNSA 1THPB 1JOUB 5KECA 1DM4B 2FEQH 1PPFE 3RLWH 3E3TA 3KQ5A 1TNLA 2A2XH 3A88A 2AIPA 4YTAA 1VITH 1QRXA 1B0FA 1HIAB 1TQ0B 1TYNA 1OWKA 1HFDA 2TGDA 3Q77A 3M5MA 3VB5A 1HAGE 2R3UA 4FUJA 1YCPK 1V6DA 5C17A 2J9NA 2KR7A 2A0QB 2P59A 3W1EA 5GCHF 2JKHA 1YYY1 3OYPA 2SGAA 4NIVA 2YMSB 1BRCE 1IQEA 5A0AE 1HB0B 1EUFA 3SGBE 3SU2A 4A1XA 3PWBA 2A1DB 1QB9A 2AMDA 1GMDG 1UTPA 2GCTC 3QTOH 2ZDMA 8ESTE 1SFQB 2XC4A 1LQDB 2F83A 3EBNA 1QQUA 4Y6DA 1BBRH 1QB1A 1QB6A 1QRZA 1GBIA 1GDUA 3DFLA 4X8TH 2PR3A 5HYOA 5DP7A 3MWIU 4X6MA 3U1JB 1O30A 1VGCC 1TB6H 2B9LA 1FIWA 2A32A 1O2KA 3SNAA 3TU7H 4ABHA 2P3FH 3RXDA 4TYDA 1NFUA 1O2QA 1C5PA 4AB9A 1GJ6A 3MI4A 5J4QA 2ZTZA 4BTIB 4IBLH 3ZZ6A 3A7TA 5DP8A 4VGCB 1DFPA 4NWKA 3K6ZA 1MQ5A 4X1QU 3ATIA 1IQLA 1ZMNA 2F9PA 2WPJS 3RXJA 1TNKA 1C5OH 1P11E 1QURH 5EPYA 2UWPA 2GGVB 4GHQA 4OS5A 3SU4A 1L4DA 1UTLM 1O3PB 2M5TA 1P09A 3EA8A 3CENA 1BRAA 1UTNA 3W95A 2QXJA 1O34A 1BMAA 1ESTA 2WPDD 3QUMP 3V7TA 1Z1IA 3P8NA 4D7GA 6LPRA 7LPRA 2KAIA 1CT0E 1C9PA 1AHTH 1XVOA 2QN5T 1UTKA 4B76A 1H9HE 2BDCA 2KZ4A 2PV9B 1C2IA 2OTVA 1GJAB 4OS4A 1GHYH 1O3EA 2ZQ2A 1SR5C 3GY7A 1KIGH 1WBGB 1RTKA 2EQNA 1ZR0A 4LXBH 2FZZA 4CR5A 1HXEH 1L1JA 2ZU5A 2O8MA 2BLOA 3H7TA 3TK5A 2PW8H 1D3TB 1OYQA 2HALA 1O39A 2QV1A 2RDEA 2ZU3A 2ZCHP 1AFQC 1TRNA 2Y7ZA 3DT0H 3A8DA 1LO6A 1GBHA 5BPEA 1IQFA 5C20A 4CHAC 3N7DA 1XX9A 1NPMA 4H6SB 1BZXE 1DICA 3MOCA 1QL7A 3FP7E 3M5NA 1VGCB 2VWLA 2C8ZB 4MG3A 5JB8S 3K2UA 1DWEH 1MKXH 1P04A 1TGBA 2BY8X 2VWMA 2V0BA 1GCTC 4JYTA 4OS2A 3RXMA 1TPOA 2SNWA 2GCHF 2JH5D 1SC8U 1Y3VA 4ASHA 2F9VA 1JIRA 1AWHB 2BQ6B 1HAVA 3OAAD 1K1OA 1TIOA 2VB0A 2WINI 2H5CA 5I46H 5HM2A 3S0NA 4IMQA 5E2OA 1Y3XA 2GP9B 1LHEH 1EB1H 2A7CA 1CGIE 3BSQA 2ZF0H 5EXLA 2J98B 4DJZB 1O3HA 1BHXF 2ZDVH 5JBAS 2FX4A 3KGPA 1ZLRA 2KM0A 3TH3H 3RXVA 1TWXB 2BDAA 1DDJA 4AZ2B 2R2MB 1V2WT 3QGJA 1VZQH 1C1PA 4NZQA 3T62A 3V13A 4X8UH 2AYWA 3W94A 2XNIA 3BTEE 1TNHA 4Q4LA 2R3YA 2ZWLH 1BT7A 1ZHRA 2WV4A 4X2YA 4XFQA 2W5EA 4H4FA 2ZFFH 1MBQA 3U28C 1HDTH 1OX1A 1MABB 1W7GH 1EZSC 4B6EA 1WSSH 3H5CB 4AYVB 3O8CA 2LPRA 3RP2A 3TJOA 2FX6A 4HZHA 5I25A 3D62A 5E2PA 3ZVEA 2ZA5A 1K1JA 5A8ZA 3GCOA 4JYUH 3PV2A 2Y80A 4ZKRU 5FBIA 3F0OA 4MNXA 2D1JA 2B7DH 1HAZB 2FM2A 1UK3A 2WPMS 2JH0D 4CRAA 5A09A 1NRSH 1OXGA 4X1PU 2XBXA 3E1XB 2TPIZ 1AUTC 1RFNA 3LONA 5EIYA 5HIYA 1L0ZA 4FUGA 4XE4A 3O8DA 5KGOA 3FANA 3SUEA 1AQ7A 1LHDH 1ARCA 1AFQB 1D6WA 3MHWU 1S0QA 1L1GA 5F03A 1O5FH 4NCYA 1YBWA 3TGJE 2ZDAH 2TGAA 4X6OA 4ABJA 3BTQE 1A5GH 4GVUA 1WUNH 1OP0A 1LHFH 3D49H 1ZPBA 1ELBA 2AS9A 3EA9A 4KP0A 4CRGA 1YCPH 1AE5A 3TNTA 4MLFB 1DXWA 1GCTB 2PSXA 1AVGH 2XOKD 2FTLE 2QF5A 3MU4A 1IQMA 3LH3A 4ABAA 1HJAC 4BAOB 4O3UA 2IOTA 1DANH 1M9UA 2OC1A 1Z8JB 3I29A 3EGKH 1DWCH 4K3JA 3O8RA 4BOHA 2QXGA 1A46H 4UE7H 2Y81A 