2GX9A

X-ray strucutre of influenza virus ns1 effector domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
127
Chain Sequence
MTMASVPASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETLQRFAWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS1 Effector Domain
publication title X-ray structure of influenza virus NS1 effector domain.
pubmed doi rcsb
source organism Unidentified influenza virus
molecule tags Transcription, virus/viral protein
total genus 32
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gx9A00
3P31A 3D6RA 3EE8A 3OA9A 4OPAA 3O9TA 4OPHA 3KWIA 3M5RA 3L4QA 3O9QA 3O9SA 3KWGA 3RVCA 3O9UA 3P39A 2RHKA 3O9RA 2KKZA 2GX9A 3P38A 3F5TA 3EE9A
chains in the Genus database with same CATH superfamily
3SPYA 3HK2A 2YHBA 4BRIA 2YJEA 1LCUA 3NDKA 1NK6A 4FK0A 3WEEA 3N4QA 4CGHA 3HP9A 1EETA 4CEBA 4FJXA 3F9MA 4JHDB 5JS2A 2I7PA 1HKBA 2PFUA 5KGWA 4B8CA 3I0RA 1WBDA 4CI6A 4FWNA 2D0OA 1U4BA 3CC2N 4DR3K 4DTMA 1YVUA 2FSJA 5DM6L 1T44A 2ZF5O 4J2AA 4C23A 3K5OA 3VGLA 2O8EA 4I7FA 5GADP 1T7PA 4CFCA 3CC4N 1RT1A 3SNNA 4KB1A 3TTCA 4FW2A 4H0VB 3J7YP 1Z25A 4IDKA 5AZIB 4BG9A 1Y64A 5FRMA 3JS6A 4ISEA 1KRPA 1M1KO 1YF5L 4K41A 1RTIA 3ZLJA 4K42A 4XIUA 3JAMO 1NJIO 1OH6A 1KSPA 4AM7A 1Q86O 3LL3A 3KLEA 2BE2A 5ADXA 5E41A 5I9EB 3TANA 5JVGL 4ELVA 3DLHA 3VMFB 3SBGA 2HBKA 4BVPA 5IWAK 3LZJA 4EP4A 4JAXA 4JS5A 4W5NA 3M5RA 2HSTA 2D0BA 3ZSRA 4FW1A 4M3WA 5AQIA 4B3RK 3CETA 5M1QA 4B3OA 1TAQA 2F9TA 4DR4K 2JGUA 3EKSA 3EZWA 3NF7A 4JK7A 2GTDA 4BRQA 1NJYA 1K9MO 4FZZA 1LWEA 3OVNA 1ZBHA 1WNSA 1RTDA 4ELUA 2O8FA 3HSTB 1XC3A 4OPAA 5AFUA 2YI1A 3LDNA 2P9NA 4NCBA 2X74A 1VRTA 3K59A 3DAWA 1JLQA 3KZBA 3RMDA 3MEGA 2QXFA 4DFKA 1EKEA 2HF4A 3THXB 2Y1IA 3GDQA 5E84A 3HZ6A 3L8BA 4JRQA 3EE9A 3O3GA 3T3FA 3THYA 4CGFA 3V1OA 4ZHRA 3AA4A 2JLEA 2BDPA 3L3VA 4JKDA 3TARA 4CHYA 1BU6O 3DLKA 2NRRA 1KTQA 4YOXA 3BF3A 2WONA 3AVHA 1QZ5A 3OYKA 3HTVA 4IJNA 4CHQA 5JVHL 3F5TA 1U49A 1QSLA 4CIEA 1NM1A 4KPYA 5AQRA 3MECA 3O9TA 1VQKN 4K8XA 4K43A 4DU1A 2HHVA 1T8EA 1V4TA 3WT0A 4E89A 4FJNA 4A59A 1FW6A 3I8DA 4F3TA 1WB9A 4HVJA 1ZC6A 2FBXA 2Q0UA 4RG8A 5EVZA 5AQUA 2A1RA 3VEYA 1HNWK 2WTUA 2H3GX 1K8AO 3E1YA 2P5OA 3MCAB 4H8KA 3F9KA 4W5OA 2QWOA 2E2QA 3ZSYA 3H45C 1HPZA 4OPHA 4FJ7A 4JI7K 2PYLA 4DV0K 2Q2RA 3NE6A 4B08A 3VQ5A 4C1NI 4JI5K 5AQJA 3B6OA 4DU3A 5ADXH 3HXMA 2HHXA 1S72N 1K73O 3ZT4A 3KLIA 3G71N 1OH8A 3OS2A 4H5NA 4KHPK 5FROA 3O9RA 1VSMA 2KW4A 1RBSA 4AHSA 1VQLN 5C25A 1YJWN 3KK3A 4CF1A 4PHTX 2V51B 4BGAA 2NUBA 1YTAA 2DTUA 1HPMA 3QBWA 1NKBA 4UQGA 4FVUA 3ATVA 4K8ZA 4JKCA 4FLZA 3LPUA 5FDLA 3CPWM 5AFUH 2ZGZA 4QS7A 4N76A 4BRPA 3O9UA 3O6WA 3TAQA 4KI4A 2BUPA 3AO3A 4H4OA 1HNIA 4BWMA 3DYAA 4CJTA 3U4LA 4NLBA 2IS3A 4YOTA 2YNHA 4XH5A 2V7YA 3C6UA 3S9HA 1IBKK 4EFHA 4F8RA 4LC9B 1FKPA 3AO5A 3SBTA 3SMSA 1BUPA 4L3QA 1TK5A 3RR8A 2G8IA 3ULEB 1TK0A 3DJCA 3AAQA 4M63C 3BY5A 2BANA 1NKEA 4U7BA 4DQIA 1FK9A 2NRWA 2RE2A 3L2VA 4KBOA 1B9FA 1K8KB 2F7TA 4DV5K 3THWB 3CJCA 4X65K 1HUXA 2OA8A 4RWTA 4FWPA 4H5TA 4CF2A 4FJ8A 4AQYK 3I55N 4FWOA 4AILC 3FZMA 4CGGA 2HMIA 3MN5A 4B8AB 1U04A 1Q7YO 3KKRA 4NXMK 2QW9A 1MWKA 5DMRA 1NK0A 3O9SA 3A0IX 4CEEA 1NGFA 1XQSC 2NNWA 3L4IA 3AVKA 4FLWA 4I2QA 2QK9A 3E9LA 1WBBA 3NBPA 5KPZA 4FWKA 1RFQA 3LAKA 1RILA 3ZT0A 1RBRA 4NYFA 2KZZA 3OY9A 2ZJRL 1HR0K 2F4VK 3LM2A 1IV0A 5IT9O 2QEXN 5GAHP 3DM2A 1LWCA 4DTRA 4CIFA 3VENA 3MEDA 1HKCA 1RT6A 3VGMA 4KTZA 3CCQN 2O8CA 2I7NA 4JI2K 2GUIA 3U9ZA 4FJMA 4Z4IA 3QFPA 1QVFM 1MA9B 4B9QA 4FM2A 3EKUA 4O8KA 2A6AA 4QCLA 4BR0A 1VSHA 5F1XA 4JKAA 1BIUA 1DGKN 4BR7A 5HRRA 1T03A 3V9WA 4B3MK 2A1SA 5AQNA 1QSSA 2DFHA 3WEEB 1QQCA 1YI2N 3T69A 1C0UA 3TSQA 3O8MA 2QWNA 2GX9A 1C6VA 4I6MA 1NGBA 1SQKA 3WXKA 1U2VA 1JL1A 2HVHA 1EP4A 3CIPA 4LF9K 1TVRA 4FM1A 2O8EB 3KWGA 3LWLA 2D4WA 4EP5A 4O5FA 3ZT1A 3PIOL 4AM6A 3DMJA 3VQQA 4Z4EA 3DI6A 1VRUA 1NGCA 5AQVA 1C0TA 1X3NA 3QEIA 2WOMA 4HUFA 2P9KB 2EHGA 3NGIA 1L5UA 4H0TB 4DV1K 3L3UA 3TAGA 1QS4A 4WQ4A 3VEWA 1A5WA 1CXUA 1GLAG 3CCLN 4BR4A 1BQNA 4ILHA 2KLAA 3ID8A 2A40A 2V7ZA 3ZYYX 3CJAA 4DUZK 5C12A 4CJKA 2W6LA 1P8ZA 2YHWA 2D5RA 3AO1A 4DTJA 2OANA 1YIJN 2F8SA 1VSEA 3UB5A 2J4RA 3DXMA 3OA9A 3C6AA 3RRHA 1JKHA 1BIZA 3CFOA 2O8FB 1S6QA 2VG5A 4M3XA 3DRSA 1C0GA 1IO2A 1GLCG 2ZJPL 3S3OA 1BDGA 4E7IA 3LDOA 5AQTA 1D9DA 1TKZA 1RDAA 1VSLA 3WXJA 4DQSA 2YHYA 1WSJA 4C8MA 1YUWA 5FLXO 4CF9A 3R6MA 3D2FA 3ASMA 1VQ8N 3MXJA 1NGHA 3A5MC 3QBXA 4WFNL 4CERA 4DUYK 3SAHA 5EOYA 4B9NA 2KTQA 2HOEA 3THYB 1FXXA 4GMJB 4CJQA 4HUEA 5CE3A 4YDUA 3GL1A 1D8YA 2HNDA 2GWJA 4LFBK 4CK2A 4BG8A 2VG7A 3AA2A 5J2QA 4PY5A 1N5YA 4Y1DA 4WYBA 4B1VA 3VEOA 1C0MA 1LAWA 1S3XA 2ZQBA 3PLAA 3CD6N 2F8TA 3HYFA 3TAEA 3TU5A 1HNVA 3PSFA 3G25A 4C1NK 2X6SA 3C94A 3HPOA 1S1VA 4IXCA 3DXKA 3ZCMA 5LMUK 1NK9A 2I5JA 1N32K 1NWKA 4Z0UA 2DY4A 4A2AA 3MXIA 3HBTA 2NZTA 3IUCA 4F2RA 1N6QA 1L3TA 2UUBK 3HO1A 3LZIA 4FWMA 1VSIA 3WNEA 4B9TA 5B8HA 4K25A 3O4QA 5BN9A 1W2BM 1LOTB 4K0KK 4JNEA 2D0AA 3QEVA 4CHPA 4DTUA 1NOYA 4KHNA 1VQ7N 2DPNA 4ILJA 2P51A 3PIPL 2VGNA 2YNIA 4M7YA 4RW9A 4GV3A 3M8QA 3DLBA 4BQZA 2ZD1A 5AQGA 2BTFA 4ELTA 1XHXA 2WC9A 1QE1A 2FBYA 3CHWA 3KTQA 4X64K 4H03B 2OPQA 4CEAA 2FSKA 3VF6A 3CCVN 1TAUA 3FR0A 3SUPA 2GUPA 3P5JA 4FPAA 4FLYA 1RDDA 1SL2A 4LF6K 2UUCK 1BA1A 4M3ZA 4CJFA 1NMNA 3CFRA 5HP1A 3WXIA 2XY5A 3T1HK 4CEQA 4CJ5A 4PUOA 4GY2B 3PX6A 1QQMA 1SAZA 4CGDA 3CM6A 2EWSA 2OTLN 4IEEA 4CJVA 4FVMA 2IGIA 4H0XB 3VQ9A 4NCAA 4O55A 1JLEA 1RT3A 3OYCA 1W97L 1SKSA 4CE9A 4KTWA 4ISFA 1Q81O 1ZBFA 4Q0BA 2Q3SA 4JN4A 3WQTA 4IDHA 5BRFA 4OGCA 1GLFO 4E7HA 5FRNA 3MWTA 4DS4A 3EZ5A 5KQ8A 4BREA 2VWBA 2KZMA 2W42A 4M42A 1QTMA 1KQSM 3OJUA 3KD1E 1RNHA 1VK0A 1ILYA 2HMPA 1NGJA 3W3DA 3CCEN 3OYJA 1TV6A 3AGKA 2IVOA 3HRGA 4CHOA 1RBVA 3A5NC 1NOZA 4DLEA 4RW8A 2YNFA 5EU7A 5HRNA 1RT5A 3VQ6A 4IO9L 3UKUA 2CGJA 4J8FA 1NMDA 4AHTA 4CGIA 4MDAA 5M1PA 3KLFA 4N56A 2IOCA 2FSNA 2W40A 3OYEA 4CZLA 3DRPA 4E1MA 3MN7A 4BRNA 5D3GA 4FWRA 3IKMA 2E4LA 5E26A 1VQON 4BR2A 2G8FA 2OYQA 5KPTA 3GOIA 3CCRN 2UUAK 3VOVA 4IBNA 2O8CB 3QINA 4CHNA 5KI6A 4YOYA 3JYTA 3V1QA 3K57A 1RTJA 5EX5A 1SV5A 4KHWA 1YT3A 1S6PA 2IC3A 4OPKA 2ASPA 1ASVA 3P39A 5AZJA 1TUYA 3NHGA 1S9EA 4FLUA 3FGUA 1NG9A 4F2SA 4IWVA 3BUZB 4DV7K 2RPIA 2HHHK 4NLCA 1IH7A 1ZBLA 4KHSA 4IG0A 2KFNA 2Q1NA 4DTOA 4EHTA 4MDBA 4DV2K 5KPRA 4I6MB 1QVGM 4MLEA 1VQ6N 4OGEA 3BF1A 1U2VB 2OPPA 3D2EA 4FJIA 1ESVA 2ITMA 3OYNA 1A5VA 4DR6K 1KLNA 3V1RA 5KTQA 4B1XB 4CZJA 2O8DA 2P1JA 2NRTA 5BRDA 1UOCA 4PWDA 3AVLA 4OX9K 2FLOA 4BRMA 3KLGA 5M1KA 2XY6A 2E20A 1VQPN 1R59O 3U8XA 1NJXA 4NXNK 2EX3A 3CYMA 3VA3A 