2GXAA

Crystal structure of papillomavirus e1 hexameric helicase with ssdna and mgadp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
270
structure length
270
Chain Sequence
b'TEKFDFGTMVQWAYDHKYAEESKIAYEYALAAGSDSNARAFLATNSQAKHVKDCATMVRHYLRAETQALSMPAYIKARCKLATGEGSWKSILTFFNYQNIELITFINALKLWLKGIPKKNCLAFIGPPNTGKSMLCNSLIHFLGGSVLSFANHKSHFWLASLADTRAALVDDATHACWRYFDTYLRNALDGYPVSIDRKHKAAVQIKAPPLLVTSNIDVQAEDRYLYLHSRVQTFRFEQPCTDESGEQPFNITDADWKSFFVRLWGRLDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*T)-3'
publication title Mechanism of DNA translocation in a replicative hexameric helicase.
pubmed doi rcsb
source organism Bovine papillomavirus type 1
molecule tags Replication/dna
total genus 83
structure length 270
sequence length 270
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Zinc finger, large T-antigen D1 domain 2gxaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gxaA02
3KJGA 2BEKA 1WBDA 1JR6A 2CJWB 1TF5A 5UKDA 1Z83A 1T0JB 3FFBA 1KAOA 1OFIA 3TW8B 2G1JA 2J0UB 4Q4HA 3LQQA 4LHVA 4KXFB 3UMFA 4BECA 1XMVA 3IPXA 4ZDIA 3GJ4A 3T35A 3IGFA 4F93B 3FMIA 4HDCA 1XBTA 2OFXA 3BS4A 3WNDA 4Q1EA 2NPIA 2YWEA 3SJCA 3U6BA 3KKNA 4Q19A 2HT6A 3QPVA 3EZ7A 1GILA 1XZQA 4XVQA 2CXXA 2AK2A 5AJVB 1W46A 5KDOA 2DB3A 1QBKC 4L9SA 4GPTA 1EFRA 3NC1C 3NVAA 2WHXA 4YONB 4NYJR 4DUGA 3X2SA 4OK3A 1CR2A 5FUXA 2HF8A 3ZJYA 4DLZA 2EW1A 1W36C 2OBLA 1XEWY 4P4SA 4TN1A 3I61A 1UKYA 1XD8A 1N6PA 2P5SA 4BFTA 1UAAA 1W7AA 4PHTA 1F60A 4CYMA 4FWTA 4NU0A 2ZI3A 5TMPA 5BN5A 3OFND 1Z29A 4KV9A 3ZQJA 1NLZA 4LJ9A 3P27A 1GNQA 3CWQA 2R2AA 1KYIA 2A3RA 3IBYA 1S1MA 3L0SA 3AP2A 1XRJA 5CK5A 5DO9A 3V4FA 2QAGB 2CLCX 1XP8A 5HCIA 2CVFA 1ANKA 2QT1A 3ZZUA 3VX4A 4D2IA 1E2QA 3BRWD 5KO2A 1N0UA 4ZCMA 1TQ6A 4IVQA 2WSSA 1EFHA 2AXNA 1DVRA 1RYFA 2KSQA 4JSYA 3RYTC 4BZPA 3J81k 1KI1A 1Z47A 3OHMA 4JLKA 4N0DA 1KI6A 5L3QA 4G01B 1N5KA 1YU9A 4R9UC 2W6JA 4AY2A 3CF2A 4A9AA 1E2JA 2ANCA 3BB1A 3K09A 3TNFA 1JQLB 4GBMA 4NE2A 3L8ZA 3QF4A 5JECA 3ASZA 1JQJC 3ECCA 2FMXA 3UANA 4Q9LA 1RRFA 1KSFX 1RW4A 5EUMA 1RVDA 1E2FA 1I2DA 1RJ9B 3Q7PA 1SVMA 1W4CA 5EXPA 2GF0A 5CM9C 1Z0IA 1ZNYA 1QHYA 3ZVLA 1C1YA 4NYMQ 2IYSA 1ZU5A 4PPQA 5AJWA 5C4MA 4K46A 2RGDA 3RWOA 3ZIAD 1OB2A 1KO8A 3H4MA 4MDFA 4RFVA 4AIIA 1H8ED 3O8BA 2XNDD 2W58A 2X8AA 3OEHD 1XMIA 3ADCA 1K6MA 1J7KA 1KSJA 1XXHA 5DYIA 1FOEB 3CRVA 5P21A 3RRMA 3A36A 5GVRA 4MKGA 4PAOA 3KXIA 2GXQA 1J99A 5EXTA 5DSZA 4IW3B 1WBBA 1IM2A 3CBQA 4XH9B 1KSHA 2AL7A 4B76A 1QHIA 2QMOA 5FR2A 4B75A 4JLJA 4YDHB 4D82A 4F38A 2VHJA 1DPFA 1TTTA 4DC9A 4ESVA 2GJAA 1UBGA 1BO6A 2BIFA 4Q1CA 4GNKA 3EA0A 2C04A 1U90A 1KJZA 3KB1A 1E2NA 1Q1ZA 3NHBA 2MSCB 3EG5A 2F7SA 2KWIA 4A8JB 1F2TB 3F0TA 3DPUA 5CK4A 4ACBA 2JDID 2O8EA 4TLEA 2ZRNA 4TL8A 2G9NA 4AC9A 4CEIB 4ARZA 4GOKA 3K70C 5LB4A 2DWOA 2E9SA 3MRSA 2YOFA 2YWGA 1FTSA 5L3SA 3DL0A 4QHSA 4A1FA 3A4MA 4MGZR 4Z8YA 3I92A 2QM7A 2FH5B 3K9HA 1O87A 2CBZA 2ZSAA 3QI2A 4KBFA 2EU8A 5F98A 2FSGA 2IHBA 3D7MA 3TSOA 2AKYA 2FA9A 2ZI4A 4A36A 4LSGA 5TXGA 1LB1B 3MWYW 3SHFA 2QG6A 3I5YA 1OSNA 1E9AA 1DADA 1DO0A 1OW3B 1U0HC 3CR8A 2SHKA 2BCGY 2F1IA 3B1ZA 4PR0A 2A5DA 1QZXA 2QORA 3IILA 3OIUA 4N0EA 4X8HA 2FZLA 2IL1A 4U5XA 2C9OA 3GLIA 4PPGA 2ZRAA 4PQFA 1E9EA 1L4YA 4Q5IA 3TUZC 2IXGA 3BXZA 3W3AA 2LCFA 1NVUQ 2ODNA 4Q4AA 3S1AB 4MH0R 2XGJA 3ZGXA 4M1WA 4C7OA 4WBSA 1XTQA 4G3XA 4LBWA 1G8FA 4PXAA 2ZS7A 4RZXA 4B48A 1KO1A 4MKFA 1UJ2A 4KYUA 4IJMA 3U3KA 3KKOA 1OJLA 4URVR 3SZRA 4URYR 1G3MA 5EP3A 2WWYA 1Z8FA 2HV8A 2ZAOA 3I1FA 3EW9A 1NLFA 4LV6A 3SYKA 1RC8A 4OHWA 2QE7A 1E2MA 1XCGB 2GNOA 2IUTA 2XB4A 1XJCA 1II8A 5BW8A 1W0JA 3QVUA 3L8YA 3U44B 4EQ6B 3AVWA 2C78A 1Z6AA 3THOA 1PUJA 3FTQA 5IK2A 3GJ7A 4Q48A 4EAQA 4C0BA 4EFLA 4QGGA 1XXHE 1Z3IX 2MMGA 3K0FB 4XWOA 3WXMA 2FFHA 3GLGB 1E9BA 1JJVA 4DSTA 4DZZA 4JJKA 4DWJA 5A5GA 4GT1A 3IQXA 1HY3A 1E1RD 5HCNA 4DT1A 2FU5C 3D8BA 5LD2B 1DAFA 1XEFA 4FMBB 4I1SA 4UNNA 4B32A 1XD9A 1D9ZA 2QRNA 3LX5A 3LY5A 3WYGA 3SDZA 4D4JA 2XTMA 4OI4A 1XFAA 1CR1A 1N5IA 2V8OA 2D2FA 2PCLA 1KK2A 5FTNA 5HE9A 4B6EA 1NJGA 3C8UA 4TMTA 1E9DA 3U6KA 1WE2A 4OL0A 3QEJA 5DHFA 4ZCIA 4IFBA 2KB0A 3T61A 1XMJA 5BYKA 5DLQC 1LF0A 4FMCB 1OH5A 1E1QD 4ZPXA 4BWYA 2J9RA 1XTRA 2A5GA 1T3SA 4M8NE 3WYAA 4DCSA 5EQTA 5JMTA 2WAXA 4OHYA 4URXR 5JSZB 4MYTA 4LI0A 5JWHA 4CRWB 1LW7A 2OXRA 3NBFA 4JL8A 4IOKA 3U3RA 3GFOA 4MUBA 1DAHA 4YMSA 4CEHB 3CH5A 4EJSA 3ZVRA 1FP7A 1KO4A 4JT4A 3U4QA 3NEJA 2ZSDA 3QXCA 3OZXA 4AG5A 1HYQA 4ZDJA 1G8PA 1KJYA 1SKYB 4NCNA 3DZ8A 3VHLB 4JLPA 3VR6A 3ZZ0A 2WMNB 5AUOB 3FHTA 1YQTA 1U8YA 1CU1A 1UDXA 4QG7A 4TLAA 2QNRA 1CRQA 1YVDA 4CT5A 3QG1A 4EIWA 2ATVA 1YHNA 1NN1A 4OHZA 2XJ9A 2QBYB 4JKYA 4EPXA 4GMDA 3WBKA 1U81A 4QM7A 4KLNA 1N2CE 1VG9B 5HZHA 2N1BA 2CHQA 