4X8SH 1HGTH 3RC4A 3SU3A 3T5FH 4GAWA 2SGPE 7KMEH 2CN0H 3U1IB 1AZZA 1YY3A 3DUXH 2W7SA 5FX6A 4OS1A 1OWHA 3NK8A 4O97A 1CQQA 2XBVA 3NUMA 1LCYA 1PPCE 5HIZA 5B6OA 3ZZ7A 1C4U2 5EQRA 1D3QB 2STBE 3VPKA 3D23A 2FOCA 4NA8A 1EP6A 3N99A 1ELAA 4Q2KA 1J9CH 2V6NA 5EQSA 2ANMH 1P2NA 5GWZA 1O2LA 2J4IA 1Z8RA 3GY6A 5L2YH 3LGTA 1TBZH 1YPJH 2A45B 1SGQE 4K5ZA 5E0GA 1C5WB 1OSSA 4WWYA 4ZXXH 2FS9A 5LGOA 3PM3A 3LGVA 2OBQA 2FPZA 1O3BA 1C5XB 4FVDA 1W0YH 1L1NA 3NCLA 2HOBA 1WXRA 1MU8B 4B2AA 3VFEA 3MO3A 4NZLA 1GI6A 1VITG 1KTSB 1ANEA 1GHWH 1NRQH 4IC5A 1HJ9A 3PMJA 2WHXA 5F53A 3U8TH 1ZZZA 2F4LA 1ELVA 1YPMH 5HMAA 4B75A 1MCVA 1B5GH 2AERH 2GZ8A 1ETRH 2H5DA 1O3CA 1G3BA 3SBKA 1NFWA 5EG4A 3F3BA 3VEQB 1P2QA 1V2KT 4TY7A 2W3IA 4J2YB 1NRNH 2ZFPH 1LHCH 4IS5A 2Q1JA 1D6RA 1O3AA 1OP8A 3EYDA 3SZNA 1GJCB 1Q31A 1A2CH 1GHAG 1ABJH 1SB1H 1K1IA 1INCA 1GMHF 1HJAB 2H2ZA 2KX4A 1FX0B 2BY7X 2XC5A 5HKKD 4BTUB 2BD7A 3GDVA 1GJ8B 1GI8B 2JJ1D 2A7HA 3GY3A 4I32A 1ETTH 2W26A 2FTMA 4ACBA 1N6XA 4ZKOU 3LU9B 4AYYB 4PROA 5H4IB 1ORFA 4I31A 1HCGA 1O2WA 1NFYA 3A82A 3OEHD 1A4WH 1KDQB 4CH2B 5EOKA 3S7HB 3P8GA 1YPLH 3SJ8A 3QGNB 4B73A 2XNDD 4XBBA 2GZ9A 2BVRH 2ASUB 1DPOA 2ANKH 2Z3CA 1QFKH 1BMLA 1DSTA 1W0ZU 2OUAA 4P00A 1HAHH 1SGRE 1Y3WA 4F48B 1F5RA 3Q3XA 1QR3E 1QL9A 2QF3A 4KTUA 5ESBA 3F2GA 3ZZ8A 2P95A 3UTUH 3PMAB 1HAYB 5DG6A 1N8OC 3LGWA 2Y6TA 4ZKNU 2OXSA 1YPHE 3MNCA 3PO1C 5ESTE 1FI8A 1MTNC 4YM9A 4KKDA 1ESAA 1GPZA 1SGIB 1P3EA 1W11U 3UOPA 4X0WU 1MAYA 1SGEE 3Q3YA 4YLQH 3ZVCA 3P8OA 4I86A 1H8IH 3SNDA 5EJZA 1ID5H 3FP8E 5JBTA 1AB9C 2CHAB 1GI1A 1JIMA 2B0FA 3ZZCA 1DITH 3SU1A 3EE7A 5C0TA 1GHBG 3ODFA 3OEED 1UK2A 2VVVA 3PYHA 1O2GH 4YLUA 1NRRH 2AGIX 3R3GB 4AGJA 2F9BH 2BXTH 4JK5A 3PMHB 1BDAA 1WQVH 2LP6A 2VIQA 1OWIA 2VH0A 1DLKB 1E79D 1TABE 3QZRA 1SKYE 1Y3UA 3TH4H 3AW0A 2LIZA 4K1EA 1IHTH 2SGEE 3DFJA 3ATWA 4O9VA 4CRBA 4ZROA 2V7QD 3S7KB 3V12A 1P2OA 1XUGA 1K0HA 4AGKA 3GYLB 1BTXA 4AG2A 3OU0A 3AAVA 1RS0A 5T6DA 1C2HA 4FUDA 3KQDA 3VB6A 2BDIA 4LZ1H 1FPHH 1W8BH 1O5DH 1MH0A 1O33A 4NIWA 4YZUA 3ZIAD 1AN1E 2BX4A 3IWMA 2AH4X 3BTFE 3SW2B 3ZZAA 4IN2A 1O37A 2SGQE 2F9OA 3ZVBA 4ASUD 1OYTH 1DY9A 4FUEA 1S81A 1P2JA 4YT7H 2A2QH 1BMNH 2R0KA 2F9NA 1H9LB 5C5OA 1HNEE 3MH4A 3L3TA 5C0UA 1CHOG 1EJMA 3SHCH 1TX6A 3P95A 4CRDA 3KL6A 1GHXH 3MU5A 3KN2A 1EAUA 2XRCA 1GDQA 5EXNA 2Y5FA 4ABGA 3BTDE 1O5AB 1QJ1B 1UHBB 1GL0E 5E0JA 1V2NT 1QZ8A 3UR9A 1WU1A 3QZQA 2H9HA 2BZAA 2WYGA 2FS8A 1K1MA 1O2PA 1C9TA 1D4PB 1WCZA 1Z7KA 5T6GA 1O2JA 3LJOA 3SJOA 1MTNB 1BRUP 1C1RA 1EPTB 5FPTA 1G3EA 3SI4H 1Z6JH 5EW2H 3RLYH 2OD3B 3RXOA 2CMYA 2FXRA 3T29A 1EZUC 4U2WA 3SU6A 2ZHFH 1AE8H 3DSPA 3SHAH 5A2MH 1WTGH 2GV7A 5C2ZA 2PGBB 5DN6D 2UWLA 3GS9A 1F92A 2RA0A 3TJUA 1YCPM 1GVZA 1C5RA 4WMFA 1O3NA 3WY8A 1C1UH 1YM0A 