2W6KA 5K14A 2Z1JA 4JKFA 4KRFA 3NAEA 2A3ZA 2Q31A 3E9PA 5AQWA 3HSCA 1KFDA 3JSMA 4GV6A 3WNGA 4JK9A 3V81A 1IJJA 4FLTA 3FZHA 2E88A 4BRDA 3NH0A 3BZCA 4DSJA 3C0BA 3BP8A 4LSNA 2HBMA 2OZMA 3OYBA 3O08A 1OVQA 1WOQA 3IMXA 3IRXA 4IFYA 4JI6K 1BO5O 2YKMA 2W41A 1ASWA 1WAJA 3NF6A 4CJSA 1SKWA 1UA0A 2QKBA 2AP1A 5BR9A 4Z4HA 4DQQA 2IAJA 3M3ZA 1EWQA 1C1AA 3C6TA 3AVBA 3FZFA 2VG6A 4E7JA 1W7AA 1JJ2M 1IKXA 3D2FB 4DMNA 4E1NA 4W5TA 4O0IA 1DKGD 1NGIA 5F0XA 4NO7A 1LAVA 5C2FA 5AR0A 3P31A 4H0YB 1J6ZA 4ISGA 3I8BA 3O3HA 3IS9A 4BGBA 1IBLK 3QB0A 5H1SQ 5J2NA 1VAZA 1NU0A 3MK6A 4BRHA 3L4QA 2GV9A 1ZBIA 5HRSA 4YNQA 1WSFA 3AVJA 2OCEA 3THVA 1ASUA 4YY3K 2O4GA 1F21A 5AQMA 3VN5A 4CZHA 1TKXA 2XY8A 3W0LA 3O5BA 4B1ZA 1VHXA 4FSVA 4DU4A 4B9VA 4EHUA 2E1YA 3DXKB 1T6CA 3O4WA 3SI6A 1GLLO 4OPJA 1UA1A 4KO0A 3F2KA 1YITN 3A5LC 3NF9A 3OYIA 3CC7N 4J2BA 4LF7K 2FF3B 4JLHA 3AY9A 3SPZA 1J5EK 1JXBA 5C0YA 2A42A 1JXEA 5AQSA 2IVPA 2P9SA 4CJWA 1IBMK 1X9JA 1X9MA 1WN7A 3T1AA 3TAPA 3CG7A 2P9UA 4CEZA 4IZ9A 4DFPA 2E1ZA 3QESA 2QKKA 5KRSA 4WCEL 1LV5A 5J2MA 4HTLA 2YJFA 3RMAA 4IOXA 3NFAA 3U9DA 1ZBSA 1C0FA 1DT9A 3P83D 2UYTA 1BWFO 1JLBA 1KAXA 1HLUA 3D45A 4LY7A 4PKGA 4BC4A 3H46O 4CF0A 4C8LA 4B1WB 3PV8A 3JXUA 4O8UA 3KJVA 3V9XA 3T7ZA 1RCHA 2P9PA 1NBWA 3SYZA 4JKHA 4LFAK 5HL7L 2PAVA 1C1BA 3C7NA 2DFEA 3MEEA 3LPTA 1TGOA 4DTXA 2GEMA 5C42A 4R5PA 3VQBA 4F3OA 4M3TA 1H1VA 1B92A 2WBNA 2ZWHA 2WUSA 3AVMA 4JHDA 5FPMA 1KAZA 2R7YA 4BVOA 2ASMA 1ATRA 3VQ4A 3SUOA 2OTJN 4DV4K 1M90O 3RMCA 5AQOA 3LP1A 3KK1A 3DLRA 4YDUC 2Z1IA 4GW6A 1WLJA 4AH9A 4Z4CA 3C65A 1RBTA 5I3UA 1Q8IA 3OS0A 4TSXA 5F2RA 4GKKK 4FXDA 1UAXA 2HBJA 3K5NA 3UKUB 3J7ZO 1K6YA 3SMPA 3AARA 1X9WA 2QI2A 4B1UB 5AQKA 3KHYA 4B9MA 1UWBA 3P38A 4CZFA 3ENBA 3D6RA 3OW2M 2E5LK 1EWRA 1QHAA 5HROA 4DQPA 3CJ9A 3ZETA 3LDLA 5LL6Z 3KK7A 4BE2A 5C24A 2GBZA 2P5GA 1HQEA 3M6GA 4DS5A 4JI4K 4WF9L 3CCJN 4CW7B 1OH5A 2KKZA 4KREA 5LJVA 3HPGA 4WE1A 1J5OA 4BROA 3DRRA 2E2NA 4B1YB 4FO0A 1RBUA 4AF1A 1YXQA 1QSYA 4CGJA 1BQMA 3VQ7A 5AZJB 4E7LA 1GLBG 4Z4GA 3UIQA 3AA5X 2YNGA 3PX0A 2HHUA 4CJ3A 4BDPA 3OTOK 3SK3A 3B8AX 4WQ5A 4FZXC 4XH4A 3A8YA 1RGIA 2YHAA 2VQEK 4DSEA 1J53A 4GVEA 4CBXA 1LW0A 5TKWA 2CGKA 5A2QO 4OJRA 2OPSA 4KI6A 3D2EB 3CJBA 3SAGA 3MN6A 3QICA 1XHZA 5M1FA 1YTUA 2FXUA 4DSKA 1IKVA 4KH5A 3DWLA 2O8DB 2P9NB 4JRPA 4M41A 2HW3A 3A5OC 2UXCK 4FJJA 1NK7A 4DR5K 3V9SA 2YKNA 1KXPA 2NRHA 4CBUA 5HOOA 3QETA 5LY3A 1J54A 4RW7A 3TR8A 3VF4A 2VWJA 1BGXT 4PA1A 4R79A 3M1FA 4IEIA 4AHCA 4MLHA 2IVNA 2Q0RA 3PO4A 1XMQK 4QS9A 4FJLA 3AVNA 3LANA 3FLCO 3ZX0A 4B3TK 3NCIA 1DTTA 2KFZA 4IFEA 1TYQA 2E2PA 3U3GA 1KVBA 4BACA 3VESA 1GLJO 2ZGYA 3WXMB 3BGRA 4W5RA 1E3MA 4CJEA 1NJWA 2QWMA 4FK2A 4QS8A 4JKBA 3TI0A 5MLCQ 3U3YA 3ID6A 3UKRA 3FZKA 4FZYA 3O3FA 3I56N 3V6DA 4KHUA 4KV8A 4JS4A 4E3SA 3WNFA 1JCGA 1N8RO 1S1WA 3C95A 3AV9A 3T1YK 1QQOA 4IFVA 1VSDA 3CFPA 4IOAL 1NLVA 3CMEN 3O80A 1KLMA 1KVCA 3VEVA 1W9HA 2G8UA 2JWKA 2VGMA 5FPNA 4CIGA 3TWHA 1Q9YA 3H6EA 1IG8A 3E01A 4KKOA 1Y97A 3OHRA 3MN9A 4IO8A 2QWQA 3EE8A 4ZTJA 4N5SA 4LSLA 3R1XA 1CZBA 4IKFA 3O1BA 4YOUA 2HNZA 1D5AA 4DR7K 4ID1A 1T3VA 1WSEA 4FOEA 5I42A 1TUUA 1MDUB 3RSEA 2IIRA 4C8KA 1QZ6A 1KFSA 2QWLA 1GOBA 3ITHA 4KH4A 1RDWX 3IFRA 1LW2A 2P9LA 1VQNN 4OKEA 4GVMA 3S3NA 4CHZA 3U6FA 3KVGA 1K8KA 4Y0WA 1VSFA 4CFAA 2X78A 4FWSA 2YX6A 3O9QA 4NCGA 3LDSA 4OKJA 2P9SB 4BDYA 4BR5A 1L3SA 1RDCA 5CZ2A 2P9UB 1N36K 3M8PA 1T05A 4CJUA 4X62K 4IJAA 4OLBA 2ETJA 4MQ3A 4JD2A 3AA3A 3OYLA 4LF5K 1J9AA 2F9WA 1P90A 3VQAA 3ZSQA 1XC9A 4E19A 3D0PA 3QERA 1GOCA 3DLLL 4HTUA 4EZ9A 3WQUA 3RR7A 3SQ1A 3H08A 4CEFA 4M3RA 4OLAA 3NVKA 4N41A 2OPRA 4H5VA 3SQ0A 1G99A 3K5MA 1IKWA 1GOAA 3MCPA 4PKHA 3VQPA 4BE1A 3ZEUA 1REVA 3PUFA 3QFUA 4DV3K 3S3MA 2PZSA 5GINA 3B6PA 4FK4A 2O8BA 2P9PB 1OVYA 4CZGA 3HL8A 3ENOA 2XO7A 1HKGA 3MXMA 3C7NB 3LP0A 1OKJA 2G8HA 3CQYA 3DOLA 4DV6K 4BDZA 2HF3A 3QNOA 4M3YA 1MU2A 1BOTO 2G8VA 4DFJA 3CQ8A 3TAFA 5JS1A 1CXQA 3P1GA 4BR9A 3Q7CA 4CF8A 4CJ4A 4BRGA 1NGEA 3MX2A 1HYZA 3EL2A 3J80O 3KK2A 1L3VA 3D7EO 3DLEA 1JLFA 3WXLA 1G15A 4EIAA 4KHYA 2D0PA 2P9IA 3AO4A 4DB3A 2Q97A 3OYAA 3RRGA 1TK8A 3OJSA 3PO5A 1YHQN 1HJOA 2QWRA 1S9GA 4BRLA 5C15A 2PY5A 3BDPA 4F9OA 3R3LA 3CF5L 1TL1A 2Z1HA 3QEXA 4LH5A 3KIOA 4B3SK 2P9KA 5J1EA 2CH6A 4JK8A 1W0HA 4AHRA 1RDUA 1JLCA 3SJHA 3ZETB 4KAZA 3EEQA 3G6EN 3OBWA 2NRZA 3AO2A 4DTNA 4CECA 3EN9A 4DR1K 1ATNA 3LALA 4JKEA 3MMVA 3CI5A 4ICLA 2ZE2A 4BWJA 4OVLA 4CD1A 4CZIA 3VF2A 4L8RB 1SL0A 3A2FA 4BRFA 3L2WA 2AA4A 1HJRA 2ASOA 1YJNN 4DSIA 4JI0K 4YHHK 1Z26A 4WFBL 2E8AA 3MAQA 2KHOA 1QQNA 1YAGA 4A62A 2BH1A 3NGZA 3AGRA 4DSLA 2NLXA 5CZ1A 2Y1JA 3K0SA 1HYSA 4FCYA 3DXMB 1D9FA 4DCHA 4JEPA 4A2BA 2HHTA 1OH7A 1WUAA 2O4IA 4DWIA 3SAFA 3ULDA 1SZ2A 1Z6RA 3RMBA 3ZSVA 5CYMA 3ZX3A 3SQ2A 4HCCA 3MWPA 5GAGP 3VQCA 5CR4A 1VSJA 4I9LA 3AAPA 3H3OB 1HNXK 3CMAN 2B4JA 4PKIA 4CEDA 5AQPA 4HCBA 1KAYA 3VQEA 1DEJA 4G1QA 4EAHD 4FL9A 3EY1A 2IDOA 4HHTA 4BRKA 1NK5A 4JKGA 5AQQA 3G10A 5C10A 5DM7L 3HVRA 2A41A 3L2QA 4G9ZA 1ZYQA 2HNYA 1TYQB 1VQ9N 3OBYA 4F4KA 3VQ8A 2Z1GA 2VWKA 2OZSA 3L2RA 3EYZA 4CJRA 1BG3A 3L2UA 3BZKA 4CFBA 2A5XA 3UKRB 1BI4A 4Z94A 3C6HA 5LJWA 3CCUN 3SUQA 1U45A 3ZSOA 3AVGA 4O44A 1SS6A 5GIPA 4FJGA 2ZM6K 4QAGA 3QO9A 3G0ZA 3NMUA 3HM8A 4LF4K 3ALYA 3CJ7A 1NJZA 4FYDA 1WSGA 1U6ZA 2FF6A 3VQDA 3PX4A 1Q82O 4DLGA 2E6LA 3SLCA 1C1CA 5JICA 1NK8A 4O4GA 4O0JA 4CFDA 3TPQA 5GAEP 3KKSA 1YJ9N 3SV4A 3S41A 2QA4N 1RT7A 3TAMA 4CD3A 5JLFA 5J2PA 1VQ4N 4PL8A 3VERA 4XEIA 1EQYA 1S1UA 3VGKA 4CZMA 1ATSA 4NYNA 1MWMA 4YOWA 3FE1A 1KVAA 3LAMA 4WQ4C 1S1XA 5AQZA 1HMVA 3SUNA 3N4PA 4IG3A 4WQ5C 3DLGA 3WNHA 3KWIA 1Q18A 3RSEB 1JCFA 1HYVA 1BCMA 2QTDA 1WSHA 2P9LB 3IAYA 3MX5A 4A5AA 4DHYA 4ILGB 5TKYA 1IG9A 1T6DA 3PSIA 3EO3A 1RT2A 2ZJQL 1WSIA 2AJQA 3OYMA 1YVNA 2UXBK 4FWLA 3L6QA 1XUPO 2FBTA 4Q5VA 4LH4A 4BRCA 1NKCA 3AVCA 3ZSXA 2HVIA 3VEZA 3VTIA 2QXLA 1HNZK 3QIPA 3NVMA 1VQ5N 1VQMN 4U67L 1TKTA 2RF2A 4WFAL 1RTHA 3GG4A 4JD2B 1GLEG 3HPHA 4DTSA 5AQFA 2RN2A 4B9UA 2HHWA 1ZXOA 3J8AA 1TKDA 1FKOA 5C2DA 4CJPA 4MO5A 3K5LA 3MDQA 4BQLA 1JCEA 4DKWA 3RTVA 1XI1A 3RVCA 3ZEUB 4JI1K 4BY9C 4GKJK 2NRVA 3H1VX 4YORA 1BISA 3CXCM 1U47A 1O13A 2CGLA 4UY8O 3WUHA 5AZIA 4CZEA 1FJGK 2O8BB 4CEOA 4BC3A 1I94K 3CJ1A 4H0PA 4CESA 1U48A 4A57A 5CY4A 5AQLA 4BC2A 4W5QA 4FJ9A 1XMOK 4PL7A 3M8RA 4H4MA 3LM9A 4BRAA 1SL1A 1EX4A 3IDHA 1BL3A 4C8NA 4AHUA 2BGGA 3HJFA 1IKYA 1SUQA 4J2EA 1KC8O 4M45A 2RHKA 4DF4A 1CZ9A 5EY4A 3DOKA 2DFFA 5HBMA 2HHSA 1NGGA 3L0QA 4J2DA 3HOSA 4EZ6A 5EXWA 5BREA 4YOVA 4V19S 1I39A 5ELZA 3R8EA 4JV5K 1HQUA 3R9PA 4FJ5A 2P9IB 5BN8A 4C8OA 