3QIAA 2ZU0C 1QHHA 1N6NA 1XCPA 4A2QA 3FHCB 3RS2A 4BFUA 1BYUA 2ZE8A 3MUFA 1CJTC 2Q9AA 3GLFA 3PVSA 3FGNA 1YE8A 5CYOA 3B9QA 4A0GA 2FEOA 4BGDA 2D62A 4IDOA 1UF9A 1Z0JA 1E2GA 2X1VA 1B0UA 5J4LA 3K1JA 4MGIR 2NTYC 4MA4A 4C0HA 3SC3A 4PFSA 1PUIA 2R65A 2XSZD 3ASYA 2RGXA 1TL7C 1W0KA 4HUQB 1KIMA 1E9SA 2NO0A 2ZREA 2BMEA 3QUSA 4QBHA 4I1VA 3K09C 1NVVQ 4XWAA 4D26A 1E9FA 3Q3JB 3CX8A 3M0EA 2ZI9A 4DSOA 4TQAA 4V0NA 4I1UA 1FUUA 1M74A 2VHQA 2ZU6A 1E79A 4Z54A 4KLZA 5JRJA 2JLUA 2FX3A 5C46F 3KQUA 2QZ4A 4RZ2A 3PITA 1GKIA 4A6XA 2ZJAA 4AI6A 4HDQB 1X86B 4OK6A 1CF4A 4LX0A 4PQRA 3AVXA 3KKMA 2ASEA 4YMUA 1NSTA 2OCPA 5DN6D 2OAQ1 3LBNA 4DBLC 2IYUA 4G5QA 1XTKA 3OF5A 4EDHA 1MO6A 2GA8A 5DE3A 1GDDA 3WYFA 2JAQA 3REFA 2QMUA 4II7A 1NJFA 4B3FX 5TY0A 2GCNA 3RWMB 2K5UA 2CMKA 2D3WA 1KDRA 5FPTA 1XTSA 3VU9B 1L7VC 1JR3A 2GBLA 2J45A 3AB3A 2Z6VA 1BS1A 4MGKR 1PLLA 5EXXA 4ACAA 4A0RA 2OG2A 5HKKD 3ADDA 4ZI2A 1OB5A 1QHSA 2VP9A 1NNEA 3I3SR 1XMSA 2PBRA 2VP5A 4IVRA 4WIAA 3P20A 3BH7A 4D4LA 3EZ9A 1JXMA 1M7BA 3IEVA 1LS6A 3OAAD 5AK0A 3QXXA 3U7GA 4IOJA 3SFVA 2XOKD 3P1JA 2GXAA 1BYIA 3IO5A 4TL6A 4ASUD 2ZRCA 2ZUCA 2RGCA 1W1WA 4FCWA 3BAFA 3WMGA 1COWA 2FGJA 2QY9A 2ZRGA 4QXAA 3CLVA 4JT2A 1JAIA 4QM6A 3W34A 1BMFA 5EP1A 3T5DA 4KJZA 4B6FA 3UG6A 1I4TD 2XAUA 4OJKA 4D6PA 1V5WA 2J0SA 2XZLA 3SJBA 2V7QD 3HR7A 3ZDQA 3LXRA 4OQNA 3GLFE 1NIPA 3IEUA 2VHTA 4M22A 4F4JA 3QG5A 1AJEA 3UWOA 2VLIA 4TSFD 3VNUA 2Z4SA 5K8TA 1E0JA 1MO3A 3G0HA 2PMDA 1F48A 4Q1FA 4Q21A 5AJYA 3WNCA 3D6TB 2NGRA 3T1VA 3N5CA 1ZBDA 5JWRA 1M34E 3ND9A 2J7PD 2GILA 1D2EA 3H86A 2GAAA 3NH9A 4LV5B 4UKDA 4BFVA 4GZMA 2YVUA 3PUVA 5H1YA 1OE0A 3DKVA 3VKGA 2OCAA 5G3ZA 4GMXA 4DB2A 1X8KA 1G4AE 3KUCA 4MQBA 3FKSA 3V9PA 3AKCA 5H8WA 3U3JA 2G1KA 2B7CA 3OIYA 4B3CA 2BJVA 4NMMA 4JLDA 5D3MA 2IYWA 1DAIA 4DIEA 1SXJB 4O25A 2D06A 4HZIA 5HE8A 3PFIA 1ZNWA 3HP1A 1E4YA 4QNMA 2JGNA 4YLGA 5KYKA 5B57C 1ZM4A 1D6JA 4RD1A 5KU1A 1G64A 1KI8A 2G0TA 8OHMA 1U8ZA 3W8NA 4TWZA 1FZQA 4D0NA 3HU2A 3HU3A 4B2IA 4LJ4A 2Q3MA 2GHIA 3GPLA 1YR9A 1TUEA 5CJPA 1TMKA 3PQCA 2GAOA 3KQKA 2BMDA 3SOPA 2JLSA 2PX3A 2BMFA 4XD7D 2OILA 2GEUA 2OFOA 2X2FA 4YXWA 5FH9A 1RIFA 2QL6A 4WXRA 3RS5A 1EESA 1UEIA 4PZZA 3UG7A 2V1UA 6Q21A 3ZD7A 1HH4A 4PSKA 2WIBA 2DFTA 1N5LA 1Q3HA 2ZS8A 2YZ2A 1S2MA 1E0KA 5G40A 1GM5A 2EFEB 1WA5A 3R9IA 1P2UA 5AUPB 2OFWA 4FINA 3B78A 5GJVC 2DWPA 1UKVY 4Y0AA 3NIBA 4BFYA 3QJYA 4KCGA 1IXRC 2O0HA 4E22A 3CR7A 4HYYA 4Q7MB 1SQ5A 4WVFA 1Z6XA 2OSBA 2CDNA 4BEBA 5F3WB 2IYYA 5JZVA 1OH7A 2ZQ5A 3QNUA 4M1OA 1NIJA 3QKTA 4EKDA 2DHRA 1AZSC 1IY0A 1NMXA 2DR3A 3PJRA 2O8DA 2R44A 2N46A 2OEPA 1KMHB 2ERYA 1XTIA 3AF1A 1VCMA 3NWJA 4Q4JA 4N1AA 4M1MA 2GK7A 1SHZA 2C2HA 4UNRA 1FX0A 4NKRA 1X1RA 3LNCA 2CCGA 1NY6A 1W36B 4LC1A 3KKPA 1GL7A 3RS0A 4QGAA 2ZRIA 3NBYC 1Q44A 2Z0MA 2ODEA 3A4LA 5HTKA 1ZCBA 1P62B 2FPMA 3B1WA 4EJSC 4ZI3A 1Q20A 4TYWA 4D0LB 1NKTA 1Z5ZA 1A2BA 1R10A 1R0ZA 3THYB 1KMQA 1Z2CA 4NP6A 1OFTA 4QGFA 2O8BA 1UM8A 1CJUC 3DEFA 5JJIA 2GCPA 3KQLA 4JLMA 4C2TA 3AVUA 1LFDB 4RJLA 5FL7A 1PV4A 1VIAA 3EZ2A 3I73A 2WJHA 4EPTA 2J5XA 2J7KA 1KOFA 3C4JA 1Z06A 4GFDA 1JI0A 4IEEA 4Z1MD 3NTUA 5DHAA 3MWKA 3B1XA 3QY0A 1BH2A 4ZIRA 2RGAA 2HJGA 1T9HA 1ZM3A 3T06B 2HF9A 2VSFA 3DHWC 2F6RA 2JIZA 3BD9A 3QKRB 4IVPA 2NZ8A 1HE1C 4MRSA 2BMJA 3KKQA 2P2LA 1T91A 2EWVA 1AS3A 3RDPA 3AKEA 3IIMA 3W5IA 3RRYA 1D9XA 1R5NA 3PV0A 5CLQA 1TX4B 1WP9A 4AKGA 4TQUS 2JLWA 4N3NA 1HURA 3M1IA 4OI2A 4Q7LA 1H8HD 5JFGA 3MWLA 5D3QA 4DSUA 2OV2A 5HPYB 5JRZA 2XZOA 4M53A 1G18A 4TT3A 5L3VA 1LVGA 1UBFA 3N70A 3TSZA 1A2KC 2D7DA 1W2HA 1MKYA 3Q72A 1Z63A 3LD9A 1QHNA 1KTVA 2JCSA 2VIIA 3AGQA 4B3XA 1LV7A 2J59A 1X8JA 4PAMA 1JEEA 2RGNA 3CX6A 3EIHA 3THXA 2AFHE 4C4PA 4RFSB 2WKQA 1NG9A 5CYPA 5DIFA 1KJWA 1GFIA 1ZIOA 4DCTA 5CB8A 2WM9B 4QFMA 1FFHA 4S35A 1GP2A 1XTJA 2H17A 2C98A 1R5OA 2GZDA 3F3YA 4L9WA 1AK2A 2D2EA 2EYQA 3G5UA 4DIDA 4DXAA 1Q22A 1E32A 1GSIA 4PPFA 3BORA 2A5JA 1G8YA 3CIOA 2CE2X 4S2EA 4B3DA 3LW7A 1E4VA 1UDWA 4CEJB 3GLHA 1VYVA 2Q3FA 4M9XA 4TTQA 3VR1A 4A2WA 4LHXA 1KI2A 5FPSA 2GBLC 3SJAA 1ZUIA 4P32A 3BERA 1OHHD 4MKIA 5FL3A 3IHWA 4XJXA 4V0KA 5EE1A 2NPFA 3K70B 4AURA 2V6JA 5HR5A 4CGZA 4PC1A 1KKMA 2UZIR 1T3LA 2DFLA 3IO3A 3BJIC 2QAJA 4XOIA 2L0XA 4RSGA 1G21E 1XEXB 1ONBA 3GCGA 2AD1A 3TAHA 3QE0A 1GAJA 4DEYA 4BZQA 1CXZA 3W90A 2JLZA 1E2KA 1XJQA 4HZUB 2O8CB 1J8MF 3FB4A 5TB5A 2XXAB 1G3QA 2OXCA 4LWZA 3JZAA 3TE6A 1P72A 2IYTA 3C16C 1NN0A 1VPLA 4JLNA 4RZ3A 1QRAA 1KI7A 1NKSA 2GVZC 3NHAA 5DI3B 1I4DD 1U99A 1U2RA 1YJ5A 2AK3A 1ZP6A 2ZJ2A 2J3EA 2DCUA 3QXSA 4HLCA 1CR4A 4FN5A 4U02A 4BQSA 1VIYA 4R7ZA 4LPKA 2YINC 1RRPA 2WJVA 2REOA 4QBIA 5EZ6B 3S1AA 3TQFA 1WF3A 5IHPA 1SZPA 1IN7A 2P6UA 2CNWA 3IKJA 2NIPA 1DBSA 1KHTA 5KSOA 1VECA 2Q9BA 1KZGB 3WMEA 3C5CA 