4CRCA 2HVXA 2J98A 1LHGH 4DGJA 2ZHDA 2F3CE 1A0JA 1DXPA 3BG4B 1P2MA 4WMDA 3RMLH 6GCHG 4GCHF 1DX5M 3ZVDA 2RA3A 1GMCG 1BJVA 1GVLA 2PTNA 4M7GA 5GJ4B 1ACBE 1BUIA 3STIA 1LPKB 4CBNA 3ODDA 2XBWA 3T2NA 2O8UA 1N6YA 2R2WU 1E1QD 1NN6A 1NU9A 3LT3A 1DOJA 1XKAC 2C8WB 4WH8A 2ZHEH 5FL7D 1DWBH 1YLNA 1GWAA 2ZZUH 1CA0C 3VB7A 2OQ5A 1CA8B 1ETSH 2RDLA 1COWD 3PB1E 5A0BA 4X1SU 4E06H 5EJLA 3NRLA 3T25A 2W3KA 1WOFA 2J94A 1FMGA 3HATH 1BHXB 4ABEA 2J95A 3AVZA 3RXLA 1O2HA 4I33A 1V2RT 3RXIA 1ELCA 3KIDU 2BTCE 1A61H 3UREA 3LDXH 1ABIH 3O8BA 2HGTH 1F5KU 1K2I1 2FDAA 3ELAH 4UONA 3F9EA 1PPHE 3M61U 1RJXB 4FUCA 2EC9H 3PROA 2XWBI 1GVKB 5K0HA 1O3DA 1C1MA 1TOMH 1SQAA 3FP6E 4A6LA 1GI9B 2V3MA 3IITA 1KMHB 1GBLA 9ESTA 3SNBA 2P3TB 1GHVH 2H9TH 1QA7A 4XBCA 3GCTG 1GBMA 3OY5U 4KTSA 1NTPA 5KEDA 4ZHLU 2ZHQH 1SLVB 1Q3XA 3LIWA 1ELTA 2BVSH 1CVWH 1ARBA 1TNGA 3A87A 1C2DA 2ZGXH 2G4TA 1QIXB 3A81A 1CBWC 4K2YA 5E8EH 3I78A 3M3TA 4DOQA 3DHKH 1SOZA 2O8WA 1ANDA 1HRTH 2TGTA 3GY5A 5GDSH 1NC6A 3E91A 1AGJA 1GJ9B 6CHAC 1K22H 7GCHF 1W14U 1PJPA 4WVPE 3M3VA 3G01A 5C5NA 2FI4E 3SU5A 3LPRA 4A7IB 1V2ST 4ESTE 1LVMA 1C5QA 2AIQA 1YC0A 4LZ4B 1SFIA 1ZGVA 3C27B 3U8OH 5CDFE 5C67A 2ZU4A 4RKOB 4OS7A 4DURA 2XXLA 1OP2A 4ISIH 1HAIH 2NU1E 2W6ID 2ZIQH 2VBCA 2GCTB 2TRMA 1WV7H 1D9IA 2J38A 1GI4A 2ZGJA 2EI7A 1CA0B 2BY6X 1NU7B 1UTMA 4K1SA 2O8TA 3A84A 5JDUB 4MNVA 1O3GA 1Y8TA 1FJSA 3M7QA 1SGCA 4UD9H 1F5LA 1EB2A 2FLRH 2JIZD 4FU7A 1ZMLA 1VR1H 4M9FA 3A86A 4CH8B 1H9IE 1K1LA 2EI6A 4JZIA 1XUJA 2FI5E 3FFGA 1GBCA 5IDKA 1PQAA 1SGPE 4OGYA 4AORA 3UOUA 2KCYA 3ZZ5A 5DGJA 3ATLA 1GI3A 1HUTH 5AFYH 3EAJA 1TGSZ 4RT0A 1LVBA 1XVMA 2BDHA 1MD8A 3UNSA 3U8RH 2GV6A 3SGQE 1MTSA 3OTPA 2GJGA 2DE9A 3EQ0H 3KQEA 4K1TA 1K1NA 1S6FA 4ABFA 3VXEH 4D7FA 3FZDA 5J4SA 5C3NA 1J17T 1MTVA 1NO9H 3TGIE 4TPYA 1QRWA 1O2IA 1TLDA 2C90B 1SMFE 2P94A 3D65E 4AN7A 2CF9H 3M5OA 1MAXA 2M2AA 2PSYA 3PRDA 1P2IA 3F9GA 1IQHA 4B2BA 3RU4T 8GCHF 1O0DH 1SOTA 1WDIA 5FPSA 1FN6A 1TAWA 1ZYOA 1SLXB 4E05H 3B8JA 1DLEA 4P02A 2UUYA 2ANYA 4X2XA 1VJAU 1BQYA 1GBDA 4DIHH 2V3OH 2VINA 1F7ZA 1KXFA 1UW7A 5DP4A 1F2SE 2QE7D 2ZDKA 5EGMA 4BXSA 1FY4A 3BG8A 1SQOA 3SUDA 4DT4A 1ZJKA 2ZFRH 4THNH 3JZ1B 1T4VH 1MBMA 1RTLA 3KHVA 2AMPA 1H1BA 4XBDA 1WQSA 2A4RA 5ABWA 1EJAA 5GNDA 4IGDA 1SPJA 1TOCB 1QHRB 2ZTXA 3BIVH 1B0EA 2WUCA 1TX8A 1XUKA 3OSYA 1TRYA 1T7CA 2FMJA 3RMNH 3SO3A 2FI3E 1C2FA 3A80A 3LKWA 4Z1MD 2NU0E 3ZZDA 1O2YA 3MO6A 1S84A 3ZZ9A 2WPLS 2K0QA 4JZ1A 4WXVA 4BTTB 4CHAB 3QN7A 2W6JD 1VJ9U 2ZFSA 2L6OA 1ANBA 2VU8E 1T8MA 5JPMH 4RN6A 3KYFA 3RM2H 3RU4D 2BMGB 5FAHA 1C2MA 3BEUA 1O3JA 3GDUA 3S9CA 2TIOA 3E90B 5C1YA 4D9QA 3MH5A 3FO8D 1FNIA 2QGRA 1NT1A 5GCHG 1VCQA 2FOBA 3KQBA 1GJ4H 2A7JA 2VIOA 1AWFH 2ZFTA 1O2XA 3RU4E 2PTCE 3M7UA 1G36A 1F0SA 5C1UA 1KY9A 