4RW6A 3O1WA 5AJ3K 1WAFA 1XNRK 3E66A 4RW4A 5FPEA 4DQ8A 1Q9XA 4I9QA 4IOCL 2G8WA 2HBLA 3K2PA 4H5WA 4LFCK 4CK3A 5M1NA 4QOZB 3T19A 3VPZA 3IG1A 4E7KA 2HB5A 3H1QA 4A61A 3E9OA 3SCXA 3FFIA 2YV0X 2VYPA 4BE0A 1E4FT 3THXA 3NH1A 4MFBA 4FLXA 5AQHA 1BA0A 1XNQK 2YCHA 1LWFA 5KQDA 4JI3K 4KHQA 5BPNA 3CERA 2V52B 2F96A 2D0CA 1S1TA 2YHXA 3LP2A 3ENHA 5KRTA 1A5XA 1BCOA 1JL2A 3ZT3A 4CJLA 4LF8K 1KCFA 4OO1J 2HHQA 1O1WA 1QHTA 2NRXA 1VSKA 5CYQA 2G8KA 3HP6A 3K58A 5JMVA 2D1KA 4DF8A 3VTHA 1S5JA 2CH5A 3CCMN 4RCHA 4CBWA 3FFKB 1X1PA 4KB0A 3K9KA 4FJHA 3HVTA 2WFBA 3VEXA 3K9JA 3I33A 4DSFA 4FOIA 5KGXA 5FPDA 4PQUA 3CPEA 1JLAA 1ZBUA 3GE1A 4KFBA 3RWUA 4M3UA 4HWIA 1HRHA 5SWMA 3HOTA 2B5JA 3GBTA 3VA0A 3PY8A 4FM0A 3O4NA 3OYGA 1EXQA 3OYFA 4ZTFA 4H0OA 2XHBA 3ATUA 2QM1A 1GLDG 3V9UA 4HUGA 2UU9K 4KH6A 5JLHA 2X6NA 1DTQA 4DQRA 3TSUA 1XWLA 4ID5A 1D4XA 4CJ7A 4DG1A 4YFUA 3QLHA 2E6MA 4BC5A 5CHIA 1Z05A 3F73A 2PYJA 3LDQA 4B9SA 2PBDA 3QEWA 4JKGB 3HT3A 4DTPA 3CCSN 1HX1A 1S22A 3M8SA 3KD5E 4H5RA 4KTQA 3V4IA 4DFMA 3OYHA 5HLFA 1RDBA 1ITGA 5AQYA 1SKRA 3TSPA 4CZKA 2E2OA 5BR8K 3I0SA 3UE5A 3ZSWA 4O5BA 4Z4FA 3HI0A 5DK5A 2XRIA 1BI4B 3CQXA 4CVNE 1DLOA 3OS1A 4M7XA 2VQFK 2FBVA 3SZ2A 1I3AA 3Q7BA 3TTFA 3QMLA 5GIOA 3ISNC 3OYDA 2XY7A 5BRHA 2ATQA 4A5BA 1X3MA 5SZTA 3ULEA 3ZT2A 1NK4A 1KD1O 3ZX2A 3TABA 3LDPA 4LD0A 2LSNA 4CCHA 4I2PA 1X9SA 1N34K 3AVFA 3THWA 1NGDA 1NNEA 4NB4A 3AVAA 5T7BA 2QWPA 4RTFD 3SV3A 4FWQA 4CK1A 3FZLA 3NGYA 3CM5A 4X66K 4FPBA 4B9LA 1CLQA 1CZAN 5BPMA 1B9DA 1E4GT 1R0AA 3P4IA 3TTDA 4XH1A 4JI8K 4GNIA 2B6AA 3KLHA 1N33K 3NF8A 4MO4A 3VETA 4FLVA 3NH2A 4OKKA 2KQ2A 1TL3A 4E1JA 2UXDK 3ZSZA 4E0DA 4GV9A 3SQ4A 1RT4A 1V4SA 2RKIA 2FC0A 3QIOA 2GWKA 2VCPA 5BPLA 1EO1A 1NGAA 2GELA 2JWLA 1BHLA 3LP3A 3HM9A 1JLGA 2Q36A 2ITGA 3QDKA 4AHVA 5LMNK 3AVIA 3SJJA 5HRPA 3QNNA 4N47A 3J81O 3V9ZA 3H3NO 3LWMA 4Y1CA 3J7AP 3G4SN 4JYAK 3QEPA 5AQXA 5M1OA 1L3UA 4DR2K 3BEXA 4FJKA
chains in the Genus database with same CATH topology
4BVOA 2ASMA 4JKGA 5AQQA 4BRIA 2YJEA 1LCUA 1ATRA 1S3XA 3PLAA 2OTJN 3WEEA 5C10A 3N4QA 5DM7L 1M90O 3CD6N 2A41A 5AQOA 3TU5A 4G9ZA 4YDUC 1TYQB 1VQ9N 3OBYA 3G25A 3F9MA 4JHDB 4C1NK 3C65A 2I7PA 4IXCA 1HKBA 2PFUA 3DXKA 5F2RA 2HBJA 3UKUB 4FWNA 4CI6A 3J7ZO 1BG3A 2D0OA 3SMPA 3CC2N 3AARA 2QI2A 4B1UB 1NWKA 5AQKA 3KHYA 3P38A 4A2AA 4CZFA 2A5XA 2FSJA 3ENBA 1T44A 2ZF5O 2NZTA 3HBTA 3UKRB 3IUCA 3U9DA 3VGLA 4C23A 3C6HA 4Z94A 5LJWA 3CCUN 3D6RA 5GADP 3OW2M 3CC4N 1QHAA 1SS6A 4FWMA 5GIPA 3TTCA 5B8HA 4K25A 4H0VB 5BN9A 3CJ9A 1W2BM 1LOTB 5AZIB 3ZETA 1Y64A 4BG9A 4BRKA 4JNEA 3LDLA 3NMUA 3KK7A 3HM8A 3JS6A 3CJ7A 4ISEA 1M1KO 1VQ7N 1YF5L 4K41A 2DPNA 4ILJA 3M6GA 1U6ZA 2FF6A 4K42A 3PIPL 2VGNA 4M7YA 4WF9L 3CCJN 4AM7A 1Q82O 1Q86O 1NJIO 2KKZA 3LL3A 4GV3A 3SLCA 4BQZA 5ADXA 5JICA 5LJVA 5AQGA 2BTFA 5I9EB 5JVGL 4BROA 2E2NA 4B1YB 2WC9A 4FO0A 3VMFB 3TPQA 3CHWA 3SBGA 4AF1A 2HBKA 1YXQA 5GAEP 1YJ9N 3S41A 4BVPA 2QA4N 5AZJB 4JAXA 4H03B 1GLBG 2FSKA 4CD3A 3M5RA 5JLFA 2HSTA 3VF6A 1VQ4N 3CCVN 5AQIA 3CETA 3FR0A 5M1QA 2F9TA 4PL8A 2GUPA 3EKSA 3EZWA 4JK7A 4FPAA 2GTDA 4XEIA 3SK3A 1EQYA 3B8AX 4WQ5A 3VGKA 4BRQA 4CZMA 1K9MO 1ATSA 4XH4A 3A8YA 1BA1A 1MWMA 1RGIA 3FE1A 4YOWA 3WXIA 4GY2B 4WQ4C 4GVEA 5AQZA 4CBXA 5TKWA 2CGKA 1QQMA 1XC3A 4OPAA 5AFUA 2YI1A 1SAZA 3LDNA 3N4PA 2P9NA 3D2EB 3CJBA 4WQ5C 3SAGA 3KWIA 3MN6A 3DAWA 1Q18A 3RSEB 1JCFA 3QICA 2OTLN 2EWSA 4IEEA 3KZBA 5M1FA 4H0XB 2FXUA 2QTDA 2P9LB 4KH5A 3DWLA 3MX5A 4A5AA 4DHYA 4ILGB 2P9NB 5TKYA 2HF4A 1T6DA 1W97L 3EO3A 3A5OC 3GDQA 2ZJQL 4ISFA 1Q81O 1KXPA 5E84A 1YVNA 2NRHA 3HZ6A 4JN4A 4FWLA 4CBUA 3L6QA 5HOOA 5LY3A 3WQTA 1XUPO 3EE9A 3VF4A 4IDHA 5BRFA 1GLFO 3MWTA 4BRCA 5KQ8A 4BREA 2VWBA 4R79A 3VEZA 3VTIA 2QXLA 3M1FA 4IEIA 3NVMA 2IVNA 2Q0RA 4MLHA 4U67L 1KQSM 1VQ5N 1VQMN 4JKDA 4QS9A 4WFAL 1BU6O 1ILYA 2HMPA 1NGJA 3GG4A 3W3DA 4JD2B 2NRRA 3CCEN 4YOXA 3FLCO 3ZX0A 1GLEG 3BF3A 4IFEA 1TYQA 1QZ5A 3HTVA 5AQFA 2E2PA 4IJNA 5JVHL 3AGKA 3F5TA 2IVOA 3HRGA 3VESA 1GLJO 3A5NC 2ZGYA 1NM1A 1ZXOA 5AQRA 3WXMB 3O9TA 1VQKN 3J8AA 4K43A 5C2DA 4IO9L 3UKUA 4MO5A 2CGJA 3MDQA 4J8FA 4BQLA 1JCEA 1NMDA 2QWMA 4DKWA 1V4TA 4MDAA 4QS8A 3WT0A 4JKBA 5M1PA 5MLCQ 4A59A 3ID6A 3UKRA 3RVCA 2FSNA 3ZEUB 2W40A 1ZC6A 3FZKA 4CZLA 2Q0UA 5AQUA 5EVZA 4BY9C 3MN7A 2NRVA 4BRNA 4FWRA 3H1VX 3I56N 3IKMA 4YORA 3VEYA 5E26A 3CXCM 1VQON 2H3GX 4BR2A 1O13A 1JCGA 2CGLA 1K8AO 4UY8O 3E1YA 3WUHA 5AZIA 3MCAB 4CZEA 5KPTA 3GOIA 1N8RO 4BC3A 2QWOA 2E2QA 3H45C 3CJ1A 1QQOA 4H0PA 3CCRN 4OPHA 3VOVA 4A57A 5AQLA 4BC2A 2Q2RA 4IOAL 4C1NI 4PL7A 1NLVA 3LM9A 5AQJA 4BRAA 5ADXH 4YOYA 3VERA 1S72N 5EX5A 1K73O 3CMEN 3O80A 3IDHA 3VEVA 3G71N 2ASPA 3P39A 4H5NA 5AZJA 1TUYA 1KC8O 2RHKA 3FGUA 2JWKA 3O9RA 2VGMA 5EY4A 5FPNA 4IWVA 3BUZB 1VQLN 3H6EA 1IG8A 1NGGA 3L0QA 4NLCA 1YJWN 3OHRA 3MN9A 4IO8A 2QWQA 3HOSA 3EE8A 5EXWA 5BREA 4YOVA 4PHTX 2V51B 4BGAA 5ELZA 3R8EA 2Q1NA 3R1XA 3R9PA 2P9IB 5BN8A 1HPMA 3QBWA 4FVUA 3ATVA 4EHTA 3O1BA 4MDBA 3O1WA 4YOUA 5KPRA 4I6MB 4JKCA 3E66A 1QVGM 1T3VA 4MLEA 4DQ8A 5FPEA 3CPWM 5AFUH 1VQ6N 2ZGZA 4QS7A 3BF1A 1U2VB 4IOCL 4BRPA 3O9UA 3O6WA 2HBLA 3D2EA 4FOEA 2BUPA 4H5WA 5M1NA 1ESVA 1TUUA 2ITMA 1MDUB 3RSEA 2IIRA 3U4LA 1QZ6A 3VPZA 4NLBA 2QWLA 4YOTA 3H1QA 4A61A 3E9OA 4KH4A 1RDWX 3IFRA 2V7YA 2P9LA 4XH5A 4B1XB 1VQNN 4CZJA 2VYPA 2NRTA 4EFHA 1E4FT 5BRDA 4LC9B 3KVGA 1K8KA 4Y0WA 3SBTA 3SMSA 4FWSA 2YX6A 3O9QA 1BUPA 1BA0A 4L3QA 2FLOA 5AQHA 4BRMA 5M1KA 2E20A 2YCHA 3ULEB 2P9SB 3AAQA 3DJCA 4M63C 1VQPN 1R59O 5KQDA 4BR5A 3U8XA 5BPNA 4U7BA 2NRWA 2P9UB 3CERA 2RE2A 4KBOA 2V52B 4JKFA 1K8KB 2F7TA 2A3ZA 3CJCA 2Q31A 3E9PA 2YHXA 5AQWA 3HSCA 1HUXA 4IJAA 4RWTA 3ENHA 4FWPA 4GV6A 4H5TA 4OO1J 4JK9A 3I55N 4FWOA 1IJJA 3FZMA 2NRXA 4JD2A 3FZHA 2E88A 3MN5A 4BRDA 1Q7YO 3C0BA 3BP8A 2HBMA 2F9WA 1P90A 2QW9A 1MWKA 3O9SA 3A0IX 3O08A 5JMVA 3DLLL 2D1KA 1WOQA 1NGFA 3VTHA 3IMXA 3WQUA 1XQSC 2NNWA 2CH5A 3CCMN 3L4IA 4RCHA 4CBWA 3FFKB 1BO5O 3K9KA 3NVKA 3E9LA 4H5VA 5KPZA 2WFBA 3VEXA 3K9JA 1G99A 2W41A 4FWKA 3I33A 3MCPA 1RFQA 4FOIA 4PKHA 3ZEUA 5FPDA 2AP1A 5BR9A 3CPEA 3QFUA 2ZJRL 3GE1A 3LM2A 5GINA 3M3ZA 4HWIA 3FZFA 3HOTA 2QEXN 3GBTA 5GAHP 2P9PB 1OVYA 4CZGA 5DM6L 1JJ2M 3VENA 3ENOA 1HKGA 1HKCA 3VGMA 3D2FB 3CCQN 2I7NA 3C7NB 4H0OA 3U9ZA 1OKJA 2QM1A 3ATUA 1DKGD 1GLDG 3CQYA 1NGIA 2HF3A 5F0XA 3QFPA 4NO7A 1QVFM 4KH6A 1MA9B 5AR0A 5C2FA 4B9QA 1BOTO 5JLHA 3EKUA 3P31A 2A6AA 1J6ZA 4H0YB 3I8BA 4ISGA 4O8KA 3TSUA 4BGBA 3QB0A 4BR0A 5H1SQ 5F1XA 1D4XA 4CJ7A 4JKAA 1VAZA 1DGKN 3MK6A 4BC5A 4BRHA 5CHIA 3L4QA 4BR7A 4BR9A 3Q7CA 1Z05A 4BRGA 3LDQA 1NGEA 2PBDA 3MX2A 3EL2A 