2ZYTX 1TQDA 4XVRA 3CWZA 2RGBA 1F2UA 1S96A 4TLDA 1QG4A 1GOTA 4JVNA 4BUJA 2BOVA 4TMWA 3D3QA 4HSEA 4RCYA 3TKLA 1F3OA 3V4RA 2Y8EA 3LQRA 3TSWA 3H84A 1L2TA 3TQCA 2GJSA 1MABB 3WNBA 1NF3A 1DAMA 1OIXA 2ZPTX 3ZZTA 4TZ0A 1M1YE 2J46A 3PUYA 4X8OA 4A6PA 5DNYB 1Z0AA 2QRZA 4JBYA 3QF7A 2HEIA 1FW6A 1AGRA 3FHOA 3IDQA 4BLRA 4QRHA 3VNVA 4PTLA 4MYHA 4W7SA 3K0AB 4QOSA 1N6OA 2IYZA 2Q0HA 3MAAC 3EAQA 4IOMA 3LH5A 4Z51A 1JNYA 1AM4D 1Y3AA 3EPJA 2HYIC 1SVIA 2N42A 2C9YA 5JI2E 3K8YA 4KO8A 5GVSA 1Z22A 3EASA 1EFTA 4W5JA 1GL9B 5E4FA 5BWMA 3THWA 1P2SA 4OHVA 3P4XA 4TL7A 3TUJC 5BN4A 1R5BA 1G20E 5KPJA 4OBEA 3OE7D 3GLHE 3W5JA 2IS2A 2QM8A 4M9QA 1W49A 1AIPA 1CULC 2IEZA 2ZI5A 4HATA 4US2R 4F91B 2JLVA 1D2NA 2AX4A 3DOFA 4JLVA 2ODWA 2OLJA 4KFRA 4Q4HB 3H0KA 1LY1A 2W6ID 3B13B 4U00A 4Z8XA 2EWWA 3O8CA 1NMYA 2BBOA 3BOSA 1MRSA 2ZANA 1R6BX 1AZTA 5JHHB 4O0MA 2BM0A 1Z2AA 3G82C 1ZAKA 2XTNA 1GNRA 1M6NA 1JJ7A 3OFNA 1GZSA 3LBHA 3BBPA 3AVQA 4P4TA 2O0KA 5GJBA 3N2IA 1KK1A 3RC8A 2ZR0A 2ZS9A 4NCKA 5JEEA 2VL7A 1TEXA 3LX8A 2FZ4A 4P4SB 4ZDKA 1G16A 4KITB 2C5LA 4B35A 3QXHA 4ZV4A 2IWRA 2YHSA 5CJ2A 4DSNA 4M1YA 1FQJA 2CLDX 1L8QA 3IBGA 5KSPA 4LV8B 4NBSA 2RHDA 5KNCA 1NN5A 1ZCAA 3W9YA 5CM8B 4BEJA 4NZYA 3ADKA 3FE2A 1G9XA 5SZJA 4AKIA 1JBKA 4M21A 3NBXX 3HU1A 1VCIA 2WPDD 3UXMA 2WICA 2VP4A 2ONKA 1KGDA 4C0AC 1TF2A 5C18A 5EUQB 1X1SA 3VX3A 3BFKA 4POAA 4G5OA 2PZGA 1YZTA 5SZHB 1KY3A 3K0EA 1NN3A 2OO7A 3BIFA 3SE0A 1SXJD 4BFXA 1EXMA 5B64A 1KI6B 3DOEA 5L3QB 5M04A 4F4IA 3Q9LA 4A92A 4JL5A 2QU8A 1JAHA 4H9GA 2WOJA 2ZVPX 4FMDF 4EPWA 4C0JA 4HI0E 1HT1E 4NYIR 3NEYA 3QF4B 4NPHA 5KOYA 1UKEA 2XEXA 4KBGA 3C14C 4OQMA 3ZIAA 2ZI7A 2ONJA 4ZO4A 4M1KA 3L43A 3ZVMA 2V6IA 2BKUA 2R8RA 2F55A 1H8EA 1IHUA 1Q57A 1XPRA 3Q5DA 3CH4B 4L5BA 2XNDA 3AVOA 4FMDB 1YZGA 2VP6A 2P3SA 3OEHA 1IJFA 2EQBA 3BGWA 3Q5EA 3AF3A 4IXNA 4EPVA 3VFDA 1SVOA 1WCV1 4DJTA 4M0LA 5FR1A 4B43A 1D2MA 3KTAA 4FMCF 1GWNA 3DVLA 5JCPA 3T5GA 3X1DA 2JA1A 3PEVA 2PH1A 1VCOA 2F43A 2GESA 3H2YA 2XJ4A 4PC3A 3ZS8A 2LKDA 5FOXA 2G88A 2JASA 2FJUA 1E6CA 3GD7A 5FBLB 5J47A 3R20A 2RGNC 1QDEA 2IHYA 4PO1A 2ZRMA 1ZNZA 1TU4A 1EX7A 1XXHB 3KUDA 3ONWA 1P4SA 4PHHA 4LJ5A 4GP6A 1IY2A 4UJ3A 1SVWA 4KSBA 2JDIA 4LRWA 1R4AA 3MJRA 5FTKA 1A1VA 3EPLA 1IQPA 3U2QA 1CS4C 2C99A 2R6CA 4A2PA 1F5NA 4CVNA 4DDWA 2HLDD 3U7HB 3IIJA 3CUEF 2NZJA 5LPNA 1W36D 2PEYA 4XSGA 2QEQA 2F1RA 1E2EA 2GZHA 4PHGA 2QTFA 2ZJ8A 1AA9A 4IDQA 4LYAA 3RS3A 2XB2A 3A8TA 4GP7A 1KDPA 3W3ZB 2O8EB 1TQ2A 5KSZA 4R71A 3I5XA 4ARZB 2KE5A 4LY6A 3EPHA 3EIQA 1US8A 1VKJA 4FD2A 1Q3TA 5L3SB 4RD0A 3OEED 3LDAA 5CB6A 1N3BA 1Q1QA 4PSVA 1DE0A 5JEDA 5G3YA 3W8RA 3D31A 1KI4A 4MRVA 2WWWA 1G19A 2IYQA 4V0OA 1K8RA 3AF0A 1C9KA 2GXSA 4JS0A 3UIEA 1Z07A 2B8WA 4LPSA 5EE9A 4YMTA 2O8FB 4A0HA 4EFNA 1J2JA 5JS7A 5SZIA 5GJWC 3GJ3A 2WKRA 1E2DA 3ND8A 2I1VB 2VHCA 4I99A 3W6PA 3C7KA 2ZM5A 1FUKA 2RH5A 3B1YA 1GKUB 4PZYA 4PQYA 1OXXK 1NBMD 3R9XA 1CEEA 4LUCA 4R98A 3GLIB 5DISB 1FQKA 4LHZA 1F6BA 3IQWA 1M2OB 3R8CA 4BFWA 4Q4AB 5KPDA 3GEEA 4C7OB 1N25A 2B21A 2EVWX 5IT5A 1MO4A 4HLUA 1RZ3A 2GJ8A 1OIWA 1CIPA 4HB3A 3Q85A 4DLXA 3PUZA 1HT2E 5J4YA 3AF2A 1E9RA 5TDHA 4HB4A 4TL9A 4QHYA 3AVYA 1N0WA 1E1RA 3BFVA 3TAUA 1GVNB 1YZKA 1CR0A 4DHEA 1S4QA 2FEMA 1OLOA 2Q6TA 4O3MA 1II8B 5A4JA 2JJ1D 2W0MA 4AK9A 1NL3A 2DWQA 1KDTA 2A30A 4JMPA 1XPUA 4DLTA 4RKFA 4C3ZA 1OPXA 3QENA 1WDTA 5E7IA 1R8SA 1Z6YA 1R0WA 5DH9A 3X1ZA 4JZKA 2P67A 4QKQA 4R2IA 1OV4A 4DT1B 1NP6A 5CDFA 1E1QA 4JYCA 4NDZA 1P7CA 2DY1A 4KI0A 1KK3A 3ZQ6A 5FBRB 2FSIA 3PXGA 3FWYA 2ZVQX 3WHLA 1II9A 2IYLD 4BZXA 1U0JA 3CPEA 3ZVNA 4HAWA 4QBFA 5JJLA 4QJ4A 4LJYA 4HAVA 4BLPA 1ZU4A 4TLBA 4CIDA 5FPHA 3A4NA 3K70D 3LW8A 3K9NA 3EC2A 2R6AA 3C5HA 4PAQA 1YZQA 3L0PA 1EG7A 4OK5A 4W5HA 5AJXA 5E7JA 1GITA 3CB4A 4FI3C 1GTVA 3CZQA 4IKEA 4ZDWA 1NY5A 3SFZA 2XITA 3LAWA 1OKKD 3P32A 3K9GA 2P65A 2CE7A 4AKEA 5LDDC 2W83A 2EYUA 5JS8A 1SGWA 3DM5A 3UK6A 4HUTA 5B30A 1VCNA 4CT4B 2EFDB 3MG9A 5CIWA 4EJSB 3UKDA 3U4QB 5EE0A 4F92B 5FOWA 3UMSA 1QVAA 3WHKA 3WRXC 4LZZA 2YWHA 3OESA 1Y63A 1BOFA 3VKHA 1P61B 1AN0A 2CVHA 1XD2A 1II0A 3SBEA 3MSXA 2CEAA 3M6AA 4LJAA 2NO6A 5F9FA 4DRZA 3FKQA 3QKSA 4KVGA 2AWOA 3AEZA 3SR0A 2G83A 5FPYA 2GDJA 3SN6A 1OXVA 2XSZA 1QHHB 4JBXA 3CRRA 4CZ2A 1B23P 4XTCS 2JJ2D 1ZNXA 5F2EA 221PA 2QQ0A 4LK2A 1GRQA 1DELA 2FG5A 2ECKA 5KNDA 1S3GA 4A82A 1A4RA 3KZ1E 3A58B 3EWSA 1FNNA 4DDTA 2CK3D 3B1VA 3GLFB 1NRJB 4NCHA 4WZ6A 2ZXUA 4YMVA 1N6HA 1ZIPA 4JL6A 2IK8A 4J0QA 2QPTA 2H5EA 1QG2A 1IN4A 4JVMA 5AUNB 3RLFA 3E1SA 3ADBA 1O3YA 2GRJA 4FIDA 5GJCA 4E07A 2XTZA 2A5FA 2H57A 1M7HA 2ZJYA 4BLOA 5BXQC 4MYCA 3FYHA 3P26A 4HDOB 4PPNA 4LJ6A 3TVDA 1Z08A 2KBEA 2ORVA 3CNLA 2CJWA 5DN6A 5KDLA 1J8YF 4IFEA 4JBWA 2CCKA 4QHTA 4TLCA 2J0UA 2ZE5A 2WWXA 