5HXFA 2NWNA 2GD4B 3RUOA 2WPIS 5F8XA 3TGKE 1GI2A 1T8LA 2ZFQH 2KCPA 1XKBC 3A85A 1GCDA 1P9SA 1RIWC 1EATA 2Y82A 1UVTH 2ZCLP 3K6YA 4FETA 1G32B 2VVCA 1P10A 1GI0A 4NGAH 3U69H 1G9IE 1B7XB 2FODA 4UFFH 4J1YA 1BMMH 1TPPA 4INLA 4U30A 4YO9A 2ZKSA 2BLVA 1T8OA 2KAIB 2BY9X 3UB0A 3KNXA 1G3DA 3QK1A 3DD2H 5EXMA 2QCYA 2GMTC 1W3CA 1SQTA 3SN8A 4Y7AA 1UTJA 2BLWA 2HRVA 4YXWD 1ZPZA 2ZEBA 3WW7A 4TPIZ 1MZAA 3QO6A 1C2LA 1CT4E 1QBVH 1OPHB 2FYRA 4K60A 4LOYH 2IPQX 1AY6H 3C1KA 4MVNA 1A0LA 5IK2D 5T6FA 2ZU1A 3L33A 4ZUHA 3NZIA 3ENSB 4JYVH 2PFEA 2P16A 1IQGA 3JZ2B 3GCHC 1P3CA 1EJNA 4AFUA 2BXUH 3A8AA 3RMOH 2G55A 1E38B 1O2ZA 3VB3A 1UK4A 1EX3A 2VH6A 3VB4A 3Q3KA 3ATKA 1QNJA 2Z9JA 1GBEA 5FHTA 3KYGA 6GCHF 1YPHC 1GBBA 1IAUA 1GMCF 3N7EA 8KME2 1O36A 3AAUA 2B5TB 1HAPH 2FOEA 1C1OA 4BXWA 1RGQA 1N1LA 1GMDF 3P17H 2Z9LA 1FONA 4I8HA 1P03A 2ODQA 2VIWA 4XSKU 3UWJH 1HAVB 4GLYA 4SGAE 4YOJA 3SV2H 2VIDA 5L30H 4XDEA 3MU0A 3GCNA 1EPTA 4X8VH 5FX5A 1EFRD 1SBWA 4BNRA 5AF9H 3RXCA 1AIXH 1MTUA 1EOJA 1K28D 2A5AA 2G52A 2BD9A 4TSFD 3UUZA 2SGFE 1V2JT 3VG8A 1RIWB 1FIZA 1IOEA 4Q63A 2ZU2A 5E0HA 2P3UB 1TGNA 1HIAA 4BANB 1V2LT 4ABIA 1MZDA 1Y59T 1BTPA 1W10U 1UTOA 1BTUA 2BX3A 3BTKE 1V2MT 3AW1A 1O2TA 1W13U 4ZMAH 2XCFA 3F0PA 1XUFA 2J34A 1C1VH 4OM9A 2DUCA 3RXQA 1GJBB 4MPWA 5L2ZH 4F55A 2D8WA 4WH6A 4X1RU 4Z6AH 1O5EH 3F2FA 2GMTB 5HGGA 2ZPSA 1TGTA 2GCHG 1HLTH 2ZGHA 3S9BA 5HM9A 1MCTA 2Y5GA 2Z3DA 1T31A 2BD3A 2YNAA 3ITIA 1O2SA 4Y0YE 3CP7A 4IW4E 2QF0A 5CHAC 1MKWK 5T1VA 1GI5A 2K1QA 3RXFA 2HNTF 2ALVA 3EE0B 4AB8A 2Q6FA 2CXVA 4MPVA 4B6FA 3HKJB 1A3EH 2LELA 4NIXA 2LNCA 3PLKA 1FZZA 1TE0A 4NSVA 1TMUH 3V3MA 1O3IA 1O2OA 2KCOA 2V3HH 2ZNKH 3RDZA 1AZ8A 2C8YB 2FOFA 4F4OC 1BIOA 1W7XH 1CSOE 1BRBE 1AO5A 1FLEE 2WV9A 4AC9A 1BOQA 5EU8A 3NPSA 1XUIA 1CHGA 2WYJA 1FN8A 3F1SB 1JBUH 1FY3A 5JB9S 2Q6DA 2J2UA 1DS2E 2G81E 3PTBA 3SOSA 2OC7A 3LH1A 3SV9A 1P06A 1NY22 5AHGH 1A3BH 1V2QT 3KF2A 2KCAA 4H6TA 1EQ9A 1IQJA 1L2EA 3A8CA 3F68H 3SNCA 2XTTB 1OWDA 3RXSA 2PGQB 2G4UA 2AMQA 3SJ9A 5L6NH 1YPKH 1NS3A 1UVPA 3ZV9A 2WPKS 2SGDE 4OS6A 2F9UA 2J92A 1TMTH 3FZZA 1LVOA 2YMSC 1K1PA 2VVUA 1O32A 2AEIH 1IHSH 1ZTLA 1KXCA 1C2JA 3L6PA 2UUKB 1JXPA 4KTCA 5K7RA 1BTYA 2PLXA 1EAXA 1C5NH 2RCEA 1CU1A 5JBCS 2Z94A 1AMHA 3BV9B 5DP6A 4DT7B 1UCYK 4IC6A 4K69A 1CGHA 3TK6A 4MNYA 3U9AH 3K65B 4ZHAA 1SQRA 4K8YA 1THSH 1OKXA 1C5SA 2VWNA 1A0HB 1C2GA 1DE7H 3SV6A 1XUHA 5LPEA 4F49A 2O8LA 1HXFH 2G5NA 5CHAB 3RXEA 3RXUA 3U98H 2Z7FE 1W12U 1BA8B 2BDBA 4Y8XA 1C2KA 5BRRE 3UQOA 1FQ3A 1QTFA 5EQQA 5FCKA 1N8OB 1BCUH 3MYWA 1Y5UT 4NA9H 1DUAA 1ZHMA 3B23B 3PO1B 2YNBA 3QTVH 3TIUA 1ZRBA 4VGCC 9LPRA 2GDDA 3SUFA 2QY0B 1O3FA 1TMBH 3UFAA 1E0FD 3FVFB 1VCWA 5GPIB 4JZDH 1QQ4A 5FPYA 4A1TA 1ZGIA 1TGCA 1H8ED 2K8IA 1JRSA 3OTJE 1BBRE 