4JKGB 5AQNA 3CCSN 3D7EO 1HX1A 1S22A 3WEEB 1YI2N 5AQMA 3T69A 3WXLA 4H5RA 3TSQA 4CZHA 4EIAA 2D0PA 3O8MA 2P9IA 2QWNA 2GX9A 4DB3A 5AQYA 2Q97A 3W0LA 3O5BA 3TSPA 4FSVA 4B1ZA 4I6MA 4CZKA 4EHUA 1SQKA 1NGBA 2E1YA 2E2OA 3DXKB 1T6CA 3O4WA 3UE5A 1YHQN 1HJOA 1U2VA 2QWRA 3WXKA 4BRLA 5C15A 4F9OA 3HI0A 3R3LA 1GLLO 3CF5L 3CIPA 3F2KA 1YITN 3A5LC 3CQXA 3KWGA 2D4WA 4M7XA 4O5FA 2P9KA 3PIOL 2CH6A 4AM6A 3Q7BA 4JK8A 3TTFA 3QMLA 5GIOA 3CC7N 1RDUA 3SJHA 3ZETB 2FF3B 5BRHA 3G6EN 3OBWA 3AY9A 1NGCA 1X3MA 2NRZA 5AQVA 4A5BA 5C0YA 2A42A 1X3NA 5AQSA 2IVPA 3ULEA 3EN9A 2P9SA 1ATNA 1X9JA 2P9KB 4H0TB 1KD1O 3ZX2A 3LDPA 2P9UA 4JKEA 3MMVA 4WQ4A 3CI5A 3VEWA 1GLAG 4IZ9A 3CCLN 1NGDA 4BR4A 2E1ZA 4NB4A 2QWPA 4RTFD 4FWQA 4ILHA 2KLAA 3ID8A 4CD1A 4CZIA 2A40A 2V7ZA 3ZYYX 3CJAA 3FZLA 3VF2A 5C12A 4WCEL 4FPBA 1CZAN 5BPMA 1P8ZA 2YHWA 4BRFA 4HTLA 2AA4A 1YIJN 2ASOA 2OANA 2YJFA 1YJNN 1E4GT 3P4IA 3TTDA 4IOXA 4XH1A 4WFBL 2E8AA 3UB5A 2KHOA 1ZBSA 2J4RA 1C0FA 3DXMA 1DT9A 3OA9A 1QQNA 4GNIA 4MO4A 3C6AA 1YAGA 2UYTA 3VETA 1BWFO 4A62A 2BH1A 1KAXA 1HLUA 1EO1A 3AGRA 2NLXA 4E1JA 1C0GA 4PKGA 4GV9A 3DXMB 1GLCG 2ZJPL 4BC4A 3H46O 4DCHA 4JEPA 1V4SA 4A2BA 1BDGA 1WUAA 4B1WB 3LDOA 2GWKA 2VCPA 5AQTA 3JXUA 1NGAA 2GELA 2JWLA 4O8UA 5BPLA 3SAFA 3WXJA 1SZ2A 3T7ZA 1Z6RA 2YHYA 2P9PA 2Q36A 3ZX3A 1NBWA 1YUWA 3QDKA 4JKHA 3MWPA 5GAGP 3R6MA 3D2FA 5CR4A 5HL7L 1VQ8N 2PAVA 3C7NA 1NGHA 3A5MC 3QBXA 4WFNL 3AAPA 3H3OB 3CMAN 3SAHA 5EOYA 4PKIA 2HOEA 2GEMA 3H3NO 5AQPA 1H1VA 1KAYA 2WBNA 5CE3A 3G4SN 4YDUA 3GL1A 2ZWHA 2GWJA 1DEJA 2WUSA 4BG8A 4JHDA 5AQXA 5M1OA 3BEXA 5FPMA 4FL9A 4EAHD 4WYBA 4B1VA 1KAZA 3VEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P31 A;  3D6R A;  3EE8 A;  3OA9 A;  4OPA A;  3O9T A;  4OPH A;  3KWI A;  3M5R A;  3L4Q A;  3O9Q A;  3O9S A;  3KWG A;  3RVC A;  3O9U A;  3P39 A;  2RHK A;  3O9R A;  2KKZ A;  2GX9 A;  3P38 A;  3F5T A;  3EE9 A; 
#chains in the Genus database with same CATH topology
 3SPY A;  3HK2 A;  2YHB A;  4BRI A;  2YJE A;  1LCU A;  3NDK A;  1NK6 A;  4FK0 A;  3WEE A;  3N4Q A;  4CGH A;  3HP9 A;  1EET A;  4CEB A;  4FJX A;  3F9M A;  4JHD B;  5JS2 A;  2I7P A;  1HKB A;  2PFU A;  5KGW A;  4B8C A;  3I0R A;  1WBD A;  4CI6 A;  4FWN A;  2D0O A;  1U4B A;  3CC2 N;  4DR3 K;  4DTM A;  1YVU A;  2FSJ A;  5DM6 L;  1T44 A;  2ZF5 O;  4J2A A;  4C23 A;  3K5O A;  3VGL A;  2O8E A;  4I7F A;  5GAD P;  1T7P A;  4CFC A;  3CC4 N;  1RT1 A;  3SNN A;  4KB1 A;  3TTC A;  4FW2 A;  4H0V B;  3J7Y P;  1Z25 A;  4IDK A;  5AZI B;  4BG9 A;  1Y64 A;  5FRM A;  3JS6 A;  4ISE A;  1KRP A;  1M1K O;  1YF5 L;  4K41 A;  1RTI A;  3ZLJ A;  4K42 A;  4XIU A;  3JAM O;  1NJI O;  1OH6 A;  1KSP A;  4AM7 A;  1Q86 O;  3LL3 A;  3KLE A;  2BE2 A;  5ADX A;  5E41 A;  5I9E B;  3TAN A;  5JVG L;  4ELV A;  3DLH A;  3VMF B;  3SBG A;  2HBK A;  4BVP A;  5IWA K;  3LZJ A;  4EP4 A;  4JAX A;  4JS5 A;  4W5N A;  3M5R A;  2HST A;  2D0B A;  3ZSR A;  4FW1 A;  4M3W A;  5AQI A;  4B3R K;  3CET A;  5M1Q A;  4B3O A;  1TAQ A;  2F9T A;  4DR4 K;  2JGU A;  3EKS A;  3EZW A;  3NF7 A;  4JK7 A;  2GTD A;  4BRQ A;  1NJY A;  1K9M O;  4FZZ A;  1LWE A;  3OVN A;  1ZBH A;  1WNS A;  1RTD A;  4ELU A;  2O8F A;  3HST B;  1XC3 A;  4OPA A;  5AFU A;  2YI1 A;  3LDN A;  2P9N A;  4NCB A;  2X74 A;  1VRT A;  3K59 A;  3DAW A;  1JLQ A;  3KZB A;  3RMD A;  3MEG A;  2QXF A;  4DFK A;  1EKE A;  2HF4 A;  3THX B;  2Y1I A;  3GDQ A;  5E84 A;  3HZ6 A;  3L8B A;  4JRQ A;  3EE9 A;  3O3G A;  3T3F A;  3THY A;  4CGF A;  3V1O A;  4ZHR A;  3AA4 A;  2JLE A;  2BDP A;  3L3V A;  4JKD A;  3TAR A;  4CHY A;  1BU6 O;  3DLK A;  2NRR A;  1KTQ A;  4YOX A;  3BF3 A;  2WON A;  3AVH A;  1QZ5 A;  3OYK A;  3HTV A;  4IJN A;  4CHQ A;  5JVH L;  3F5T A;  1U49 A;  1QSL A;  4CIE A;  1NM1 A;  4KPY A;  5AQR A;  3MEC A;  3O9T A;  1VQK N;  4K8X A;  4K43 A;  4DU1 A;  2HHV A;  1T8E A;  1V4T A;  3WT0 A;  4E89 A;  4FJN A;  4A59 A;  1FW6 A;  3I8D A;  4F3T A;  1WB9 A;  4HVJ A;  1ZC6 A;  2FBX A;  2Q0U A;  4RG8 A;  5EVZ A;  5AQU A;  2A1R A;  3VEY A;  1HNW K;  2WTU A;  2H3G X;  1K8A O;  3E1Y A;  2P5O A;  3MCA B;  4H8K A;  3F9K A;  4W5O A;  2QWO A;  2E2Q A;  3ZSY A;  3H45 C;  1HPZ A;  4OPH A;  4FJ7 A;  4JI7 K;  2PYL A;  4DV0 K;  2Q2R A;  3NE6 A;  4B08 A;  3VQ5 A;  4C1N I;  4JI5 K;  5AQJ A;  3B6O A;  4DU3 A;  5ADX H;  3HXM A;  2HHX A;  1S72 N;  1K73 O;  3ZT4 A;  3KLI A;  3G71 N;  1OH8 A;  3OS2 A;  4H5N A;  4KHP K;  5FRO A;  3O9R A;  1VSM A;  2KW4 A;  1RBS A;  4AHS A;  1VQL N;  5C25 A;  1YJW N;  3KK3 A;  4CF1 A;  4PHT X;  2V51 B;  4BGA A;  2NUB A;  1YTA A;  2DTU A;  1HPM A;  3QBW A;  1NKB A;  4UQG A;  4FVU A;  3ATV A;  4K8Z A;  4JKC A;  4FLZ A;  3LPU A;  5FDL A;  3CPW M;  5AFU H;  2ZGZ A;  4QS7 A;  4N76 A;  4BRP A;  3O9U A;  3O6W A;  3TAQ A;  4KI4 A;  2BUP A;  3AO3 A;  4H4O A;  1HNI A;  4BWM A;  3DYA A;  4CJT A;  3U4L A;  4NLB A;  2IS3 A;  4YOT A;  2YNH A;  4XH5 A;  2V7Y A;  3C6U A;  3S9H A;  1IBK K;  4EFH A;  4F8R A;  4LC9 B;  1FKP A;  3AO5 A;  3SBT A;  3SMS A;  1BUP A;  4L3Q A;  1TK5 A;  3RR8 A;  2G8I A;  3ULE B;  1TK0 A;  3DJC A;  3AAQ A;  4M63 C;  3BY5 A;  2BAN A;  1NKE A;  4U7B A;  4DQI A;  1FK9 A;  2NRW A;  2RE2 A;  3L2V A;  4KBO A;  1B9F A;  1K8K B;  2F7T A;  4DV5 K;  3THW B;  3CJC A;  4X65 K;  1HUX A;  2OA8 A;  4RWT A;  4FWP A;  4H5T A;  4CF2 A;  4FJ8 A;  4AQY K;  3I55 N;  4FWO A;  4AIL C;  3FZM A;  4CGG A;  2HMI A;  3MN5 A;  4B8A B;  1U04 A;  1Q7Y O;  3KKR A;  4NXM K;  2QW9 A;  1MWK A;  5DMR A;  1NK0 A;  3O9S A;  3A0I X;  4CEE A;  1NGF A;  1XQS C;  2NNW A;  3L4I A;  3AVK A;  4FLW A;  4I2Q A;  2QK9 A;  3E9L A;  1WBB A;  3NBP A;  5KPZ A;  4FWK A;  1RFQ A;  3LAK A;  1RIL A;  3ZT0 A;  1RBR A;  4NYF A;  2KZZ A;  3OY9 A;  2ZJR L;  1HR0 K;  2F4V K;  3LM2 A;  1IV0 A;  5IT9 O;  2QEX N;  5GAH P;  3DM2 A;  1LWC A;  4DTR A;  4CIF A;  3VEN A;  3MED A;  1HKC A;  1RT6 A;  3VGM A;  4KTZ A;  3CCQ N;  2O8C A;  2I7N A;  4JI2 K;  2GUI A;  3U9Z A;  4FJM A;  4Z4I A;  3QFP A;  1QVF M;  1MA9 B;  4B9Q A;  4FM2 A;  3EKU A;  4O8K A;  2A6A A;  4QCL A;  4BR0 A;  1VSH A;  5F1X A;  4JKA A;  1BIU A;  1DGK N;  4BR7 A;  5HRR A;  1T03 A;  3V9W A;  4B3M K;  2A1S A;  5AQN A;  1QSS A;  2DFH A;  3WEE B;  1QQC A;  1YI2 N;  3T69 A;  1C0U A;  3TSQ A;  3O8M A;  2QWN A;  2GX9 A;  1C6V A;  4I6M A;  1NGB A;  1SQK A;  3WXK A;  1U2V A;  1JL1 A;  2HVH A;  1EP4 A;  3CIP A;  4LF9 K;  1TVR A;  4FM1 A;  2O8E B;  3KWG A;  3LWL A;  2D4W A;  4EP5 A;  4O5F A;  3ZT1 A;  3PIO L;  4AM6 A;  3DMJ A;  3VQQ A;  