1W4RA 4RY2A 2X19A 4JJZA 5CDFE 1XZPA 4FW9A 4IEIA 3VR5A 4BLTA 3ICEA 2VQSA 3GJ5A 3CO5A 3WRYC 4C2UA 2PT7A 3PUWA 5BN3A 1XNJA 5FPKA 4HB0A 1DG3A 1YZNA 4NH0A 2VSOA 1PZNA 1KO5A 2PT5A 1XB2A 5HKKA 2NO1A 4ITRC 4G1UC 3IIKA 3K9LA 1VG1A 5AR1A 1R7RA 3M4YA 1MO5A 5TVKA 1IN6A 2CLSA 1KZ7B 3T34A 4EPYA 3OAAA 1GKYA 2P6NA 2CCJA 3E5HA 2XOKA 2OT3B 3KJHA 3UMRA 2NOAA 3JZMA 4DCUA 1NLYA 4ASUA 2JATA 4DKXA 2B7BA 2I3BA 4LC0A 1RPZA 1G41A 2R9VA 4AYWA 5JBQA 4ILEA 2GWHA 4HAZA 1JEDA 3AKDA 3UWKA 2HYDA 1EFRD 5KSYA 4Q7JB 4DUGD 2IT1A 2V7QA 3KXKA 4GSYA 1V43A 5C2JB 2FPKA 1G5RA 2QAGA 4JIMA 2FF7A 4B33A 2QSYA 4DDUA 4TSFA 3L0IB 2AHOA 4ZKDA 1E2PA 1W47A 3CX7A 2ZJZA 5TARA 1W5TA 4Q9KA 1DAKA 2QMEA 4H1UA 4JVLA 5KTYA 1A5TA 3ZH9B 2ZTSA 3Q8XB 2J7PA 1S8FA 2V1XA 3BB4A 1T5LA 1P2TA 3BFXA 4QNRA 4NONA 4LBVA 5FOTA 5FI1B 3T1TA 1S0UA 4TZ6A 1DARA 2P5TB 5BQ5A 2ZE6A 1HQYE 4JYBA 5FFMA 2CL6X 3B8HA 3CPHA 3ZS9A 3AM1A 1XX6A 3KX2A 3B2EA 2C95A 2WSSD 3OIWA 2E1RA 2R6FA 2X77A 3KJIA 3AVPA 3KXLA 4JSTA 1KDOA 1RJ9A 1DTSA 1E0SA 2VEDA 1WXQA 1YKSA 4IDPA 5CIQA 2W6JD 1BKDR 5TV2A 2JLQA 2I4IA 1OIVA 2FPLA 2J0VA 1RRCA 4UNSA 5DGXA 4MRRA 1K5DA 1EFUA 2BM1A 2PZEA 2IX3A 4B3GA 4LHYA 4Q9IA 3B85A 4JKIA 4D4MA 2H18A 3FMFA 3MGCA 1ZJ6A 2GJKA 2GXUA 4GI7A 5D3MB 1J90A 2C96A 5ELXA 1SKQA 1OT3A 4HAUA 3VQTA 2PX0A 1DOAA 3SEAA 3LA6A 2OUKA 4B73A 3LV8A 4EFMA 2B6HA 4XD7A 3HDTA 2FWRA 2PLFA 4MRPA 4XIGS 1L4UA 4HLUC 4HAXA 2WJIA 3QBTA 3WP0A 2ORWA 3CNNA 3FFAA 3WBJA 2MMCA 4KFTA 1LTQA 3OIVA 1FMJA 4BFZA 1CRPA 3TJZA 5J4VA 3CNOA 2GZAA 1NSFA 4G5GA 2IF2A 2GCOB 4Q01A 4B2LA 5J40A 1NG1A 4G0NA 3VAAA 3LFUA 5F9HA 4XWKA 2OBMA 3VMFA 2B8TA 3GQBA 2ATXA 2ZSBA 3NG1A 4L4UA 3PG5A 3W6NA 1CP2A 2FE4A 4IXMA 3EC1A 4B3BA 1IBRA 3QEOA 4NCJA 4IRUB 2IEYA 1RE0A 1IY1A 1F2TA 2GF9A 3AKYA 521PA 5FI0B 4A8JA 4BE7B 4BRWA 3ZD6A 4C9BA 4X8LA 1GUAA 1TAGA 3REGA 2YWFA 2ZSFA 2WBLC 3R7WB 4CEIA 1HTWA 1OFUX 4OQFA 2FDCA 3DKPA 2H7VA 4DLWA 2RHMA 2JEOA 2C8VA 1ZC3A 2GTPA 2ZYWX 1G3IA 4BFSA 4D81A 1G7RA 4KSCA 3F5FA 2H8KA 4RZUA 4B74A 1TF7A 1GL6A 1CJVC 1AS2A 3SHWA 5FBQB 1DEKA 4UJ5A 1CBUA 2FFQA 1IONA 5FUWA 4OI0A 1N5JA 2WWIA 2XZPA 4L16A 4NYJQ 1TQ4A 3U7EB 3VHXA 2O8DB 3U5ZB 4OKSA 3MMPA 3Q7QA 3U3OA 1ZMXA 4DEXA 4OQLA 4Q4JB 3CPJB 3A1TA 3IHLA 1P2VA 1FX0B 3PUXA 3RRNA 3HYTA 1NMZA 2IXEA 4US1R 3RNLA 2G3YA 2WZQA 1GRNA 1OXUA 2CHGA 1E3MA 4RKEA 2QROA 3DM9B 5G53C 4JLAA 2OM2A 3TMKA 1GNPA 2DBYA 3EPKA 1SVLA 4LOAA 1G8HA 4Z1MA 4KFUA 4V0LA 3N2EA 5G41A 4DLVA 1CJMA 2O8BB 2EFCB 4YC7A 4Q1AA 5SZKB 1A82A 1FNMA 4PO8A 2AR7A 1KK0A 1Q12A 2WWHA 3A1WA 2HCBA 4Q47A 4B34A 2Z43A 3UPUA 2QGNA 1ZW6A 4DCNA 4MKHA 1QVRA 3HR8A 1E2HA 1UBEA 1W4AA 5GADl 1JPNA 1W4BA 4RCZA 2I1QA 3U44A 4NYMR 4PZLA 3R9WA 4EQ6A 2BVNA 1A7JA 3SYLA 3MJHA 2AFIE 1G291 1ESNA 2ZE7A 3A1UA 4Q66C 3NXSA 4E03A 1IXSB 4PSAA 3DO6A 1H8HA 3RHFA 2QP4A 4ZIRB 5FBVB 1UPTA 5EZ5A 5J5CA 3SBDA 3K0FA 2ZEJA 5DYGA 5IF9A 3TGPA 3GMTA 3C15C 3GLGA 2VSXA 3C41J 2FV8A 1R0YA 1R8QA 2FGKA 2IA5A 1U0LA 1AKYA 4ON9A 4UXJA 2VH5R 1DAEA 1E2IA 1SVSA 2QE7D 4PC6A 1VTKA 1YRBA 1W0JD 3B60A 1JB1A 3L2OB 5FOVA 3KB2A 2BC9A 2JLXA 1Z6TA 2IW3A 2ZRDA 2ANBA 1P75A 3EWAA 3GEIA 1P9NA 3MD0A 2HT1A 5IK2D 1S9DA 1T0HB 3CRQA 3RVBA 4LJ7A 2WTUA 3AVVA 2QGZA 2W2VA 4M4SA 3BK7A 5K8LA 5JLJA 4FCTA 2JJ8A 5IDVA 4CDGA 4DLUA 2FFBA 5C1BA 4CF7A 1YR6A 1EGAA 1ODFA 5EXSA 1FL9A 3LXXA 4Y0VA 3L0OA 4Q1DA 2GK6A 4P0TA 3SI7A 4IDNA 5KNBA 1N6RA 2ZRHA 3EZ6A 1DS6A 3RSOA 3NDBB 4BASA 5JSZA 2IS4A 1P60A 4TQ9A 4URWR 1FTNA 2C9CA 1JECA 3THXB 5DI9A 1Q21A 2BV3A 2WSMA 4Q03A 4V02A 4XSHA 3FVQA 2F9LA 4DCVA 4CEHA 3CZPA 5FOSA 1OHHA 4P4UA 3JVUA 1DO2A 4DB4A 2CL0X 3MFYA 2PMKA 4DDVA 1Z6GA 1JXOA 5JCZA 1MT0A 4GZLA 4L15A 1X6VA 3VR3A 4M9SA 1ZRHA 2ORIA 3E2IA 1E0AA 2QQEA 4NCIA 1BIFA 1W2GA 1G17A 1T8TA 2ZRFA 1QHGA 3GLHB 3WMFA 3WP1B 4BRUA 5IRCD 2QBYA 1EWQA 2REXB 1R0XA 2ZITA 4WAUA 4B71A 2ZJ5A 3DMDA 1U9IA 1G6HA 2O5VA 4GOXA 2NO9A 3CONA 5K8UA 1G4UR 4QL3A 3F8TA 4TYPA 1E98A 1XWIA 4RD6A 5E3HA 2AD5A 3QXJA 4HEJA 5LBIA 3HYRA 3DDCA 3BE4A 2HJVA 2KI5A 1RYHA 1YRAA 3RABA 1VG8A 2ZR7A 3TK1A 4LDJA 3CF6R 4QBGB 2QAGC 1P6XA 3U7FB 1IXZA 2H92A 2O8FA 3TRFA 4RVCA 1P3JA 4LBYA 1S1CA 1ZD9A 2UVQA 1KSGA 3AQ4A 3AUXA 4B2PA 1HE8B 2CL7X 4UXIA 3EX7C 3GJ8A 1ZUNB 4XTRA 3GFTA 2ZRBA 1OFHA 1VG0B 3NH6A 3CM0A 5EP2A 3TW4A 4B44A 2G0NA 2DFNA 3SQXA 5FTLA 4KHZA 4HUQA 2GEVA 4AKHA 2QUZA 1Z28A 1TPZA 1G7TA 3SU8A 4P31A 1AQYA 3BWDD 2O52A 3GLGE 3IUYA 3HJNA 4M2LA 2ZETA 1WQ1R 3LLUA 3TR0A 4RD3A 2PCJA 2BJWA 3AP3A 3AH8A 3TLXA 1TADA 2YC2C 3PENA 3RSLA 3SYNA 3AP1A 4QJ3A 2R6DA 2RGEA 1VYUA 1F2UB 2R62A 3TUIC 2ZJBA 3RRZA 1W0KD 5K8IA 4DLSA 3MLEA 1YR7A 1KI3A 4OI1A 3AVTA 1PVOA 4MYUA 4D0GA 2OE2A 4Q9JA 3E70C 1E79D 2BWJA 1KI9A 4KVAA 4NL4H 1JALA 4G5SA 1Z0DA 4US0R 4NYIQ 2B92A 4C0LA 3B7GA 