1FY1A 3BIUH 1AB9B 3PV5A 4X6PA 4NG9H 4WY3A 3T28A 1J16A 2PWXA 1O3LA 2BOKA 4BAMB 2C8XB 3N7OA 1O3OA 1A1RA 5DPAA 4CBOA 2ZDLA 1ELFA 1BTHH 2YMSD 2XWAA 3RM0H 1FV9A 4CREA 1KXEA 2CGAA 3SI3H 2GTBA 1AFEH 2BD2A 3ZZBA 2BQ7B 5FCRA 1MD7A 4UFDH 3MNSA 1KXDA 4NFFA 1SGDE 2ZP0H 1TALA 1TX7A 4ABDA 1GBJA 1E37B 1QBNA 4FUFA 4ISOA 4ISHH 3RC5A 3BTTE 1BTWA 3FOAA 1FPCH 3FKSD 4RT1A 5IYTA 3NWUA 1C5YB 2FO9A 4AFSA 3PLBA 5DP5A 4DW2U 3FN8A 2W7UA 3MNBA 2C3SA 4X2WA 3SV7A 1UVOA 5A8YA 1G2MA 3MQKC 1U6QA 1Y3YA 3EA7A 3UIRA 2Z3EA 1EAWA 1C4Y2 4B71A 2F91A 2QIQA 1UTQA 1A5IA 3TPIZ 1DWDH 1EAIA 2ZCKP 2C93B 3UPEA 4Z0KA 2BHGA 3M37A 2GT8A 1P02A 3RXRA 1OOKB 2BOHB 3ZVGA 2A31A 2AHME 2IPHA 4Y8YA 1GMHG 5EJ1A 3T27A 3OX7U 2PKSC 1RXPA 2JJ2D 3FAOA 3WWFA 1G30B 3UAIC 1SHHB 1ZSLA 3UWIA 1LPGB 1NROH 1S0RA 1SGFG 4TT3D 1SGFA 2FP7B 1V3XA 1GJDB 3QDZB 2D2DA 1LMWB 1UVSH 2XYAA 4I8GA 5FXLA 2IN2A 5DP9A 1F0RA 1QCPA 6ESTA 4UEHH 4D76A 4UFGH 1ELEE 4Y79A 4MTBA 1YGCH 3DSGA 1C1SA 1QJ6B 3E0PB 1HYLA 2XCNA 3LGUA 1S85A 3RXPA 2THFB 4MPXA 1VITF 1C1WH 2XC0A 1HBTH 1MKWH 5C94A 1C1QA 1C4V2 1S6LA 1NZQH 3GY8A 1HV7A 4ZAEA 2BB4A 1CO7E 2Y7XA 4X1NU 1O3MA 1YPGH 4X6NA 2ZDNA 1D3PB 1NFXA 3KCGH 4GSOA 2WSSD 3SZEA 3F2HA 3GDSA 1PQ7A 4IMZA 3ZZ4A 2QXIA 2FYQA 3OFND 2CF8H 1E34B 3BEIB 3RXTA 1Z1JA 2R0LA 2A4OA 3SUGA 2RG3A 3H7OA 2CK3D 3NKKA 1UCYE 2FWWA 5A0CA 1C1TA 1ZSKA 4DY7B 2BD8A 5FBEA 1TA2A 2GT7A 2HWLB 4WF8A 4ISNA 2WZQA 2ZECA 2ODYB 1MU6B 1AKSB 1V2TT 4GHTA 3SV8A 2NU4E 3LC3A 1GHAF 2Z6BD 1GI7B 5LH8A 1O3KA 4YT6H 3TITA 1ZRKA 4B74A 4ACAA 4UDWH 1KLJH 3I77A 3BF6H 1FDPA 2H9EH 4HTCH 3PTNA 1ZMJA 4A92A 5CHBA 1O5BB 5EW1H 1O5GH 2I6SA 4ZXYH 2H6MA 2ILNA 3OY6U 5TCAA 5LPRA 3ZZ3A 4JZFH 1HAXB 3MO9A 2F43B 1TONA 2Z9GA 2I6QA 5A8XA 3NXPA 1GJ7B 1C1NA 5CE1A 2G00A 2PKAB 4U32A 4Y11E 1CE5A 1O35A 2PKSB 3SYJA 5LPFA 4YOIA 2BLQA 1OWJA 1FAKH 1ANCA 2ZPRA 5DO4H 1NRPH 2BDGA 1Y5BT 1G2LA 1JMOH 2HNTC 2KFWA 5DP3A 3DA9B 3M3SA 1HAOH 3CS7A 4NWLA 4I8LA 2AGEX 2P93A 2OC8A 4R0IA 1YWUA 1OHHD 1AVWA 1BJUA 1UCYH 1UJ1A 1V2UT 2GVFA 2ZQ1A 4CR9A 4ZH8A 5F8ZA 1Q2WA 4I8JA 1BMFD 1ZTJA 2OCVB 1NM6A 2GX4A 4WMEA 1NBMD 2OC0A 1CBWB 1GHZA 3TH2H 3PWCA 4TWYA 3SNEA 1F0UA 2HPPH 2ZG0H 1C5ZB 1FXYA 4AOQA 2ZGCA 4DIIH 4QT8C 4I7YH 1ZTKA 2IJOB 6CHAB 1NBME 2OINA 3HK3B 3SU0A 1AI8H 1NESE 1O2NA 2VGCC 1KYNA 1KDQA 4JCNA 4BAHB 4XOJA 5T3HA 1O2UA 1IQKA 1ESBA 2FOHA 2GDEH 3A7XA 3SGAE 4KGAA 4DG4A 1LTOA 3UQVA 1GHBF 3QWCH 3E6PH 5PTPA 4B2CA 5AVDA 1KLTA 3H09A 1J15A 2FLBH 1SLUB 1V2VT 3QX5H 4X2VA 2OBOA 1W0JD 2B8OH 2Y5HA 1H8DH 3A83A 4HGCA 1EASA 1JRTA 2ZC9H 1W0KD 2QC2A 1S83A 1GDNA 4B1TA 2V35A 4ZKSU 1J8AA 3MH7A 4FU8A 3HGPA 4FU9A 3P8FA 4Y7BA 2FIRH 2BZ6H 1CT2E 1SL3A 1TNIA 4WJG2 2CV3A 5JBBS 4GCHG 2WUBA 1C5UA 3P70B 1H8HD 4RKJB 3SQEE 1PPZA 2NU2E 1C2EA 4INKA 3BTWE 5AFZH 2Q6GA 4HFPB 5GXPA 3ZYDA 4Q80A 2HNTE 3ATMA 1XMNB 4NSYA 3VGCC 2XBYA 4DVAU 2RFKC 1GBAA 1MMJN 2A5KA 1MTWA 1CHOF 1P57B 4RI0A 4AG1A 2HLCA 4Y8ZA 1YP9A 1ZHPA 3CNRA 5DJ7A 1YLCA 1Y5AT 5DSFA 5F6MA 4JK6A 4HG6A 3S9AA 4H42U 2JETC 4U01A