4Z4E A;  3DI6 A;  1VRU A;  1NGC A;  5AQV A;  1C0T A;  1X3N A;  3QEI A;  2WOM A;  4HUF A;  2P9K B;  2EHG A;  3NGI A;  1L5U A;  4H0T B;  4DV1 K;  3L3U A;  3TAG A;  1QS4 A;  4WQ4 A;  3VEW A;  1A5W A;  1CXU A;  1GLA G;  3CCL N;  4BR4 A;  1BQN A;  4ILH A;  2KLA A;  3ID8 A;  2A40 A;  2V7Z A;  3ZYY X;  3CJA A;  4DUZ K;  5C12 A;  4CJK A;  2W6L A;  1P8Z A;  2YHW A;  2D5R A;  3AO1 A;  4DTJ A;  2OAN A;  1YIJ N;  2F8S A;  1VSE A;  3UB5 A;  2J4R A;  3DXM A;  3OA9 A;  3C6A A;  3RRH A;  1JKH A;  1BIZ A;  3CFO A;  2O8F B;  1S6Q A;  2VG5 A;  4M3X A;  3DRS A;  1C0G A;  1IO2 A;  1GLC G;  2ZJP L;  3S3O A;  1BDG A;  4E7I A;  3LDO A;  5AQT A;  1D9D A;  1TKZ A;  1RDA A;  1VSL A;  3WXJ A;  4DQS A;  2YHY A;  1WSJ A;  4C8M A;  1YUW A;  5FLX O;  4CF9 A;  3R6M A;  3D2F A;  3ASM A;  1VQ8 N;  3MXJ A;  1NGH A;  3A5M C;  3QBX A;  4WFN L;  4CER A;  4DUY K;  3SAH A;  5EOY A;  4B9N A;  2KTQ A;  2HOE A;  3THY B;  1FXX A;  4GMJ B;  4CJQ A;  4HUE A;  5CE3 A;  4YDU A;  3GL1 A;  1D8Y A;  2HND A;  2GWJ A;  4LFB K;  4CK2 A;  4BG8 A;  2VG7 A;  3AA2 A;  5J2Q A;  4PY5 A;  1N5Y A;  4Y1D A;  4WYB A;  4B1V A;  3VEO A;  1C0M A;  1LAW A;  1S3X A;  2ZQB A;  3PLA A;  3CD6 N;  2F8T A;  3HYF A;  3TAE A;  3TU5 A;  1HNV A;  3PSF A;  3G25 A;  4C1N K;  2X6S A;  3C94 A;  3HPO A;  1S1V A;  4IXC A;  3DXK A;  3ZCM A;  5LMU K;  1NK9 A;  2I5J A;  1N32 K;  1NWK A;  4Z0U A;  2DY4 A;  4A2A A;  3MXI A;  3HBT A;  2NZT A;  3IUC A;  4F2R A;  1N6Q A;  1L3T A;  2UUB K;  3HO1 A;  3LZI A;  4FWM A;  1VSI A;  3WNE A;  4B9T A;  5B8H A;  4K25 A;  3O4Q A;  5BN9 A;  1W2B M;  1LOT B;  4K0K K;  4JNE A;  2D0A A;  3QEV A;  4CHP A;  4DTU A;  1NOY A;  4KHN A;  1VQ7 N;  2DPN A;  4ILJ A;  2P51 A;  3PIP L;  2VGN A;  2YNI A;  4M7Y A;  4RW9 A;  4GV3 A;  3M8Q A;  3DLB A;  4BQZ A;  2ZD1 A;  5AQG A;  2BTF A;  4ELT A;  1XHX A;  2WC9 A;  1QE1 A;  2FBY A;  3CHW A;  3KTQ A;  4X64 K;  4H03 B;  2OPQ A;  4CEA A;  2FSK A;  3VF6 A;  3CCV N;  1TAU A;  3FR0 A;  3SUP A;  2GUP A;  3P5J A;  4FPA A;  4FLY A;  1RDD A;  1SL2 A;  4LF6 K;  2UUC K;  1BA1 A;  4M3Z A;  4CJF A;  1NMN A;  3CFR A;  5HP1 A;  3WXI A;  2XY5 A;  3T1H K;  4CEQ A;  4CJ5 A;  4PUO A;  4GY2 B;  3PX6 A;  1QQM A;  1SAZ A;  4CGD A;  3CM6 A;  2EWS A;  2OTL N;  4IEE A;  4CJV A;  4FVM A;  2IGI A;  4H0X B;  3VQ9 A;  4NCA A;  4O55 A;  1JLE A;  1RT3 A;  3OYC A;  1W97 L;  1SKS A;  4CE9 A;  4KTW A;  4ISF A;  1Q81 O;  1ZBF A;  4Q0B A;  2Q3S A;  4JN4 A;  3WQT A;  4IDH A;  5BRF A;  4OGC A;  1GLF O;  4E7H A;  5FRN A;  3MWT A;  4DS4 A;  3EZ5 A;  5KQ8 A;  4BRE A;  2VWB A;  2KZM A;  2W42 A;  4M42 A;  1QTM A;  1KQS M;  3OJU A;  3KD1 E;  1RNH A;  1VK0 A;  1ILY A;  2HMP A;  1NGJ A;  3W3D A;  3CCE N;  3OYJ A;  1TV6 A;  3AGK A;  2IVO A;  3HRG A;  4CHO A;  1RBV A;  3A5N C;  1NOZ A;  4DLE A;  4RW8 A;  2YNF A;  5EU7 A;  5HRN A;  1RT5 A;  3VQ6 A;  4IO9 L;  3UKU A;  2CGJ A;  4J8F A;  1NMD A;  4AHT A;  4CGI A;  4MDA A;  5M1P A;  3KLF A;  4N56 A;  2IOC A;  2FSN A;  2W40 A;  3OYE A;  4CZL A;  3DRP A;  4E1M A;  3MN7 A;  4BRN A;  5D3G A;  4FWR A;  3IKM A;  2E4L A;  5E26 A;  1VQO N;  4BR2 A;  2G8F A;  2OYQ A;  5KPT A;  3GOI A;  3CCR N;  2UUA K;  3VOV A;  4IBN A;  2O8C B;  3QIN A;  4CHN A;  5KI6 A;  4YOY A;  3JYT A;  3V1Q A;  3K57 A;  1RTJ A;  5EX5 A;  1SV5 A;  4KHW A;  1YT3 A;  1S6P A;  2IC3 A;  4OPK A;  2ASP A;  1ASV A;  3P39 A;  5AZJ A;  1TUY A;  3NHG A;  1S9E A;  4FLU A;  3FGU A;  1NG9 A;  4F2S A;  4IWV A;  3BUZ B;  4DV7 K;  2RPI A;  2HHH K;  4NLC A;  1IH7 A;  1ZBL A;  4KHS A;  4IG0 A;  2KFN A;  2Q1N A;  4DTO A;  4EHT A;  4MDB A;  4DV2 K;  5KPR A;  4I6M B;  1QVG M;  4MLE A;  1VQ6 N;  4OGE A;  3BF1 A;  1U2V B;  2OPP A;  3D2E A;  4FJI A;  1ESV A;  2ITM A;  3OYN A;  1A5V A;  4DR6 K;  1KLN A;  3V1R A;  5KTQ A;  4B1X B;  4CZJ A;  2O8D A;  2P1J A;  2NRT A;  5BRD A;  1UOC A;  4PWD A;  3AVL A;  4OX9 K;  2FLO A;  4BRM A;  3KLG A;  5M1K A;  2XY6 A;  2E20 A;  1VQP N;  1R59 O;  3U8X A;  1NJX A;  4NXN K;  2EX3 A;  3CYM A;  3VA3 A;  2W6K A;  5K14 A;  2Z1J A;  4JKF A;  4KRF A;  3NAE A;  2A3Z A;  2Q31 A;  3E9P A;  5AQW A;  3HSC A;  1KFD A;  3JSM A;  4GV6 A;  3WNG A;  4JK9 A;  3V81 A;  1IJJ A;  4FLT A;  3FZH A;  2E88 A;  4BRD A;  3NH0 A;  3BZC A;  4DSJ A;  3C0B A;  3BP8 A;  4LSN A;  2HBM A;  2OZM A;  3OYB A;  3O08 A;  1OVQ A;  1WOQ A;  3IMX A;  3IRX A;  4IFY A;  4JI6 K;  1BO5 O;  2YKM A;  2W41 A;  1ASW A;  1WAJ A;  3NF6 A;  4CJS A;  1SKW A;  1UA0 A;  2QKB A;  2AP1 A;  5BR9 A;  4Z4H A;  4DQQ A;  2IAJ A;  3M3Z A;  1EWQ A;  1C1A A;  3C6T A;  3AVB A;  3FZF A;  2VG6 A;  4E7J A;  1W7A A;  1JJ2 M;  1IKX A;  3D2F B;  4DMN A;  4E1N A;  4W5T A;  4O0I A;  1DKG D;  1NGI A;  5F0X A;  4NO7 A;  1LAV A;  5C2F A;  5AR0 A;  3P31 A;  4H0Y B;  1J6Z A;  4ISG A;  3I8B A;  3O3H A;  3IS9 A;  4BGB A;  1IBL K;  3QB0 A;  5H1S Q;  5J2N A;  1VAZ A;  1NU0 A;  3MK6 A;  4BRH A;  3L4Q A;  2GV9 A;  1ZBI A;  5HRS A;  4YNQ A;  1WSF A;  3AVJ A;  2OCE A;  3THV A;  1ASU A;  4YY3 K;  2O4G A;  1F21 A;  5AQM A;  3VN5 A;  4CZH A;  1TKX A;  2XY8 A;  3W0L A;  3O5B A;  4B1Z A;  1VHX A;  4FSV A;  4DU4 A;  4B9V A;  4EHU A;  2E1Y A;  3DXK B;  1T6C A;  3O4W A;  3SI6 A;  1GLL O;  4OPJ A;  1UA1 A;  4KO0 A;  3F2K A;  1YIT N;  3A5L C;  3NF9 A;  3OYI A;  3CC7 N;  4J2B A;  4LF7 K;  2FF3 B;  4JLH A;  3AY9 A;  3SPZ A;  1J5E K;  1JXB A;  5C0Y A;  2A42 A;  1JXE A;  5AQS A;  2IVP A;  2P9S A;  4CJW A;  1IBM K;  1X9J A;  1X9M A;  1WN7 A;  3T1A A;  3TAP A;  3CG7 A;  2P9U A;  4CEZ A;  4IZ9 A;  4DFP A;  2E1Z A;  3QES A;  2QKK A;  5KRS A;  4WCE L;  1LV5 A;  5J2M A;  4HTL A;  2YJF A;  3RMA A;  4IOX A;  3NFA A;  3U9D A;  1ZBS A;  1C0F A;  1DT9 A;  3P83 D;  2UYT A;  1BWF O;  1JLB A;  1KAX A;  1HLU A;  3D45 A;  4LY7 A;  4PKG A;  4BC4 A;  3H46 O;  4CF0 A;  4C8L A;  4B1W B;  3PV8 A;  3JXU A;  4O8U A;  3KJV A;  3V9X A;  3T7Z A;  1RCH A;  2P9P A;  1NBW A;  3SYZ A;  4JKH A;  4LFA K;  5HL7 L;  2PAV A;  1C1B A;  3C7N A;  2DFE A;  3MEE A;  3LPT A;  1TGO A;  4DTX A;  2GEM A;  5C42 A;  4R5P A;  3VQB A;  4F3O A;  4M3T A;  1H1V A;  1B92 A;  2WBN A;  2ZWH A;  2WUS A;  3AVM A;  4JHD A;  5FPM A;  1KAZ A;  2R7Y A;  4BVO A;  2ASM A;  1ATR A;  3VQ4 A;  3SUO A;  2OTJ N;  4DV4 K;  1M90 O;  3RMC A;  5AQO A;  3LP1 A;  3KK1 A;  3DLR A;  4YDU C;  2Z1I A;  4GW6 A;  1WLJ A;  4AH9 A;  4Z4C A;  3C65 A;  1RBT A;  5I3U A;  1Q8I A;  3OS0 A;  4TSX A;  5F2R A;  4GKK K;  4FXD A;  1UAX A;  2HBJ A;  3K5N A;  3UKU