2IYXA 1KAGA 2QPAA 4LYJA 5FUYA 5LB2A 3DMNA 1KY2A 4DLYA 2VBCA 3U60B 4E5UA 2WJGA 5AWFC 3OE7A 3VKWA 1QF9A 4V0MA 3VU9A 4Q7KA 1UBCA 1ZC4A 2NQ2C 3GJ0A 3GJXC 1VHTA 1G8GA 1XJ0A 2HCJB 3ZYCA 3PCRB 1N6IA 4C0SA 4ABYA 1HUQA 4EUNA 4PO9A 4HAYA 4OYHA 3BH0A 4UNQA 5C4GB 1X3SA 2IF0A 5B2ZA 2GVDC 2W6IA 3RC3A 3FPAA 1G3UA 2BKEA 1SKYE 4QJ5A 1AGPA 1XDBA 4TTRA 2V4ZA 2Z83A 1JPJA 2G6BA 2OHFA 2VP0A 3THWB 1TEVA 1EFCA 1YZLA 2ZYUX 2Q9CA 3GEHA 1T6NA 2UZ3A 5FOUA 3A6PC 2AKAB 1JR3D 1OF1A 3KL4A 4A8JC 4M1SA 5JWOA 1ZM9A 2QP3A 2YJTD 4YDSA 1EWRA 2EFHB 4LYFA 4C0KA 3ICQB 1MH1A 2GEDA 4K8OA 1VYTA 4WZAE 2A9KA 4ZCLA 3O8RA 3AUYA 1UKZA 1P73A 2WMOB 4KFSA 2W2XA 4TMZA 2FNAA 5E7MA 2RKOA 1HV8A 2MSDB 2YOHA 2VP2A 4W5WA 1AS0A 4DVGA 2YKGA 1SHKA 3KQNA 1LS1A 3B82A 1D5CA 4KU4A 1COWD 2QTHA 4F7WA 2QPOA 1Z0FA 3EXAA 1BMFD 3GJ6A 2OCBA 3LRPA 4NTZA 4YMWA 5EE3A 2BDTA 3EZFA 1M7GA 1CTQA 3GLIE 2VRWA 3K0CA 2WPDA 2V9PA 2F1JA 2F3RA 4UNPA 4JVSB 1N6KA 3A1SA 2GETA 3O8DA 1P5ZB 4O2RA 4AG6A 3KJEA 3QPUA 4M1TA 1WRBA 3IPYA 3KFXA 2WAYA 1Q1BA 4LJ8A 2QA5A 2D7CA 4K81B 1TUIA 4WA7A 3RS7A 3K0SA 1U98A 1WMSA 2BEJA 2W0SA 4TYQA 1NVVR 1SXJA 1U94A 1P9WA 1XU4A 3QKUA 4JLOA 2V3CC 1N6LA 3PEUA 4IOLA 2HXYA 2LKCA 4ZKEA 1CLUA 3K53A 2HXSA 1VDZA 4TMVA 2ZAMA 2F3TA 4BPBA 2F1HA 2RCNA 2ZRKA 4PC7A 1G7CA 4PC2A 4H1VA 1LNZA 2VO1A 3FKSD 2AXPA 1G3RA 5HZKA 2D4HA 2ZUDA 4QGHA 3X1WA 1FPMA 4Q00A 4BLQA 1HEIA 4KODA 4CW7A 3DZDA 3T15A 1KKLA 1I4LD 2A7QA 2RAPA 3GP8A 4YQFA 2V54A 4A4DA 4NHOA 4URZR 4UQOA 3NDPA 4V0ME 2FSFA 3W6OA 2JLYA 4KYIB 5FTJA 2OLKA 4Q02A 2ZROA 5A0FA 2ZYVX 4WOPA 1M8PA 2BBWA 2VF7A 2IXFA 3B6EA 5CLLA 3KDSE 121PA 4ESHA 1CJKC 5LD2C 1GIAA 2GJ9A 3SNHA 3JVVA 3TIFA 4I1OA 4U7DA 1T4GA 2WKPA 4D25A 2F9MA 2IUUA 1OH6A 2LWIA 3QVVA 4YXWD 3U61B 1E96A 2ZRPA 1G1MA 2DFKB 4L8GA 2J87A 3KTAB 5KDDA 1FMLA 4Q4LA 1PJRA 1KMHA 4WXPA 4A0FA 1E2LA 1W5SA 3RANA 3EARA 2F43B 4W9MC 2HLDA 3CW2A 3AV0B 3MCAA 2RMKA 2W00A 4I4LA 1TU3A 1XCMA 2XX3A 2WIAA 1KNQA 3MWJA 1IN5A 1G7SA 1NI3A 3CRW1 3LVQE 3O47A 4IHQA 3TVTA 2FFAA 4R2HA 4V03A 3EA5A 3CRMA 2REBA 2IS1A 1HA3A 2VF8A 2BBSA 3ETLA 1KO7A 2OESA 1SVKA 3B5JA 1UFQA 3NKVA 2ZIAA 5FUVA 5H70A 2A78A 2OCYC 2OAP1 2PL3A 2YC4C 1CKEA 4TYYA 2MSEB 3RS4A 4C0QC 1YR8A 3THYA 2PJZA 3B9PA 5KHOC 4RD4A 1W44A 3TR5A 3OEEA 1E94E 1IN8A 3AF4A 3H1TA 4G5RA 4PHFA 2NO7A 4HLQB 2HUPA 1ZD8A 3HPRA 2WVJA 1ZYUA 2YV5A 2KBFA 2QSZA 5JHGB 3WY9A 1DAGA 1T5IA 1U9IC 2Z4RA 1NVXQ 3V00A 1EK0A 2YNMA 3RAPR 2HDNB 1S9HA 2AWNA 2UKDA 4MITA 821PA 3BH6A 1SXJE 3ZLJA 3QPWA 2YYZA 1UADA 1T8UA 2H16A 5ANRB 721PA 1US8B 2FN4A 1NBMA 1UEJA 2WOOA 3I32A 3GFPA 3FMOB 4AWXA 3QKRA 3TBKA 2WJYA 1TNDA 5FL7D 4LBZA 1DG1G 4IDHA 1PLKA 3FDIA 2Q3HA 2BHRA 1ZVQA 5H68A 5JI3E 2IBMA 1ZM7A 5J4KA 3I62A 3HPQA 4OJQA 1ESMA 2ERXA 1J70A 1ETUA 4LCBA 2IUSA 621PA 3L82B 1MR3F 4TTPA 1R2QA 5E95A 1OXTA 1E69A 2XNSA 3I72A 4MGYR 4MRNA 2O0JA 1ZD1A 2V55B 4LYHA 2JIZD 3SJZA 1W48A 3NC0C 1OYYA 1YZUA 3LO5A 1OXSC 2NG1A 1Q1EA 4ERNA 1Z0KA 2YOGA 2PZFA 2DPXA 2JJ1A 4M9ZA 4GRAA 4I81A 5B58C 1K5GA 2FOLA 4URUR 4RFSA 1FP6A 1X8LA 2GCOA 5AJZA 4EPRA 2J1LA 3T1QA 2BBTA 2QT0A 3QBVA 3I8SA 2DYKA 3LLMA 2ODBA 1D8TA 2WJJA 3LBIA 2W2TA 3VTKA 4TT3D 2G77B 2QMHA 2ZUBA 4TMXA 3UATA 1IAQA 2TMKA 5EJEA 1OH8A 5BYJA 3T12A 3SQWA 4WZBE 2J0QA 1G5PA 4JLBA 4PANA 1RRGA 1IJEA 1VHLA 1ZM2A 2D74A 3R8FA 1ELOA 2RGGA 1GG2A 1JR3E 4B47A 2QTVB 4WW0A 2PJRA 1C4OA 4XVUA 4CEJA 4GOJA 1ZUHA 3R7WA 3PEWA 2PEZA 5JJKA 2P0EA 2IYRA 4OHXA 2IS6A 2R6GA 3FOZA 5L3RA 4RD2A 5J4HA 1H65A 1NVWQ 3PEYA 4KAXA 4TYNA 4QC2A 1S3SA 3LVRE 2WV9A 3BC1A 1XEXA 1T3HA 2AN9A 3A37A 4GL2A 1KNXA 1EX6A 2X2EA 2OZEA 4AD8A 1OKKA 1MRNA 1QHXA 2OBNA 2JLRA 4HZUA 2O8CA 5FBWB 2XXAA 3X1XA 1AQUA 2VPPA 4D80A 4AYXA 5KUTA 1ZINA 2FSHA 4D4KA 4DLRA 2ZI6A 2Z5FA 4LGMA 3TH5A 1PLJA 4E09A 1P9RA 5DI3A 1E9CA 1RKBA 3KQHA 2RB4A 3NBZC 4FCVA 1Q0UA 2A5YB 2BCJQ 2VHUA 5EE5B 2IC5A 2VA8A 4OQXA 1NBME 2ZRLA 1U8AA 3BB3A 4A15A 2GKSA 1XF9A 3A1VA 2A2ZA 3CKLA 4GDFA 2J41A 1LF5A 2ZRJA 3VR2A 3EIEA 2VTKA 2QENA 2Q21A 2EFGA 1MV5A 3PR1A 2JJ2A 3KFVA 2IWHA 3AGPA 1XEWX 3VR4A 2NMVA 3T1OA 3CF0A 4AYTA 1I2MA 4BLSA 2ZJOA 3I8XA 2QI9C 2CK3A 3K0CC 4TMKA 1GRRA 1VMAA 3FMPB 1XD2B 3HWSA 4Q1BA 1G5TA 5EP4A 4UXHA 1IOZA 3LWNA 2IYVA 4P3YA 4MDEA 2ZR9A 2CNWD 2QN6A 3QKSB 3QQ5A 2QP9X 4P33A 3X1YA 2WWGA 4LHWA 1N0VC 2P6RA 5L8VA 5FTMA 1SXJC 1MABA 1RFLA 4HLDA 3PIRA 2KJQA 1OYWA 1WB9A 4X8MA 1MOZA 2WWFA 2VYFA 2C77A 1G6OA 3P4YA 2ZSEA 4O2LA 3I4LA 1E99A 4FWIB 3U3MA 4C30A 4F4CA 3K0AA 4MUAA 5CITA 2E87A 2H1LA 4PX9A 1AKEA 1SULA 3QSYA 4FXPA 3QOFA 4Q18A 2CHVA 421PA 4HB2A 4Q9HA 3SS8A 5AUQA 1XPOA 1HQCA 2C03A 2PLRA
chains in the Genus database with same CATH superfamily