chains in the Genus database with same CATH topology
1O2MA 3ZVAA 1V2PT 2PHBA 4NIYA 2VIPA 4GPGA 2TBSA 2XW9A 3CS0A 1SSXA 1E36B 3SJIA 1GG6C 1XXFA 1DVAH 2AGGX 3SJKA 1SHYA 3UR6A 1BITA 3AASA 5EPNA 4D9RA 4TY6A 1SLWB 1AUJA 2G5VA 1PPEE 1LQEA 1ELDE 3HPTB 1EZQA 2BDYA 1WTHD 1LDTT 1SVPA 1DT2A 2H1UA 1SGNE 1OWEA 2VGCB 5DKMA 2WPHS 1EOLA 1O31A 1C5VA 2FOAA 3RXGA 4A1VA 5CMXH 1KXAA 1XM1A 3URCA 1TPAE 4K8BA 2SNVA 3P92A 2GKVE 3F6UH 3EDXB 4I8KA 4SGBE 3LGYA 2STAE 2FOGA 1UMAH 1QY6A 1O2RA 2VWOA 3MNXA 3ZV8A 1KLIH 3HGNA 1KXBA 2QA9E 3PLPA 1PFXC 1PPGE 3KQCA 4GUXA 2DE8A 2OQUA 1HJ8A 1ZJDA 4JMYA 4LK4A 1ELGA 3A8BA 1UVUH 5ETXA 2BD4A 2ALPA 3M35A 1TRMA 1UHBA 2WV5A 1PQ8A 4MDSA 2CJIA 3LGIA 4TWWA 7GCHG 1CGJE 1EP5A 1Z6EA 4Y71A 2OLGA 1TNJA 4JZEH 2HPQH 4YOGA 2CHAC 1P0SH 5TJXA 1BBRK 1ZPCA 2AFQB 1D3DB 1TQ7B 4FXGH 3VXFH 4MNWA 4CRFA 1KSNA 4R8TB 4AFZA 3B9FH 1LVYA 1AVXA 5JYIA 1H4WA 2ZPQA 5G4BA 3QLPH 3BTGE 1P2KA 3VGCB 2P8OC 2EI8A 2VIVA 2NU3E 3M7TA 1UO6A 4BAQB 1GL1A 2G8TA 1ZSJA 3LC5A 2EA3A 2Z9KA 3TJVA 1YKTA 2BY5X 4HI3A 3A7YA 4D8NA 3Q00A 1P8VC 3ESTA 1P12E 1FUJA 1G37A 3IG6B 2BD5A 1FAXA 2TGPZ 2C4FH 1DY8A 2R9PA 5TCCA 3Q76A 1BTZA 2JETB 1AU8A 1P01A 3HK6B 4Y76A 4RSPA 4A5TS 5GIBA 1VCPA 2ODPA 1DUEA 2ZI2H 1J14A 5F8TA 1WAYB 1GG6B 5C1XA 1E35B 3GCTF 1PYTC 2ZTYA 1SG8B 2PUXB 1GGDC 1L4ZA 2JH6D 3RMMH 3F9FA 1Z8GA 3BTHE 4AFQA 1XXDA 2ANWA 3TJNA 3T26A 1EZXC 4NA7A 3S69A 1T8NA 1SI5H 3SORA 4IN1A 3GCHB 3E8LA 2FESH 1LKBA 1BB0B 3SQHE 1YF4A 4FUHA 3LOXA 1LKAA 2UUFB 1O5CB 3TVJB 3A7VA 1KTTB 3K9XB 4ABBA 8GCHG 1IQNA 2A4QA 3GYMA 2BM2A 2PUQH 1GBKA 2G51A 1S82A 2ESTE 1IQIA 1F0TA 2SFAA 2GZ7A 7ESTE 4NFEA 3A89A 5EODA 3RXAA 1T32A 3ZYEA 1FY5A 4E7RG 2QXHA 1TPSA 1EPTC 2Z9IA 3MH6A 4FUIA 4KELA 1GBTA 1GJ5H 2A5IA 1DSUA 1QBOA 3UNRA 2ZO3H 1RD3B 1YPEH 3MU1A 4MQAA 4BAKB 3LJJA 1X7AC 3ZVFA 1QGFA 2UWOA 3BN9A 4DCDA 4E7NA 3MTYA 5SGAE 3E0NB 3A7ZA 1QJ7B 2VJ1A 3GY2A 2QYIA 2ZGBH 1ZOMA 4MPUA 4AX9H 3BG4C 2P8OB 1SGTA 3STJA 1MKXK 1TBQH 1PYTD 3R0FA 1GBFA 2BYAX 2A4GA 2K7XA 1SGYE 2YOLA 4YESB 1OS8A 1C5MD 3KEEA 4ZHMU 1QL8A 1TBRH 3MFJA 4ISLA 3RXBA 1K21H 1W2KH 1G3CA 3GOVB 1A5HA 2EEKA 1EKBB 3UY9A 1QA0A 3BTME 3UNQA 3A7WA 4Q7ZA 4Q7XA 4FVBA 3GICB 1P05A 1GGDB 1YLDA 2ZHWH 4FUBA 4Y10E 1S5SA 1FY8E 2ULLA 1WYKA 2QAAA 4Q7YA 1AKSA 4O3TA 3V0XA 1K9OE 1PPBH 1LPZB 1Z8IB 3E16B 4OGXA 2D26C 1MQ6A 1V2OT 1A7SA 3RXKA 4WXIA 3PV4A 1O2VA 1TA6A 2OP9A 3TK9A 3GISB 1AD8H 1C5LH 1T4UH 2BVXH 1EXFA 2VNTA 4UFEH 3PMBB 1S6HA 1THRH 3BEFB 3M5LA 1JWTA 4Y0ZE 3P6ZB 1TFXA 