B;  3J7Z O;  1K6Y A;  3SMP A;  3AAR A;  1X9W A;  2QI2 A;  4B1U B;  5AQK A;  3KHY A;  4B9M A;  1UWB A;  3P38 A;  4CZF A;  3ENB A;  3D6R A;  3OW2 M;  2E5L K;  1EWR A;  1QHA A;  5HRO A;  4DQP A;  3CJ9 A;  3ZET A;  3LDL A;  5LL6 Z;  3KK7 A;  4BE2 A;  5C24 A;  2GBZ A;  2P5G A;  1HQE A;  3M6G A;  4DS5 A;  4JI4 K;  4WF9 L;  3CCJ N;  4CW7 B;  1OH5 A;  2KKZ A;  4KRE A;  5LJV A;  3HPG A;  4WE1 A;  1J5O A;  4BRO A;  3DRR A;  2E2N A;  4B1Y B;  4FO0 A;  1RBU A;  4AF1 A;  1YXQ A;  1QSY A;  4CGJ A;  1BQM A;  3VQ7 A;  5AZJ B;  4E7L A;  1GLB G;  4Z4G A;  3UIQ A;  3AA5 X;  2YNG A;  3PX0 A;  2HHU A;  4CJ3 A;  4BDP A;  3OTO K;  3SK3 A;  3B8A X;  4WQ5 A;  4FZX C;  4XH4 A;  3A8Y A;  1RGI A;  2YHA A;  2VQE K;  4DSE A;  1J53 A;  4GVE A;  4CBX A;  1LW0 A;  5TKW A;  2CGK A;  5A2Q O;  4OJR A;  2OPS A;  4KI6 A;  3D2E B;  3CJB A;  3SAG A;  3MN6 A;  3QIC A;  1XHZ A;  5M1F A;  1YTU A;  2FXU A;  4DSK A;  1IKV A;  4KH5 A;  3DWL A;  2O8D B;  2P9N B;  4JRP A;  4M41 A;  2HW3 A;  3A5O C;  2UXC K;  4FJJ A;  1NK7 A;  4DR5 K;  3V9S A;  2YKN A;  1KXP A;  2NRH A;  4CBU A;  5HOO A;  3QET A;  5LY3 A;  1J54 A;  4RW7 A;  3TR8 A;  3VF4 A;  2VWJ A;  1BGX T;  4PA1 A;  4R79 A;  3M1F A;  4IEI A;  4AHC A;  4MLH A;  2IVN A;  2Q0R A;  3PO4 A;  1XMQ K;  4QS9 A;  4FJL A;  3AVN A;  3LAN A;  3FLC O;  3ZX0 A;  4B3T K;  3NCI A;  1DTT A;  2KFZ A;  4IFE A;  1TYQ A;  2E2P A;  3U3G A;  1KVB A;  4BAC A;  3VES A;  1GLJ O;  2ZGY A;  3WXM B;  3BGR A;  4W5R A;  1E3M A;  4CJE A;  1NJW A;  2QWM A;  4FK2 A;  4QS8 A;  4JKB A;  3TI0 A;  5MLC Q;  3U3Y A;  3ID6 A;  3UKR A;  3FZK A;  4FZY A;  3O3F A;  3I56 N;  3V6D A;  4KHU A;  4KV8 A;  4JS4 A;  4E3S A;  3WNF A;  1JCG A;  1N8R O;  1S1W A;  3C95 A;  3AV9 A;  3T1Y K;  1QQO A;  4IFV A;  1VSD A;  3CFP A;  4IOA L;  1NLV A;  3CME N;  3O80 A;  1KLM A;  1KVC A;  3VEV A;  1W9H A;  2G8U A;  2JWK A;  2VGM A;  5FPN A;  4CIG A;  3TWH A;  1Q9Y A;  3H6E A;  1IG8 A;  3E01 A;  4KKO A;  1Y97 A;  3OHR A;  3MN9 A;  4IO8 A;  2QWQ A;  3EE8 A;  4ZTJ A;  4N5S A;  4LSL A;  3R1X A;  1CZB A;  4IKF A;  3O1B A;  4YOU A;  2HNZ A;  1D5A A;  4DR7 K;  4ID1 A;  1T3V A;  1WSE A;  4FOE A;  5I42 A;  1TUU A;  1MDU B;  3RSE A;  2IIR A;  4C8K A;  1QZ6 A;  1KFS A;  2QWL A;  1GOB A;  3ITH A;  4KH4 A;  1RDW X;  3IFR A;  1LW2 A;  2P9L A;  1VQN N;  4OKE A;  4GVM A;  3S3N A;  4CHZ A;  3U6F A;  3KVG A;  1K8K A;  4Y0W A;  1VSF A;  4CFA A;  2X78 A;  4FWS A;  2YX6 A;  3O9Q A;  4NCG A;  3LDS A;  4OKJ A;  2P9S B;  4BDY A;  4BR5 A;  1L3S A;  1RDC A;  5CZ2 A;  2P9U B;  1N36 K;  3M8P A;  1T05 A;  4CJU A;  4X62 K;  4IJA A;  4OLB A;  2ETJ A;  4MQ3 A;  4JD2 A;  3AA3 A;  3OYL A;  4LF5 K;  1J9A A;  2F9W A;  1P90 A;  3VQA A;  3ZSQ A;  1XC9 A;  4E19 A;  3D0P A;  3QER A;  1GOC A;  3DLL L;  4HTU A;  4EZ9 A;  3WQU A;  3RR7 A;  3SQ1 A;  3H08 A;  4CEF A;  4M3R A;  4OLA A;  3NVK A;  4N41 A;  2OPR A;  4H5V A;  3SQ0 A;  1G99 A;  3K5M A;  1IKW A;  1GOA A;  3MCP A;  4PKH A;  3VQP A;  4BE1 A;  3ZEU A;  1REV A;  3PUF A;  3QFU A;  4DV3 K;  3S3M A;  2PZS A;  5GIN A;  3B6P A;  4FK4 A;  2O8B A;  2P9P B;  1OVY A;  4CZG A;  3HL8 A;  3ENO A;  2XO7 A;  1HKG A;  3MXM A;  3C7N B;  3LP0 A;  1OKJ A;  2G8H A;  3CQY A;  3DOL A;  4DV6 K;  4BDZ A;  2HF3 A;  3QNO A;  4M3Y A;  1MU2 A;  1BOT O;  2G8V A;  4DFJ A;  3CQ8 A;  3TAF A;  5JS1 A;  1CXQ A;  3P1G A;  4BR9 A;  3Q7C A;  4CF8 A;  4CJ4 A;  4BRG A;  1NGE A;  3MX2 A;  1HYZ A;  3EL2 A;  3J80 O;  3KK2 A;  1L3V A;  3D7E O;  3DLE A;  1JLF A;  3WXL A;  1G15 A;  4EIA A;  4KHY A;  2D0P A;  2P9I A;  3AO4 A;  4DB3 A;  2Q97 A;  3OYA A;  3RRG A;  1TK8 A;  3OJS A;  3PO5 A;  1YHQ N;  1HJO A;  2QWR A;  1S9G A;  4BRL A;  5C15 A;  2PY5 A;  3BDP A;  4F9O A;  3R3L A;  3CF5 L;  1TL1 A;  2Z1H A;  3QEX A;  4LH5 A;  3KIO A;  4B3S K;  2P9K A;  5J1E A;  2CH6 A;  4JK8 A;  1W0H A;  4AHR A;  1RDU A;  1JLC A;  3SJH A;  3ZET B;  4KAZ A;  3EEQ A;  3G6E N;  3OBW A;  2NRZ A;  3AO2 A;  4DTN A;  4CEC A;  3EN9 A;  4DR1 K;  1ATN A;  3LAL A;  4JKE A;  3MMV A;  3CI5 A;  4ICL A;  2ZE2 A;  4BWJ A;  4OVL A;  4CD1 A;  4CZI A;  3VF2 A;  4L8R B;  1SL0 A;  3A2F A;  4BRF A;  3L2W A;  2AA4 A;  1HJR A;  2ASO A;  1YJN N;  4DSI A;  4JI0 K;  4YHH K;  1Z26 A;  4WFB L;  2E8A A;  3MAQ A;  2KHO A;  1QQN A;  1YAG A;  4A62 A;  2BH1 A;  3NGZ A;  3AGR A;  4DSL A;  2NLX A;  5CZ1 A;  2Y1J A;  3K0S A;  1HYS A;  4FCY A;  3DXM B;  1D9F A;  4DCH A;  4JEP A;  4A2B A;  2HHT A;  1OH7 A;  1WUA A;  2O4I A;  4DWI A;  3SAF A;  3ULD A;  1SZ2 A;  1Z6R A;  3RMB A;  3ZSV A;  5CYM A;  3ZX3 A;  3SQ2 A;  4HCC A;  3MWP A;  5GAG P;  3VQC A;  5CR4 A;  1VSJ A;  4I9L A;  3AAP A;  3H3O B;  1HNX K;  3CMA N;  2B4J A;  4PKI A;  4CED A;  5AQP A;  4HCB A;  1KAY A;  3VQE A;  1DEJ A;  4G1Q A;  4EAH D;  4FL9 A;  3EY1 A;  2IDO A;  4HHT A;  4BRK A;  1NK5 A;  4JKG A;  5AQQ A;  3G10 A;  5C10 A;  5DM7 L;  3HVR A;  2A41 A;  3L2Q A;  4G9Z A;  1ZYQ A;  2HNY A;  1TYQ B;  1VQ9 N;  3OBY A;  4F4K A;  3VQ8 A;  2Z1G A;  2VWK A;  2OZS A;  3L2R A;  3EYZ A;  4CJR A;  1BG3 A;  3L2U A;  3BZK A;  4CFB A;  2A5X A;  3UKR B;  1BI4 A;  4Z94 A;  3C6H A;  5LJW A;  3CCU N;  3SUQ A;  1U45 A;  3ZSO A;  3AVG A;  4O44 A;  1SS6 A;  5GIP A;  4FJG A;  2ZM6 K;  4QAG A;  3QO9 A;  3G0Z A;  3NMU A;  3HM8 A;  4LF4 K;  3ALY A;  3CJ7 A;  1NJZ A;  4FYD A;  1WSG A;  1U6Z A;  2FF6 A;  3VQD A;  3PX4 A;  1Q82 O;  4DLG A;  2E6L A;  3SLC A;  1C1C A;  5JIC A;  1NK8 A;  4O4G A;  4O0J A;  4CFD A;  3TPQ A;  5GAE P;  3KKS A;  1YJ9 N;  3SV4 A;  3S41 A;  2QA4 N;  1RT7 A;  3TAM A;  4CD3 A;  5JLF A;  5J2P A;  1VQ4 N;  4PL8 A;  3VER A;  4XEI A;  1EQY A;  1S1U A;  3VGK A;  4CZM A;  1ATS A;  4NYN A;  1MWM A;  4YOW A;  3FE1 A;  1KVA A;  3LAM A;  4WQ4 C;  1S1X A;  5AQZ A;  1HMV A;  3SUN A;  3N4P A;  4IG3 A;  4WQ5 C;  3DLG A;  3WNH A;  3KWI A;  1Q18 A;  3RSE B;  1JCF A;  1HYV A;  1BCM A;  2QTD A;  1WSH A;  2P9L B;  3IAY A;  3MX5 A;  4A5A A;  4DHY A;  4ILG B;  5TKY A;  1IG9 A;  1T6D A;  3PSI A;  3EO3 A;  1RT2 A;  2ZJQ L;  1WSI A;  2AJQ A;  3OYM A;  1YVN A;  2UXB K;  4FWL A;  3L6Q A;  1XUP O;  2FBT A;  4Q5V A;  4LH4 A;  4BRC A;  1NKC A;  3AVC A;  3ZSX A;  2HVI A;  3VEZ A;  3VTI A;  2QXL A;  1HNZ K;  3QIP A;  3NVM A;  1VQ5 N;  1VQM N;  4U67 L;  1TKT A;  2RF2 A;  4WFA L;  1RTH A;  3GG4 A;  4JD2 B;  1GLE G;  3HPH A;  4DTS A;  5AQF A;  2RN2 A;  4B9U A;  2HHW A;  1ZXO A;  3J8A A;  1TKD A;  1FKO A;  5C2D A;  4CJP A;  4MO5 A;  3K5L A;  3MDQ A;  