4M6YA 1KP3A 4KW7A 1A9PA 1TF5A 3WFJA 3FAKA 3FZEA 4CCYA 1ZD3A 5CA0A 3FTEA 4J1TA 5CBPA 3EYAA 3GJ4A 5IH7A 3EVCA 3ZEIA 2YWEA 2GLOA 3QHPA 1QGAA 2HU8A 4C7JA 3ZMVA 5ADUS 2E5LB 3H18A 1KH1A 3UAOA 2GAJA 2CEKA 1W36C 3BWEA 4OQDA 4E70A 4IQ4A 3Q6NA 1W7AA 2BR4A 4FWTA 1BQ4A 4F4UA 5SV2A 4XLZA 2I8AA 2YZ7A 3C6QA 3GCMA 1X9IA 3JWGA 1L4HA 4AQYB 1V4BA 3KP7A 2CVFA 1F36A 1PWXA 2AW3A 3BTUA 2HMYB 3NYRA 3K8OE 3G2BA 4X7MA 1OLSB 2IEKA 5KYXB 1CWUA 3UJ9A 4DARA 3AZPA 1CD5A 4GBMA 3S1MJ 3L8ZA 3GWZA 3ASZA 2FMXA 1A4XA 2SKEA 4Q9LA 5F5NA 2QJOA 3D43A 1A4UA 3DZFA 2A0WA 3E8SA 5CM9C 1QHYA 3EPZA 3O2NA 3G73A 3H4MA 3T9DA 4BU0A 1R0SA 4DG8A 4FOSA 1CUIA 1ZEMA 4WY8A 1ZSYA 2OQIA 4DKJA 2Z2YA 3SHTA 3KXIA 4UDOA 4Q12A 3WGQA 3HYNA 3DAPA 2GJAA 4LJLA 1MGTA 4C3JJ 1B26A 4RA9A 2MSCB 3EG5A 2F7SA 4YO7A 3MELA 5LU8A 2G9NA 1M67A 5AYVA 1FTSA 2MINA 2QM7A 1ZK2A 1L4FA 3SD7A 3IL2A 2HSWA 4U0JA 2JLCA 2ZXJA 4CM3A 1I9CA 3BQNB 3JYQA 4BOYA 3HWWA 4EGYA 3O03A 3GTOJ 3TUZC 5CVTA 5E6UA 2C8JA 1U0SY 3JTEA 1XTQA 4U3JA 3AL3A 1FQWA 2AOXA 1P5RA 1PEKE 4INJA 3K5IA 3E0XA 4URYR 2XAQA 2VKTA 1FYWA 4QQ8A 4RORA 3C5EA 1U8EA 5KYUA 3QOEA 1NLFA 3LNTA 2PWBA 2EJWA 1U2PA 1R4NB 3IRRA 4RTSA 3GJ7A 4R1TA 3IXLA 2IDZA 2QNBA 3OUZA 1JJVA 2W2LA 4QO8A 4P0QB 3KSUA 2EV9A 2FMKA 1XEFA 1M2EA 1HZZC 4NNOA 3KIPA 3LY5A 4GPBA 5TLSA 1ECJA 1ZPDA 3P45A 2RH4A 1YB5A 2CW8A 5LOVA 3MMYB 4NK4A 4A23A 2IHJA 1ADYA 4P9UA 3TZQA 2H1FA 4LI0A 2OXRA 1OYIA 3PA8A 5HS9A 1QQ5A 2BV6A 5K3OA 4IL6C 3FUXA 1U8YA 3TS1A 3FLMA 2HPAA 4EIWA 3H2JA 3RREA 4G09A 2Q1TA 5DBOA 3QIAA 3BT9A 3DP9A 5DNDA 2ZE8A 3NTLA 3RYCA 3GLFA 1I5RA 2I6QA 3BWBA 4EUHA 2UXCB 4MGIR 4MA4A 4A7PA 2KRHA 1NW4A 3MFKA 1SOMA 3TL3A 2FHPA 4XWAA 3Q3JB 3IT0A 2OG1A 4V0NA 2PJDA 1IN1A 2PD3A 3PL1A 4BU1A 2QYSA 4MQVA 3RADC 2PAFA 3CJNA 4Z7NB 4OK6A 3IKVA 2DQLA 1HG0A 5IU6A 2OAQ1 4GXNA 1E3IA 5BSWA 3GCXA 1F0YA 4Y2PA 5KKCA 3NHFA 4II7A 4R1NA 3VU9B 1JR3A 2VC1A 1K4KA 4A0RA 4IIYA 3ZZNA 2VP5A 3NTVA 5AK0A 4GG1A 1NX6A 1E20A 3QXXA 4CMGA 3HZHA 1NM5C 3PCTA 2ZUCA 1SBCA 3UMJA 3BAFA 3QSGA 4LXGA 1UDBA 5EP1A 4EJFA 3W6VA 1W29A 2B61A 2VHZA 4GR5A 2V7QD 4KDFA 3LXRA 4FHZA 3STYA 3P9YA 3TD2A 2OP0A 2P75A 3ZV4A 3T1VA 3GYHX 4E7HA 2OTLI 3HXOA 1T1RA 4H7EA 1NBAA 3FKSA 3AKCA 2VXOA 2G1KA 4NMMA 4R1MA 4YRDA 1NYQA 1QBJA 4UPVA 2YW9A 1GKKA 4YUVA 3BSSA 2O0YA 4D0NA 3IHTA 2Q3MA 1XP5A 4BY9E 3H75A 2HQAA 3ENKA 5IHXA 3R0VA 4PZZA 3RT9A 1Q3HA 1S2MA 1EQAA 2NXJA 3R9IA 1DC3A 1MW7A 3H2GA 4DJFC 1JHAA 5AM2A 1V8BA 2IZ1A 3HN2A 5GADJ 4EO9A 4MTEA 2CDRA 3CJRA 3GCWA 4Y6RA 5AKEA 2V0CA 4G0ZA 2AOTA 5AM4A 2CCGA 1NY6A 2ECOA 1VJGA 3QPLA 4QTTB 3RQ4A 1K63A 5FPQA 4IO9F 3FI0A 5AONA 1RZRA 3U1TA 2LBFB 2I87A 3GF2A 4RTPA 3KOMA 3I73A 3C4JA 3G9TA 4OM7A 3T4UA 2NTNA 1F9AA 2OK7A 3KL2A 1EXVA 2G9WA 3OJWA 3QKRB 1YI1A 1VFPA 2Y6UA 2LUOA 2Z1NA 4IMIB 1AS3A 3RDPA 4Z49A 5F35A 1IZ9A 2Q5IA 2VH1A 4RK6A 4GMHA 1ENOA 5JCOA 4DSUA 1UXGA 2XZOA 3Q3EA 2VJAA 5HX7A 4DR3B 3TSZA 2X2PA 3Q72A 2LCIA 1XELA 5JNLA 5A1TA 4M74A 1J56A 2RGNA 2PS9A 1ZIOA 1J4AA 2WM9B 5A1JA 2JFGA 3I42A 5FHRA 5ADWA 2C98A 4LZNA 3A3NA 4DIDA 1WULS 2M32A 5TISC 3W9SA 4XB2A 4TTQA 4A2WA 1D4OA 1A71A 4YRLA 3BERA 3IHWA 4KQGA 4G12A 4TROA 1LUJB 3U4MA 4AURA 3RK1A 1WUHS 3IO3A 1NC1A 2QAJA 2WWRA 4B1RA 3IMGA 3GFFA 1ZUNA 3U80A 4JLNA 1Y5NA 4L6IA 5EJGA 4NE9A 1OILA 5B7PA 4AN4A 4GUDA 3T4PA 3DMHA 3ISJA 2YIDA 4NJMA 1DBSA 1VECA 3W5UA 4MJ3A 1EEHA 2VUHB 3TIIA 1T4MA 1HEYA 1TYZA 1PP7U 1Y33E 1OTYA 1VXRA 1DQUA 2Y8EA 1XZLA 1B2RA 3ZLUA 3MA0A 2LSOA 3FHOA 2B0JA 3K0AB 2BGUA 3LSIA 4Z51A 3H42B 3TOXA 2DA1A 2CSXA 3W7AA 1MN6A 1MX5A 3TM5A 4OBEA 3JAMA 1U0BB 3OM0A 1LY1A 2HR3A 1NTCA 1HT3A 3LRXA 4IBOA 3O8CA 4MAFA 2VSYA 2BM0A 1Z2AA 1JJ7A 2X9DA 4Y17A 2BY2A 2CXTA 1QOZA 2LH9A 1TEXA 4AS3A 3L92A 4YRJA 1EDBA 2P4EA 2EZIA 3B3GA 2Q0OA 2BP7B 2HXGA 3U7QB 4DSNA 3PA6A 3PE4A 3I09A 1DIGA 1N0IA 3FFWA 2NVXJ 4RVUA 5EZGA 4E5NA 1JG4A 3K0EA 2J5KA 4EG1A 1SA0B 2XUJA 4TS1A 4A92A 4JL5A 2CSOA 3DPTA 3FLBA 4E7LA 2FZKA 4BJ1A 4GYJA 1UKEA 3C14C 5K5OA 4OQMA 3CQZJ 2OOKA 4XKJA 4OHBA 2DGDA 1H8EA 3AVOA 3S28A 2I3ZA 4S1NA 2P3SA 1SUSA 1K88A 4L5EA 3Q5EA 4HT3B 5EJ7A 1FYMA 5FR1A 2IXAA 2XGGA 4XFDA 1VJDA 1GFSA 2Q1YA 5EIOA 2C31A 2P6OA 3U17A 3WE7A 1MGOA 1OLXA 2Z4TA 2O6HA 1KVTA 3AY3A 1FU4A 4JA0A 5JATA 5JS2A 4DDWA 1T2AA 2UZKA 2V5VA 1DKLA 3NQ41 3BL5A 1E2EA 2PIAA 3BYZA 4XCVA 4L4ZA 4YUAA 1O6ZA 1FBQA 4JZYA 2XMQA 3EPHA 3EVNA 2QRMA 3TB4A 4ZJPA 1E1MA 3LDAA 5TF0A 3GTPJ 3E9DA 4TVKA 5GPAA 4XM3A 3NHSA 4I3FA 4L78A 2W57A 3PNMA 1ULHA 1BBYA 5D5PA 3M83A 1U63A 3GRVA 5KYTA 3U7RA 4KTVE 3U4AA 1WCIA 5HGXA 3D4LA 5F7XA 2ZQYA 1E9RA 4LEIA 3VR4H 4X93A 2GIVA 1OBCA 4G1EB 4NNPA 4Q4CA 2ERCA 5F76A 1W8IA 1IWPB 4ENNA 1YK0A 1KQPA 4JP2A 1E1CB 2CFOA 3ND7A 3H5IA 4IV5A 5KYWB 4R2IA 1OV4A 3VAZA 1HW2A 1Y4AE 1KK3A 3ZQ6A 5MFZA 1XKTA 4YJFB 1H5NA 4A2CA 1QZ3A 1GTVA 3WLMA 1ZUWA 4NQWB 5JAPA 