1HPGA 3MU8A 3RXHA 1O38A 1RRKA 4O03A 2O9QA 3RC6A 1C5TA 1RTFB 2FOMB 1Z71A 3MMGA 3TLOA 1PQ5A 4INHA 3M36A 2PKAA 3HKIB 2UUJB 1MUEB 2BQWB 3URDA 3GY4A 1P9UA 5DK1A 3F9HA 3TNSA 1THPB 1JOUB 1DM4B 2FEQH 1PPFE 3RLWH 3E3TA 1TNLA 2A2XH 3A88A 2AIPA 4YTAA 1VITH 1QRXA 1B0FA 1HIAB 1TQ0B 1TYNA 1OWKA 1HFDA 2TGDA 3Q77A 3M5MA 3VB5A 1HAGE 2R3UA 4FUJA 1YCPK 1V6DA 2J9NA 2A0QB 2P59A 5GCHF 2JKHA 1YYY1 3OYPA 2SGAA 4NIVA 1BRCE 1IQEA 5A0AE 1HB0B 1EUFA 3SGBE 3SU2A 4A1XA 3PWBA 2A1DB 1QB9A 2AMDA 1GMDG 1UTPA 2GCTC 3QTOH 2ZDMA 8ESTE 1SFQB 2XC4A 1LQDB 2F83A 3EBNA 1QQUA 4Y6DA 1BBRH 1QB1A 1QB6A 1QRZA 1GBIA 1GDUA 3DFLA 4X8TH 2PR3A 5HYOA 5DP7A 3MWIU 4X6MA 3U1JB 1O30A 1VGCC 1TB6H 2B9LA 1FIWA 2A32A 1O2KA 3SNAA 3TU7H 4ABHA 2P3FH 3RXDA 4TYDA 1NFUA 1O2QA 1C5PA 4AB9A 1GJ6A 3MI4A 5J4QA 2ZTZA 4BTIB 4IBLH 3ZZ6A 3A7TA 5DP8A 4VGCB 1DFPA 4NWKA 3K6ZA 1MQ5A 4X1QU 3ATIA 1IQLA 1ZMNA 2F9PA 2WPJS 3RXJA 1TNKA 1C5OH 1P11E 1QURH 5EPYA 2UWPA 2GGVB 4GHQA 4OS5A 3SU4A 1L4DA 1UTLM 1O3PB 2M5TA 1P09A 3EA8A 3CENA 1BRAA 1UTNA 3W95A 2QXJA 1O34A 1BMAA 1ESTA 3QUMP 3V7TA 1Z1IA 3P8NA 4D7GA 6LPRA 7LPRA 2KAIA 1CT0E 1C9PA 1AHTH 1XVOA 2QN5T 1UTKA 4B76A 1H9HE 2BDCA 2PV9B 1C2IA 2OTVA 1GJAB 4OS4A 1GHYH 1O3EA 2ZQ2A 1SR5C 3GY7A 1KIGH 1WBGB 1RTKA 1ZR0A 4LXBH 2FZZA 4CR5A 1HXEH 1L1JA 2ZU5A 2O8MA 2BLOA 3H7TA 3TK5A 2PW8H 1D3TB 1OYQA 2HALA 1O39A 2QV1A 2ZU3A 2ZCHP 1AFQC 1TRNA 2Y7ZA 3DT0H 3A8DA 1LO6A 1GBHA 5BPEA 1IQFA 5C20A 4CHAC 1XX9A 1NPMA 4H6SB 1BZXE 1DICA 3MOCA 1QL7A 3FP7E 3M5NA 1VGCB 2VWLA 2C8ZB 4MG3A 5JB8S 3K2UA 1DWEH 1MKXH 1P04A 1TGBA 2BY8X 2VWMA 2V0BA 1GCTC 4JYTA 4OS2A 3RXMA 1TPOA 2SNWA 2GCHF 2JH5D 1SC8U 1Y3VA 4ASHA 2F9VA 1JIRA 1AWHB 2BQ6B 1HAVA 1K1OA 1TIOA 2VB0A 2WINI 2H5CA 5I46H 5HM2A 3S0NA 4IMQA 5E2OA 1Y3XA 2GP9B 1LHEH 1EB1H 2A7CA 1CGIE 3BSQA 2ZF0H 5EXLA 4DJZB 1O3HA 1BHXF 2ZDVH 5JBAS 2FX4A 3KGPA 1ZLRA 3TH3H 3RXVA 1TWXB 2BDAA 1DDJA 4AZ2B 2R2MB 1V2WT 3QGJA 1VZQH 1C1PA 4NZQA 3T62A 3V13A 4X8UH 2AYWA 3W94A 2XNIA 3BTEE 1TNHA 2R3YA 2ZWLH 1BT7A 1ZHRA 2WV4A 4X2YA 4XFQA 2W5EA 4H4FA 2ZFFH 1MBQA 1HDTH 1OX1A 1W7GH 1EZSC 1WSSH 3H5CB 4AYVB 3O8CA 2LPRA 3RP2A 3TJOA 2FX6A 4HZHA 5I25A 3D62A 5E2PA 3ZVEA 2ZA5A 1K1JA 5A8ZA 3GCOA 4JYUH 2Y80A 4ZKRU 5FBIA 4MNXA 2D1JA 2B7DH 1HAZB 2FM2A 1UK3A 2WPMS 2JH0D 4CRAA 5A09A 1NRSH 1OXGA 4X1PU 2XBXA 3E1XB 2TPIZ 1AUTC 1RFNA 3LONA 1L0ZA 4FUGA 4XE4A 3O8DA 3FANA 3SUEA 1AQ7A 1LHDH 1ARCA 1AFQB 1D6WA 3MHWU 1S0QA 1L1GA 5F03A 1O5FH 4NCYA 1YBWA 3TGJE 2ZDAH 2TGAA 4X6OA 4ABJA 3BTQE 1A5GH 4GVUA 1WUNH 1OP0A 1LHFH 3D49H 1ZPBA 1ELBA 2AS9A 3EA9A 4KP0A 4CRGA 1YCPH 1AE5A 3TNTA 4MLFB 1DXWA 1GCTB 2PSXA 1AVGH 2FTLE 3MU4A 1IQMA 3LH3A 4ABAA 1HJAC 4BAOB 4O3UA 2IOTA 1DANH 1M9UA 2OC1A 1Z8JB 3I29A 3EGKH 1DWCH 4K3JA 3O8RA 4BOHA 2QXGA 1A46H 