4BQL A;  1JCE A;  4DKW A;  3RTV A;  1XI1 A;  3RVC A;  3ZEU B;  4JI1 K;  4BY9 C;  4GKJ K;  2NRV A;  3H1V X;  4YOR A;  1BIS A;  3CXC M;  1U47 A;  1O13 A;  2CGL A;  4UY8 O;  3WUH A;  5AZI A;  4CZE A;  1FJG K;  2O8B B;  4CEO A;  4BC3 A;  1I94 K;  3CJ1 A;  4H0P A;  4CES A;  1U48 A;  4A57 A;  5CY4 A;  5AQL A;  4BC2 A;  4W5Q A;  4FJ9 A;  1XMO K;  4PL7 A;  3M8R A;  4H4M A;  3LM9 A;  4BRA A;  1SL1 A;  1EX4 A;  3IDH A;  1BL3 A;  4C8N A;  4AHU A;  2BGG A;  3HJF A;  1IKY A;  1SUQ A;  4J2E A;  1KC8 O;  4M45 A;  2RHK A;  4DF4 A;  1CZ9 A;  5EY4 A;  3DOK A;  2DFF A;  5HBM A;  2HHS A;  1NGG A;  3L0Q A;  4J2D A;  3HOS A;  4EZ6 A;  5EXW A;  5BRE A;  4YOV A;  4V19 S;  1I39 A;  5ELZ A;  3R8E A;  4JV5 K;  1HQU A;  3R9P A;  4FJ5 A;  2P9I B;  5BN8 A;  4C8O A;  4RW6 A;  3O1W A;  5AJ3 K;  1WAF A;  1XNR K;  3E66 A;  4RW4 A;  5FPE A;  4DQ8 A;  1Q9X A;  4I9Q A;  4IOC L;  2G8W A;  2HBL A;  3K2P A;  4H5W A;  4LFC K;  4CK3 A;  5M1N A;  4QOZ B;  3T19 A;  3VPZ A;  3IG1 A;  4E7K A;  2HB5 A;  3H1Q A;  4A61 A;  3E9O A;  3SCX A;  3FFI A;  2YV0 X;  2VYP A;  4BE0 A;  1E4F T;  3THX A;  3NH1 A;  4MFB A;  4FLX A;  5AQH A;  1BA0 A;  1XNQ K;  2YCH A;  1LWF A;  5KQD A;  4JI3 K;  4KHQ A;  5BPN A;  3CER A;  2V52 B;  2F96 A;  2D0C A;  1S1T A;  2YHX A;  3LP2 A;  3ENH A;  5KRT A;  1A5X A;  1BCO A;  1JL2 A;  3ZT3 A;  4CJL A;  4LF8 K;  1KCF A;  4OO1 J;  2HHQ A;  1O1W A;  1QHT A;  2NRX A;  1VSK A;  5CYQ A;  2G8K A;  3HP6 A;  3K58 A;  5JMV A;  2D1K A;  4DF8 A;  3VTH A;  1S5J A;  2CH5 A;  3CCM N;  4RCH A;  4CBW A;  3FFK B;  1X1P A;  4KB0 A;  3K9K A;  4FJH A;  3HVT A;  2WFB A;  3VEX A;  3K9J A;  3I33 A;  4DSF A;  4FOI A;  5KGX A;  5FPD A;  4PQU A;  3CPE A;  1JLA A;  1ZBU A;  3GE1 A;  4KFB A;  3RWU A;  4M3U A;  4HWI A;  1HRH A;  5SWM A;  3HOT A;  2B5J A;  3GBT A;  3VA0 A;  3PY8 A;  4FM0 A;  3O4N A;  3OYG A;  1EXQ A;  3OYF A;  4ZTF A;  4H0O A;  2XHB A;  3ATU A;  2QM1 A;  1GLD G;  3V9U A;  4HUG A;  2UU9 K;  4KH6 A;  5JLH A;  2X6N A;  1DTQ A;  4DQR A;  3TSU A;  1XWL A;  4ID5 A;  1D4X A;  4CJ7 A;  4DG1 A;  4YFU A;  3QLH A;  2E6M A;  4BC5 A;  5CHI A;  1Z05 A;  3F73 A;  2PYJ A;  3LDQ A;  4B9S A;  2PBD A;  3QEW A;  4JKG B;  3HT3 A;  4DTP A;  3CCS N;  1HX1 A;  1S22 A;  3M8S A;  3KD5 E;  4H5R A;  4KTQ A;  3V4I A;  4DFM A;  3OYH A;  5HLF A;  1RDB A;  1ITG A;  5AQY A;  1SKR A;  3TSP A;  4CZK A;  2E2O A;  5BR8 K;  3I0S A;  3UE5 A;  3ZSW A;  4O5B A;  4Z4F A;  3HI0 A;  5DK5 A;  2XRI A;  1BI4 B;  3CQX A;  4CVN E;  1DLO A;  3OS1 A;  4M7X A;  2VQF K;  2FBV A;  3SZ2 A;  1I3A A;  3Q7B A;  3TTF A;  3QML A;  5GIO A;  3ISN C;  3OYD A;  2XY7 A;  5BRH A;  2ATQ A;  4A5B A;  1X3M A;  5SZT A;  3ULE A;  3ZT2 A;  1NK4 A;  1KD1 O;  3ZX2 A;  3TAB A;  3LDP A;  4LD0 A;  2LSN A;  4CCH A;  4I2P A;  1X9S A;  1N34 K;  3AVF A;  3THW A;  1NGD A;  1NNE A;  4NB4 A;  3AVA A;  5T7B A;  2QWP A;  4RTF D;  3SV3 A;  4FWQ A;  4CK1 A;  3FZL A;  3NGY A;  3CM5 A;  4X66 K;  4FPB A;  4B9L A;  1CLQ A;  1CZA N;  5BPM A;  1B9D A;  1E4G T;  1R0A A;  3P4I A;  3TTD A;  4XH1 A;  4JI8 K;  4GNI A;  2B6A A;  3KLH A;  1N33 K;  3NF8 A;  4MO4 A;  3VET A;  4FLV A;  3NH2 A;  4OKK A;  2KQ2 A;  1TL3 A;  4E1J A;  2UXD K;  3ZSZ A;  4E0D A;  4GV9 A;  3SQ4 A;  1RT4 A;  1V4S A;  2RKI A;  2FC0 A;  3QIO A;  2GWK A;  2VCP A;  5BPL A;  1EO1 A;  1NGA A;  2GEL A;  2JWL A;  1BHL A;  3LP3 A;  3HM9 A;  1JLG A;  2Q36 A;  2ITG A;  3QDK A;  4AHV A;  5LMN K;  3AVI A;  3SJJ A;  5HRP A;  3QNN A;  4N47 A;  3J81 O;  3V9Z A;  3H3N O;  3LWM A;  4Y1C A;  3J7A P;  3G4S N;  4JYA K;  3QEP A;  5AQX A;  5M1O A;  1L3U A;  4DR2 K;  3BEX A;  4FJK A; 
#chains in the Genus database with same CATH homology
 4BVO A;  2ASM A;  4JKG A;  5AQQ A;  4BRI A;  2YJE A;  1LCU A;  1ATR A;  1S3X A;  3PLA A;  2OTJ N;  3WEE A;  5C10 A;  3N4Q A;  5DM7 L;  1M90 O;  3CD6 N;  2A41 A;  5AQO A;  3TU5 A;  4G9Z A;  4YDU C;  1TYQ B;  1VQ9 N;  3OBY A;  3G25 A;  3F9M A;  4JHD B;  4C1N K;  3C65 A;  2I7P A;  4IXC A;  1HKB A;  2PFU A;  3DXK A;  5F2R A;  2HBJ A;  3UKU B;  4FWN A;  4CI6 A;  3J7Z O;  1BG3 A;  2D0O A;  3SMP A;  3CC2 N;  3AAR A;  2QI2 A;  4B1U B;  1NWK A;  5AQK A;  3KHY A;  3P38 A;  4A2A A;  4CZF A;  2A5X A;  2FSJ A;  3ENB A;  1T44 A;  2ZF5 O;  2NZT A;  3HBT A;  3UKR B;  3IUC A;  3U9D A;  3VGL A;  4C23 A;  3C6H A;  4Z94 A;  5LJW A;  3CCU N;  3D6R A;  5GAD P;  3OW2 M;  3CC4 N;  1QHA A;  1SS6 A;  4FWM A;  5GIP A;  3TTC A;  5B8H A;  4K25 A;  4H0V B;  5BN9 A;  3CJ9 A;  1W2B M;  1LOT B;  5AZI B;  3ZET A;  1Y64 A;  4BG9 A;  4BRK A;  4JNE A;  3LDL A;  3NMU A;  3KK7 A;  3HM8 A;  3JS6 A;  3CJ7 A;  4ISE A;  1M1K O;  1VQ7 N;  1YF5 L;  4K41 A;  2DPN A;  4ILJ A;  3M6G A;  1U6Z A;  2FF6 A;  4K42 A;  3PIP L;  2VGN A;  4M7Y A;  4WF9 L;  3CCJ N;  4AM7 A;  1Q82 O;  1Q86 O;  1NJI O;  2KKZ A;  3LL3 A;  4GV3 A;  3SLC A;  4BQZ A;  5ADX A;  5JIC A;  5LJV A;  5AQG A;  2BTF A;  5I9E B;  5JVG L;  4BRO A;  2E2N A;  4B1Y B;  2WC9 A;  4FO0 A;  3VMF B;  3TPQ A;  3CHW A;  3SBG A;  4AF1 A;  2HBK A;  1YXQ A;  5GAE P;  1YJ9 N;  3S41 A;  4BVP A;  2QA4 N;  5AZJ B;  4JAX A;  4H03 B;  1GLB G;  2FSK A;  4CD3 A;  3M5R A;  5JLF A;  2HST A;  3VF6 A;  1VQ4 N;  3CCV N;  5AQI A;  3CET A;  3FR0 A;  5M1Q A;  2F9T A;  4PL8 A;  2GUP A;  3EKS A;  3EZW A;  4JK7 A;  4FPA A;  2GTD A;  4XEI A;  3SK3 A;  1EQY A;  3B8A X;  4WQ5 A;  3VGK A;  4BRQ A;  4CZM A;  1K9M O;  1ATS A;  4XH4 A;  3A8Y A;  1BA1 A;  1MWM A;  1RGI A;  3FE1 A;  4YOW A;  3WXI A;  4GY2 B;  4WQ4 C;  4GVE A;  5AQZ A;  4CBX A;  5TKW A;  2CGK A;  1QQM A;  1XC3 A;  4OPA A;  5AFU A;  2YI1 A;  1SAZ A;  3LDN A;  3N4P A;  2P9N A;  3D2E B;  3CJB A;  4WQ5 C;  3SAG A;  3KWI A;  3MN6 A;  3DAW A;  1Q18 A;  3RSE B;  1JCF A;  3QIC A;  2OTL N;  2EWS A;  4IEE A;  3KZB A;  5M1F A;  4H0X B;  2FXU A;  2QTD A;  2P9L B;  4KH5 A;  3DWL A;  3MX5 A;  4A5A A;  4DHY A;  4ILG B;  2P9N B;  5TKY A;  2HF4 A;  1T6D A;  1W97 L;  3EO3 A;  3A5O C;  3GDQ A;  2ZJQ L;  4ISF A;  1Q81 O;  1KXP A;  5E84 A;  1YVN A;  2NRH A;  3HZ6 A;  4JN4 A;  4FWL A;  4CBU A;  3L6Q A;  5HOO A;  5LY3 A;  3WQT A;  1XUP O;  3EE9 A;  3VF4 A;  4IDH A;  5BRF A;  1GLF O;  3MWT A;  4BRC A;  5KQ8 A;  4BRE A;  2VWB A;  4R79 A;  3VEZ A;  3VTI A;  2QXL A;  3M1F A;  4IEI A;  3NVM A;  2IVN A;  2Q0R A;  4MLH A;  4U67 L;  1KQS M;  1VQ5 N;  1VQM N;  4JKD A;  4QS9 A;  4WFA L;  1BU6 O;  1ILY A;  2HMP A;  1NGJ A;  3GG4 A;  3W3D A;  4JD2 B;  2NRR A;  3CCE N;  