4O4HF 2OV3A 2COBA 3PNKA 4YVFA 4GECA 2W83A 1DKRA 1P4WA 1C30B 3G5LA 5GTDA 3TRIA 2W24A 3CUQC 2CVHA 2XYGA 5ILUA 2BGTA 3CLHA 5JZ9A 4G0YA 2APJA 1REQB 2ECKA 3CG4A 2YS7A 2H3HA 2CK3D 1NRJB 2QTLA 1WOMA 2WJ4A 3LX4A 5AHRA 2J48A 4C5CA 1QIIA 4INZA 3C3XA 1LQ1A 4OKNA 3H11B 5B3LA 2CJWA 1CDDA 1Y8RB 3GTGJ 2GBIA 4TKVB 2FLWA 4IEIA 4NUBA 4ENUA 2G06A 3PUWA 2A14A 3AL0C 4XORA 3S2ZA 3DNPA 2AN5A 3IULA 2XOKA 2NOAA 4CGYA 4J0KA 4G0MA 4DJAA 2XYVA 2R9VA 3IP7A 2WLTA 5KSYA 3S14J 3K4PA 3M6VA 3KXKA 4L1KA 1QX4A 1G5RA 4IZHA 4B0OA 2HA2A 1PFUA 1IG7A 3HDHA 3AG3H 2NSJA 4MW6A 2VB6A 3QW4B 4ECEA 4BUZA 3WSTA 4TZ6A 1IZ1A 2ZIGA 3W04A 5HS4A 2I7DA 5C80A 3KX2A 2ZFUA 1JKRC 4H15A 2XGMA 4U6SA 3ZW9A 3SXUA 1K5DA 2GAFA 3DLHA 2QTGA 2DUNA 4RTKA 2TDXA 5EIAA 3B9BA 2JIBA 1ZJ6A 2GJKA 1J90A 1Z82A 4EFMA 4RXTA 1ZK4A 1YF3A 3ZI4A 4MRPA 2Y66A 4HAXA 4BNDA 2CMFA 1IEQA 5JAMA 1T9GS 2JUGA 4Q01A 1OTHA 4B2LA 4DQKA 4K9PA 5F9HA 4LMAA 1W6RA 1XCVA 4IH9A 2GF9A 5CEJA 3ZD6A 4BE7B 4BAGA 2GM3A 4P1ZA 3M4ZA 5CT6A 1HTWA 3WTSC 1ZMRA 1OUMA 5SYAA 3CNHA 4DSAA 1G3IA 2BI4A 1G7RA 2QR5A 3F5FA 4N3AA 5THQA 2K9MA 4GVPA 2Y4NA 4L16A 1QE0A 3T52A 4HDMA 4P6VF 4XA8A 3X2EA 2I6UA 2CKDA 2I4RA 4UHKA 4RK0A 2ENWA 4K03A 4ITVA 1R6VA 1UQTA 5K5EA 5HVQC 2D5AA 2A86A 2ZOSA 1MBJA 4HWRA 2EOAA 1QB7A 2RHTA 1EB8A 1KS9A 1QP4A 2LW7A 3HR8A 2I6TA 1E2HA 1UBEA 1QQBA 1I0ZA 2M7AA 4Z2YA 4YJGA 1WNTA 1JIKA 3LUHA 2BFMA 3OQIB 2XUZA 2CLLB 3THSA 4MI3A 4XDHA 5K8VA 1HBXG 1JGTA 1SVSA 1P5JA 1FS6A 2WU0A 3PDWA 1VTKA 5FI5A 1XZMA 4AAYA 5C5EA 2JLXA 3EWAA 4J2HA 4ADSG 3E6DA 4AP9A 2QGZA 1AUPA 3WOHA 3M82A 4XB6B 3BWGA 1ACJA 4EY4A 3Q87B 2QSJA 4EM6A 4Q03A 1WP4A 3JQBA 1UMKA 1ZMBA 4XGRA 2FF5A 3HCRA 3HXQA 4CTOA 4M9SA 1PZFA 4GM1A 4IGAA 3RKUA 3L7JA 1R23A 4B5KA 1G17A 4YPVA 3QPSA 4D1QA 4F52A 2VWGA 3KLOA 4TYPA 1OFCX 2NYUA 5CB0A 2YWCA 3T99A 1RKXA 3I71A 4AZWA 4CKWB 3GJSA 1VBKA 1KEEB 1IM5A 5JFRA 3WB0A 1Z4PX 2QAGC 2IY9A 4MICA 3KVYA 5BV0A 3GUHA 1OAOA 1Y8AA 4WOKA 2QVLA 4YJ2A 1Z9BA 5KZMB 3OR1C 4Z0TA 4A0QA 5AW4A 4M2LA 1UBMS 4II2A 1PVEA 3K6SA 4WGGA 2O0LA 2OKCA 3MLEA 3AVTA 1JHZA 1G0OA 1GTJ1 3JARA 2V7VA 4ZT7A 4MQLA 3P9PA 1J0CA 2QPAA 4NU8X 5DTEA 1RXIA 2YJ6A 3OMLA 5M2QA 2VBCA 3AL2A 2J3QA 4YHHB 1K66A 4LG1A 3NOXA 5LXTF 1PR5A 4CYCA 2NUAA 4NVRA 3THWB 2HW8A 2PUGA 1ORVA 5I8ZA 5BSUA 4A8JC 4D4IA 3FF4A 5GY7A 2BFNA 2Z99A 4GQIA 2WMOB 4MS4B 3KTDA 3UAWA 1SHKA 1LS1A 4IICA 2FZWA 3D59A 2AIRA 2Y68A 3M5CA 2BDTA 3IOYA 2IT0A 4LMPA 5JC1A 2ZTUA 4Y0NA 2J33A 3KFXA 1NNSA 3RSHA 2PU7A 4RANA 2Q1SA 3QKUA 1P9WA 3UMMA 1E59A 3C24A 4I0BA 1B8OA 3CVUA 1AHPA 3I37X 4D8VA 3U7IA 2AXPA 3X1WA 2PWYA 4Q00A 3UGKA 2ICAA 2YRWA 1HDOA 1LPSA 5DHTA 4CYDA 1L1EA 2XE7A 1F5SA 3WTXC 3V8EA 4HBLA 2GJ9A 4U7DA 2XDYA 2IUUA 2JHAA 4YQYA 3ERCA 4HGZA 3ER6A 4QRDA 1SC9A 4PXYA 3KLNA 5TSDA 4AU1A 2PKRA 1BCRB 2XVCA 2WIAA 4KOAA 4ZCTA 3IMCA 2OESA 4TKZA 3SWWA 2RVCA 2MSEB 1XL0A 2J09A 2ZLBA 4P4GA 3BMQB 3BA6A 4YFYA 1EFKA 4BCDA 3PFBA 1X70A 1BW6A 1BJTA 1TKAA 1RAEA 1B16A 2C9MA 4C6TB 5JHGB 4FE4A 1T5IA 1VQOI 4DR5B 4IIJB 5C1IA 1TVKA 1YT5A 3EN0A 1NJ6A 4UBOA 3I54A 4HOYA 2B5OA 4LBZA 2QY6A 3PO3J 2JT1A 5GPBA 3IB6A 5JI3E 1G98A 1HC8A 2C7VA 4KIGA 2FWAA 3B1KA 3I9V2 3WAKA 4S12A 4EVQA 1SUWA 3LO5A 2G0EA 1BGVA 4E7ZA 4DV6B 3A2LA 2RHRA 2PUDA 2P5LC 4RMGA 1P2BA 4JOMA 5BPFA 4WTOA 4TZTA 2F4NA 5LNK6 3HTXA 2EAUA 1KQGA 2PJRA 5I7HA 4JYPA 1D4AA 3FVTA 1U8TA 2IS6A 2XKKA 3FOZA 1A76A 1UPFA 4J0JA 2IY7A 2OB2A 1S3SA 1PYGA 3M33A 2AFRA 2GXGA 3A37A 3LWZA 2WJ3A 1NE2A 2QJWA 4R3UC 3HJFA 4IY1A 2E5WA 5FBWB 3X1XA 1AQUA 4IV0A 1A7UA 2IEIA 3QU7A 3FD8A 2CJXA 2CVZA 1TW3A 4CLDA 4PCLA 4TTIA 3QOPA 4BHTA 2GPSA 1VLVA 2HFJA 1J22A 2XXBA 3HKCB 1I2MA 5KKAA 4PLGA 4YFVA 4G0WA 3TLCA 4BO5A 1SIWA 3QKSB 2WWGA 3CWCA 5CFRA 1R5JA 1OWPA 1XX5A 1QP7A 2Q3LA 3IT1A 1KMIY 4G23A 1GPDG 4BNJA 4CKBA 3WGJA 5CITA 4NQZA 2EJTA 2R4QA 3ZCPA 1TD1A 3VO8A 4HB2A 3W7VA 5F1KA 2DPYA 5K99A 1HQCA 2HU2A 2VLAA 2HK9A 5JSFA 5ERGB 1O08A 2AG1A 1PZGA 3R7SA 1T0JB 5C8VA 5CNMA 2V7BA 4IRIA 1FFDA 2FZGA 2AOWA 2OAZA 2O2EA 3EZ7A 3Q2KA 5BWCA 1EVLA 4XVQA 4AF7A 5A5EA 4L9SA 5AHWA 2IYEA 3TLAA 3IWZA 4N3BA 2OBLA 2QVOA 3MJVA 2GF2A 2C97A 4KQWA 2MC4A 1N6PA 1N2OA 1E6KA 5CFMA 3OFND 5AW2A 3AK4A 4JUDX 3LYHA 2AE2A 1NUHA 2GO1A 1U5TC 4LISA 1XP8A 3GRZA 3ZZUA 1ZN7A 1C0WA 1BWRA 2COEA 1MC8A 4DIMA 4OFZA 1EFHA 1DVRA 5LSAA 4BZPA 4RBNA 3DB1A 2YMMA 3G85A 4AY2A 5F1YA 4O4LB 1JQJC 1U1EA 4RTMA 3MTAA 1LQ2A 3W1WA 2Z5UA 3QEAZ 5EUMA 1JLKA 4X7PA 2X0EA 2EIJH 3ET4A 1ZU5A 5FKJA 3HDJA 1Z2NX 3KCCA 1UBKS 2RGDA 2Y30A 4HPXB 4ZZ3A 3BJEA 2XQGA 2XV4S 2KHZA 3CB2A 1V9CA 1G0NA 1Y8ZA 2O7QA 1IM2A 2EJVA 2QLBA 4XH9B 1KSHA 1NFRA 1HDYA 1XC7A 3C3AA 4ZYWA 1MC5A 1GEEA 4KN6A 1ZAOA 3NTXA 2JDID 2DQYA 2IGKA 4H1HA 2CBGA 1J0BA 2OHGA 1MEOA 2IIPA 2ZSAA 3DXFA 3VPSA 