4UE7H 2Y81A 4X8SH 1HGTH 3RC4A 3SU3A 3T5FH 4GAWA 2SGPE 7KMEH 2CN0H 3U1IB 1AZZA 3DUXH 2W7SA 5FX6A 4OS1A 1OWHA 3NK8A 4O97A 1CQQA 2XBVA 3NUMA 1LCYA 1PPCE 3ZZ7A 5B6OA 1C4U2 5EQRA 1D3QB 2STBE 3VPKA 3D23A 2FOCA 4NA8A 1EP6A 1ELAA 4Q2KA 1J9CH 2V6NA 5EQSA 2ANMH 1P2NA 5GWZA 1O2LA 2J4IA 1Z8RA 3GY6A 5L2YH 3LGTA 1TBZH 1YPJH 2A45B 1SGQE 4K5ZA 5E0GA 1C5WB 1OSSA 4WWYA 4ZXXH 2FS9A 5LGOA 3PM3A 3LGVA 2OBQA 2FPZA 1O3BA 1C5XB 4FVDA 1W0YH 1L1NA 3NCLA 2HOBA 1MU8B 4B2AA 3VFEA 3MO3A 4NZLA 1GI6A 1VITG 1KTSB 1ANEA 1GHWH 1NRQH 4IC5A 1HJ9A 3PMJA 3U8TH 1ZZZA 1ELVA 1YPMH 5HMAA 4B75A 1MCVA 1B5GH 2AERH 2GZ8A 1ETRH 2H5DA 1O3CA 1G3BA 3SBKA 1NFWA 5EG4A 3VEQB 1P2QA 1V2KT 4TY7A 2W3IA 4J2YB 1NRNH 2ZFPH 1LHCH 4IS5A 2Q1JA 1D6RA 1O3AA 1OP8A 3EYDA 3SZNA 1GJCB 1Q31A 1A2CH 1GHAG 1ABJH 1SB1H 1K1IA 1INCA 1GMHF 1HJAB 2H2ZA 2BY7X 2XC5A 4BTUB 2BD7A 3GDVA 1GJ8B 1GI8B 2A7HA 3GY3A 4I32A 1ETTH 2W26A 2FTMA 1N6XA 4ZKOU 3LU9B 4AYYB 4PROA 5H4IB 1ORFA 4I31A 1HCGA 1O2WA 1NFYA 3A82A 1A4WH 1KDQB 4CH2B 5EOKA 3S7HB 3P8GA 1YPLH 3SJ8A 3QGNB 4B73A 4XBBA 2GZ9A 2BVRH 2ASUB 1DPOA 2ANKH 2Z3CA 1QFKH 1BMLA 1DSTA 1W0ZU 2OUAA 1HAHH 1SGRE 1Y3WA 1F5RA 3Q3XA 1QR3E 1QL9A 2QF3A 4KTUA 5ESBA 3ZZ8A 2P95A 3UTUH 3PMAB 1HAYB 5DG6A 1N8OC 3LGWA 2Y6TA 4ZKNU 2OXSA 1YPHE 3MNCA 3PO1C 5ESTE 1FI8A 1MTNC 4YM9A 4KKDA 1ESAA 1GPZA 1SGIB 1P3EA 1W11U 3UOPA 4X0WU 1MAYA 1SGEE 3Q3YA 4YLQH 3ZVCA 3P8OA 1H8IH 3SNDA 1ID5H 3FP8E 5JBTA 1AB9C 2CHAB 1GI1A 1JIMA 2B0FA 3ZZCA 1DITH 3SU1A 1GHBG 3ODFA 1UK2A 2VVVA 3PYHA 1O2GH 4YLUA 1NRRH 2AGIX 3R3GB 4AGJA 2F9BH 2BXTH 4JK5A 3PMHB 1BDAA 1WQVH 2VIQA 1OWIA 2VH0A 1DLKB 1TABE 3QZRA 1Y3UA 3TH4H 3AW0A 2LIZA 4K1EA 1IHTH 2SGEE 3DFJA 3ATWA 4O9VA 4CRBA 4ZROA 3S7KB 3V12A 1P2OA 1XUGA 4AGKA 3GYLB 1BTXA 4AG2A 3OU0A 3AAVA 1RS0A 5T6DA 1C2HA 4FUDA 3KQDA 3VB6A 2BDIA 4LZ1H 1FPHH 1W8BH 1O5DH 1MH0A 1O33A 4NIWA 4YZUA 1AN1E 2BX4A 3IWMA 2AH4X 3BTFE 3SW2B 3ZZAA 4IN2A 1O37A 2SGQE 2F9OA 3ZVBA 1OYTH 1DY9A 4FUEA 1S81A 1P2JA 4YT7H 2A2QH 1BMNH 2R0KA 2F9NA 1H9LB 5C5OA 1HNEE 3MH4A 3L3TA 1CHOG 1EJMA 3SHCH 1TX6A 3P95A 4CRDA 3KL6A 1GHXH 3MU5A 3KN2A 1EAUA 2XRCA 1GDQA 5EXNA 2Y5FA 4ABGA 3BTDE 1O5AB 1QJ1B 1UHBB 1GL0E 5E0JA 1V2NT 3UR9A 1WU1A 3QZQA 2H9HA 2BZAA 2WYGA 2FS8A 1K1MA 1O2PA 1C9TA 1D4PB 1WCZA 1Z7KA 5T6GA 1O2JA 3LJOA 3SJOA 1MTNB 1BRUP 1C1RA 1EPTB 5FPTA 1G3EA 3SI4H 1Z6JH 5EW2H 3RLYH 2OD3B 3RXOA 2CMYA 2FXRA 3T29A 1EZUC 4U2WA 3SU6A 2ZHFH 1AE8H 3SHAH 5A2MH 1WTGH 2GV7A 5C2ZA 2PGBB 2UWLA 1F92A 2RA0A 3TJUA 1YCPM 1GVZA 1C5RA 4WMFA 1O3NA 3WY8A 1C1UH 1YM0A 4CRCA 2HVXA 1LHGH 4DGJA 2ZHDA 2F3CE 1A0JA 1DXPA 3BG4B 1P2MA 4WMDA 3RMLH 6GCHG 4GCHF 1DX5M 3ZVDA 2RA3A 1GMCG 1BJVA 1GVLA 2PTNA 4M7GA 5GJ4B 1ACBE 1BUIA 3STIA 1LPKB 4CBNA 3ODDA 2XBWA 3T2NA 2O8UA 1N6YA<