4YOX A;  3FLC O;  3ZX0 A;  1GLE G;  3BF3 A;  4IFE A;  1TYQ A;  1QZ5 A;  3HTV A;  5AQF A;  2E2P A;  4IJN A;  5JVH L;  3AGK A;  3F5T A;  2IVO A;  3HRG A;  3VES A;  1GLJ O;  3A5N C;  2ZGY A;  1NM1 A;  1ZXO A;  5AQR A;  3WXM B;  3O9T A;  1VQK N;  3J8A A;  4K43 A;  5C2D A;  4IO9 L;  3UKU A;  4MO5 A;  2CGJ A;  3MDQ A;  4J8F A;  4BQL A;  1JCE A;  1NMD A;  2QWM A;  4DKW A;  1V4T A;  4MDA A;  4QS8 A;  3WT0 A;  4JKB A;  5M1P A;  5MLC Q;  4A59 A;  3ID6 A;  3UKR A;  3RVC A;  2FSN A;  3ZEU B;  2W40 A;  1ZC6 A;  3FZK A;  4CZL A;  2Q0U A;  5AQU A;  5EVZ A;  4BY9 C;  3MN7 A;  2NRV A;  4BRN A;  4FWR A;  3H1V X;  3I56 N;  3IKM A;  4YOR A;  3VEY A;  5E26 A;  3CXC M;  1VQO N;  2H3G X;  4BR2 A;  1O13 A;  1JCG A;  2CGL A;  1K8A O;  4UY8 O;  3E1Y A;  3WUH A;  5AZI A;  3MCA B;  4CZE A;  5KPT A;  3GOI A;  1N8R O;  4BC3 A;  2QWO A;  2E2Q A;  3H45 C;  3CJ1 A;  1QQO A;  4H0P A;  3CCR N;  4OPH A;  3VOV A;  4A57 A;  5AQL A;  4BC2 A;  2Q2R A;  4IOA L;  4C1N I;  4PL7 A;  1NLV A;  3LM9 A;  5AQJ A;  4BRA A;  5ADX H;  4YOY A;  3VER A;  1S72 N;  5EX5 A;  1K73 O;  3CME N;  3O80 A;  3IDH A;  3VEV A;  3G71 N;  2ASP A;  3P39 A;  4H5N A;  5AZJ A;  1TUY A;  1KC8 O;  2RHK A;  3FGU A;  2JWK A;  3O9R A;  2VGM A;  5EY4 A;  5FPN A;  4IWV A;  3BUZ B;  1VQL N;  3H6E A;  1IG8 A;  1NGG A;  3L0Q A;  4NLC A;  1YJW N;  3OHR A;  3MN9 A;  4IO8 A;  2QWQ A;  3HOS A;  3EE8 A;  5EXW A;  5BRE A;  4YOV A;  4PHT X;  2V51 B;  4BGA A;  5ELZ A;  3R8E A;  2Q1N A;  3R1X A;  3R9P A;  2P9I B;  5BN8 A;  1HPM A;  3QBW A;  4FVU A;  3ATV A;  4EHT A;  3O1B A;  4MDB A;  3O1W A;  4YOU A;  5KPR A;  4I6M B;  4JKC A;  3E66 A;  1QVG M;  1T3V A;  4MLE A;  4DQ8 A;  5FPE A;  3CPW M;  5AFU H;  1VQ6 N;  2ZGZ A;  4QS7 A;  3BF1 A;  1U2V B;  4IOC L;  4BRP A;  3O9U A;  3O6W A;  2HBL A;  3D2E A;  4FOE A;  2BUP A;  4H5W A;  5M1N A;  1ESV A;  1TUU A;  2ITM A;  1MDU B;  3RSE A;  2IIR A;  3U4L A;  1QZ6 A;  3VPZ A;  4NLB A;  2QWL A;  4YOT A;  3H1Q A;  4A61 A;  3E9O A;  4KH4 A;  1RDW X;  3IFR A;  2V7Y A;  2P9L A;  4XH5 A;  4B1X B;  1VQN N;  4CZJ A;  2VYP A;  2NRT A;  4EFH A;  1E4F T;  5BRD A;  4LC9 B;  3KVG A;  1K8K A;  4Y0W A;  3SBT A;  3SMS A;  4FWS A;  2YX6 A;  3O9Q A;  1BUP A;  1BA0 A;  4L3Q A;  2FLO A;  5AQH A;  4BRM A;  5M1K A;  2E20 A;  2YCH A;  3ULE B;  2P9S B;  3AAQ A;  3DJC A;  4M63 C;  1VQP N;  1R59 O;  5KQD A;  4BR5 A;  3U8X A;  5BPN A;  4U7B A;  2NRW A;  2P9U B;  3CER A;  2RE2 A;  4KBO A;  2V52 B;  4JKF A;  1K8K B;  2F7T A;  2A3Z A;  3CJC A;  2Q31 A;  3E9P A;  2YHX A;  5AQW A;  3HSC A;  1HUX A;  4IJA A;  4RWT A;  3ENH A;  4FWP A;  4GV6 A;  4H5T A;  4OO1 J;  4JK9 A;  3I55 N;  4FWO A;  1IJJ A;  3FZM A;  2NRX A;  4JD2 A;  3FZH A;  2E88 A;  3MN5 A;  4BRD A;  1Q7Y O;  3C0B A;  3BP8 A;  2HBM A;  2F9W A;  1P90 A;  2QW9 A;  1MWK A;  3O9S A;  3A0I X;  3O08 A;  5JMV A;  3DLL L;  2D1K A;  1WOQ A;  1NGF A;  3VTH A;  3IMX A;  3WQU A;  1XQS C;  2NNW A;  2CH5 A;  3CCM N;  3L4I A;  4RCH A;  4CBW A;  3FFK B;  1BO5 O;  3K9K A;  3NVK A;  3E9L A;  4H5V A;  5KPZ A;  2WFB A;  3VEX A;  3K9J A;  1G99 A;  2W41 A;  4FWK A;  3I33 A;  3MCP A;  1RFQ A;  4FOI A;  4PKH A;  3ZEU A;  5FPD A;  2AP1 A;  5BR9 A;  3CPE A;  3QFU A;  2ZJR L;  3GE1 A;  3LM2 A;  5GIN A;  3M3Z A;  4HWI A;  3FZF A;  3HOT A;  2QEX N;  3GBT A;  5GAH P;  2P9P B;  1OVY A;  4CZG A;  5DM6 L;  1JJ2 M;  3VEN A;  3ENO A;  1HKG A;  1HKC A;  3VGM A;  3D2F B;  3CCQ N;  2I7N A;  3C7N B;  4H0O A;  3U9Z A;  1OKJ A;  2QM1 A;  3ATU A;  1DKG D;  1GLD G;  3CQY A;  1NGI A;  2HF3 A;  5F0X A;  3QFP A;  4NO7 A;  1QVF M;  4KH6 A;  1MA9 B;  5AR0 A;  5C2F A;  4B9Q A;  1BOT O;  5JLH A;  3EKU A;  3P31 A;  2A6A A;  1J6Z A;  4H0Y B;  3I8B A;  4ISG A;  4O8K A;  3TSU A;  4BGB A;  3QB0 A;  4BR0 A;  5H1S Q;  5F1X A;  1D4X A;  4CJ7 A;  4JKA A;  1VAZ A;  1DGK N;  3MK6 A;  4BC5 A;  4BRH A;  5CHI A;  3L4Q A;  4BR7 A;  4BR9 A;  3Q7C A;  1Z05 A;  4BRG A;  3LDQ A;  1NGE A;  2PBD A;  3MX2 A;  3EL2 A;  4JKG B;  5AQN A;  3CCS N;  3D7E O;  1HX1 A;  1S22 A;  3WEE B;  1YI2 N;  5AQM A;  3T69 A;  3WXL A;  4H5R A;  3TSQ A;  4CZH A;  4EIA A;  2D0P A;  3O8M A;  2P9I A;  2QWN A;  2GX9 A;  4DB3 A;  5AQY A;  2Q97 A;  3W0L A;  3O5B A;  3TSP A;  4FSV A;  4B1Z A;  4I6M A;  4CZK A;  4EHU A;  1SQK A;  1NGB A;  2E1Y A;  2E2O A;  3DXK B;  1T6C A;  3O4W A;  3UE5 A;  1YHQ N;  1HJO A;  1U2V A;  2QWR A;  3WXK A;  4BRL A;  5C15 A;  4F9O A;  3HI0 A;  3R3L A;  1GLL O;  3CF5 L;  3CIP A;  3F2K A;  1YIT N;  3A5L C;  3CQX A;  3KWG A;  2D4W A;  4M7X A;  4O5F A;  2P9K A;  3PIO L;  2CH6 A;  4AM6 A;  3Q7B A;  4JK8 A;  3TTF A;  3QML A;  5GIO A;  3CC7 N;  1RDU A;  3SJH A;  3ZET B;  2FF3 B;  5BRH A;  3G6E N;  3OBW A;  3AY9 A;  1NGC A;  1X3M A;  2NRZ A;  5AQV A;  4A5B A;  5C0Y A;  2A42 A;  1X3N A;  5AQS A;  2IVP A;  3ULE A;  3EN9 A;  2P9S A;  1ATN A;  1X9J A;  2P9K B;  4H0T B;  1KD1 O;  3ZX2 A;  3LDP A;  2P9U A;  4JKE A;  3MMV A;  4WQ4 A;  3CI5 A;  3VEW A;  1GLA G;  4IZ9 A;  3CCL N;  1NGD A;  4BR4 A;  2E1Z A;  4NB4 A;  2QWP A;  4RTF D;  4FWQ A;  4ILH A;  2KLA A;  3ID8 A;  4CD1 A;  4CZI A;  2A40 A;  2V7Z A;  3ZYY X;  3CJA A;  3FZL A;  3VF2 A;  5C12 A;  4WCE L;  4FPB A;  1CZA N;  5BPM A;  1P8Z A;  2YHW A;  4BRF A;  4HTL A;  2AA4 A;  1YIJ N;  2ASO A;  2OAN A;  2YJF A;  1YJN N;  1E4G T;  3P4I A;  3TTD A;  4IOX A;  4XH1 A;  4WFB L;  2E8A A;  3UB5 A;  2KHO A;  1ZBS A;  2J4R A;  1C0F A;  3DXM A;  1DT9 A;  3OA9 A;  1QQN A;  4GNI A;  4MO4 A;  3C6A A;  1YAG A;  2UYT A;  3VET A;  1BWF O;  4A62 A;  2BH1 A;  1KAX A;  1HLU A;  1EO1 A;  3AGR A;  2NLX A;  4E1J A;  1C0G A;  4PKG A;  4GV9 A;  3DXM B;  1GLC G;  2ZJP L;  4BC4 A;  3H46 O;  4DCH A;  4JEP A;  1V4S A;  4A2B A;  1BDG A;  1WUA A;  4B1W B;  3LDO A;  2GWK A;  2VCP A;  5AQT A;  3JXU A;  1NGA A;  2GEL A;  2JWL A;  4O8U A;  5BPL A;  3SAF A;  3WXJ A;  1SZ2 A;  3T7Z A;  1Z6R A;  2YHY A;  2P9P A;  2Q36 A;  3ZX3 A;  1NBW A;  1YUW A;  3QDK A;  4JKH A;  3MWP A;  5GAG P;  3R6M A;  3D2F A;  5CR4 A;  5HL7 L;  1VQ8 N;  2PAV A;  3C7N A;  1NGH A;  3A5M C;  3QBX A;  4WFN L;  3AAP A;  3H3O B;  3CMA N;  3SAH A;  5EOY A;  4PKI A;  2HOE A;  2GEM A;  3H3N O;  5AQP A;  1H1V A;  1KAY A;  2WBN A;  5CE3 A;  3G4S N;  4YDU A;  3GL1 A;  2ZWH A;  2GWJ A;  1DEJ A;  2WUS A;  4BG8 A;  4JHD A;  5AQX A;  5M1O A;  3BEX A;  5FPM A;  4FL9 A;  4EAH D;  4WYB A;  4B1V A;  1KAZ A;  3VEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...