4MAMA 1X9GA 5E4JA 2PUCA 3VUFA 1DJLA 4M72A 4IKPA 1R0KA 3BTCA 1YRLA 1DADA 1OW3B 1B1CA 3CR8A 1L5HB 4MSUA 5G1PA 4HDUA 2D59A 4H7HA 4WBSA 4RZXA 4B48A 2ZS7A 4XYGA 3SZRA 4WCDA 2Y99A 3WMRA 1MZPA 4D5FA 2WE7A 1W0JA 3RC9A 4KACA 1NVGA 3QELB 3FTQA 1V3VA 4NC8A 5J8CA 1Z3IX 1SEPA 1AF7A 3CT4A 5D8LB 1HY3A 3K1PA 4J9UE 1XTPA 3F5DA 5D5XB 3JRAA 3DBHB 3C8UA 2OL4A 3GA0A 1XQ1A 3L8CA 1UJMA 4ZPXA 3P19A 2WAXA 1I1OA 1ECGA 1BH6A 1R1TA 1ATIA 3A1EA 3L0BA 1RXUA 3GFOA 4TTAA 4ZOLF 1KO4A 5AFSA 2NUPA 3PKJA 4YRKA 1J23A 1BI0A 2XJ9A 4EPXA 1NONA 3CH7A 1D4ZA 4UE6A 4C22A 3TG2A 3Q2IA 1XG5A 3MD2A 1O9HA 2D5CA 1AKQA 3GX1A 2O50A 1MRZA 3RS2A 3MUFA 1RP1A 5C5DA 5FUMA 1NYLA 3C3YA 3OL4A 1GAXA 2IEDA 4KDEA 1PSZA 1TL7C 2V98A 3LSMA 1GVHA 2VI5A 4L5CA 4FOTA 1V8FA 4TQAA 4HBZA 1HDZA 1SN7A 4RL6A 1QCDA 3N76A 5CX1A 4ZHQF 4FR2A 2OZUA 3IEXA 2OCPA 3IVCA 4DBLC 1P4RA 4BO4A 1KARA 4ZGBA 3AILA 3DAHA 1HYGA 5BNZA 4KEAA 4KRXA 1Z18A 4B3FX 1L7VC 3DO8A 1Q15A 3MQ4A 2OORA 2M30A 2NXEA 2EV0A 3ONNA 3P20A 3OAAD 2Y71A 2QLNA 4ZK6A 3K9CA 1LBIA 5TC4A 1T2VA 5LLSA 3W34A 1EFPA 3GRYA 1X39A 1NW6A 4XJSA 1T0FC 1U0EA 3UA4A 3AINA 2LP4Y 2A9PA 3HR7A 2IHNA 3H3JA 5A3QA 3JRCA 1BA5A 1OFUA 3I04A 3QFRA 2VH2A 4COKA 2Q4OA 4JJGA 1MW9X 1X8KA 3GLQA 1PZEA 4B40A 4YRBA 3JZIA 2BJVA 2IYWA 1P18A 5B57C 2ZIWB 1VKNA 5B3AA 4YRIA 5BSVA 4CHGA 5JFOA 1ST2A 3KUXA 2HMWA 3QWBA 2OILA 2QTNA 6Q21A 6PAXA 1E0KA 1WA5A 1BFKA 2DWPA 5JXGA 1BW9B 3RYIB 3OOHA 1JJFA 3O3CA 5K6AC 4KDPA 2ORED 2ZQ5A 4QASA 3QFFA 1M1XB 4BJ6A 2WADA 3TQRA 2WKWA 4YRZA 5SY9A 5REQB 3ZIUA 3EULA 4MWBA 3M5DA 3QYEA 4EI9A 3NHKA 3CYFA 4ZI3A 2X6QA 4EGCB 3CX3A 3THYB 1KMQA 1Z2CA 2O8BA 3X0DA 3JALB 4RGRA 3ZTTA 1JTVA 3EZ2A 2G28A 1I5OA 4I0WB 3PQ5A 4FQGA 2DH5A 1GGVA 4FS3A 5T8KC 4NENA 5K0TA 1ZM3A 2XKOA 1A36A 3S15J 1GV0A 2F6RA 1KH2A 3BD9A 4HF0A 1WKBA 5IKOA 2LYCA 1BDBA 3O38A 4AKGA 2MBFA 2DHDA 2F6CA 1JEYA 4J7UA 1KTVA 2J59A 2DRIA 1NHGA 4MV9A 3ZV5A 5CYPA 4QFMA 4XMYA 4DV0B 3F3YA 3KP2A 4EW2A 2EYQA 1JTEA 1GSIA 2RV8A 1RI5A 3VHQA 2F3QA 1KI2A 4LHXA 3Q7RA 4XM1A 1UIMA 1OHHD 3OECA 3PF9A 4XRGA 5CVIA 3E7PA 3PQ4A 2G04A 4PV7A 1CXZA 2JLZA 2XXAB 3G88A 2IYTA 1DX9A 1GU1A 1V1MB 1QRAA 4UPEA 1ZP6A 3KAJA 1SQGA 5BQXA 3LOPA 3HCNA 2GBYA 2VEOA 4ALNA 3ABLH 3KOYA 3IKJA 3FWEA 3H0GJ 1E62A 3C5CA 3WTWC 1S96A 1TJPB 1SB8A 5ITSA 4Y2UA 4BUJA 3KT8A 1IHOA 1N2BA 4U63A 4DR6B 2OR3A 3G7NA 5HP4A 1JAXA 1VHQA 3OHPA 5GONB 1OIXA 4YX9A 3PUYA 5DNYB 1QYCA 4BQQA 5GIPE 3IE1A 3LLVA 4B87A 3I59A 1C9DB 2AO9A 1KYVA 3Q41A 2W2PA 4PTZA 3L1JA 1EXNA 1G20E 5DRYA 1W49A 2P2GA 1A3CA 2ZPAA 3RQIA 1D2NA 2W6ID 2ASVA 4V2FA 3ISPA 2NU8B 3QQAA 1GPNA 1RWKA 1GSOA 2XTNA 4TWIA 1R7JA 1XVAA 2JWTA 2QHXA 4OU4A 4MV3A 5TJHA 4BY1J 3VVCA 4WN9B 4LG0B 3WL8A 3O74A 3U9GA 4NFHA 4GQBA 1DX4A 4Y1RA 1YI2I 4NZYA 1G9XA 5DNCA 3L7YA 3X2QH 1TF2A 1WSWA 3OZ7A 2Q3JA 3DF9A 2RKBA 5B64A 3SE0A 3FXOA 3ZJUA 3JYLA 2R1VA 1JVSA 5K0SA 3MT7A 4E0BA 1DHRA 5IVPA 1XPRA 2NYRA 4G94A 5ECYA 4ESEA 1EM8B 3MTEA 1RJEA 3KSBC 3GNSA 4L08A 1KORA 2VCYA 5LR6A 2FX2A 1G5HA 2HLPA 1EFVA 5FOXA 1W34A 2W7TA 4PRZA 1R6TA 1ZVKA 2W4MA 5AJTA 2L42A 3PQ3A 4KMOA 5T57A 1P31A 3NHYA 3EXFB 2DZDA 2VKHA 1KDPA 5FNVA 2MYUA 1LRJA 4PSVA 2I8CA 2OXFA 3R0JA 3HUFA 4MRVA 4E5KA 3V7WA 3AAFA 4X24A 3ND8A 2I1VB 2VHCA 4A26A 2COMA 1CEEA 4R98A 4GDMA 4QBTA 3IP3A 4TVOA 4ME6A 3NAMA 4MLPA 3W8EA 3ICWA 5EGSA 1N25A 3FJOA 1Y1VJ 2Y1OA 3X1KA 4QUIA 3TEDA 1U4OA 3ZLBA 3Q7TA 4EG8A 4B17A 1E1RA 2V9VA 3FYCA 3BDVA 3DDUA 4GWLA 5EZYB 1DIRA 2QTVA 3A7DA 2B0CA 2DECA 3ZCRA 5M5YJ 2JIDA 4BBJA 4R1QA 1KXZA 2NACA 4NDZA 4RGQA 3D1LA 3DVQX 4PYKA 4JQFA 3OJXA 2O07A 4LX8A 3HTUA 1P6QA 1R9TJ 4ZCLA 4OK5A 3NUGA 4IKEA 3SFZA 9ANTA 2GAIA 4EHIA 2P65A 3DD1A 2KDOA 5CIWA 4KXLA 4M9RA 3LNQA 1ZXXA 1KYWA 4MMXB 2B7LA 5JD5A 4BEHB 4LZZA 3M9LA 1DJMA 1XD2A 2NO6A 1N2IA 4HQEA 1I5EA 3M1AA 4HNHA 3HOVJ 4L0YB 3K1ZA 3MS7A 3UKOA 3IH4A 1B23P 1J5XA 3B38A 5AQEA 5FA8A 1S89A 3E58A 1PSWA 1MQSA 4QVGA 3E1SA 3TZCA 2W37A 5HIIA 1Z88A 3RQSA 5IS2A 2VUSA 1MG5A 4L8LA 3LC1O 2PJUA 2WUEA 3OM8A 4LJ6A 3WIUA 1Z08A 4K9DA 3FNIA 4UVCA 3LP6A 2H1CA 4B09A 3HDGA 1M5TA 3J7AO 3FHJA 5IJ9A 4BLTA 1TM3E 1QNFA 5DTQA 1XNJA 2C7PA 4X0EA 1HNNA 3D4IA 1QTQA 3FUWA 3K9LA 3TO5A 3NNSA 3D3WB 5BSHA 5LU9A 1FC0A 1VSUA 4YPFA 2WZBA 2FWMX 4M1EA 1E2UA 4ASUA 2C2YA 2FKAA 5M3BA 6GPBA 2GOMA 4EG4A 4EHLA 3G79A 4MK4A 4OXQA 4G0XA 4K86A 1RI1A 2IT1A 2PKXA 3EZLA 5C4IA 2OBBA 4RLHA 2QMQA 3A1DA 4C9YA 2XA1A 1SH7A 3NWTA 4FZVA 1A5TA 1F51E 1U8BA 2BEUB 2BGNA 2CFRA 1T4DA 5JROA 5LGNA 2IOFA 2XQFA 3R3HA 5D5VB 4YECA 4D57A 1VL8A 4IHKA 2EZ9A 1X0XA 4IDPA 3JD2A 1SCDA 2HNBA 3K32A 4ZQGA 2DJIA 4DPLA 3PYXA 4Q9IA 1SKQA 1VIMA 2DU8A 2OUKA 1C7ZA 4HLUC 1C7JA 3WBJA 3QBDA 4KFTA 1FMJA 1QK5A 2G9VA 5KAIC 2M2IA 2GZAA 1XHEA 3EC7A 1FFAA 1SCKA 3TLZA 1GXQA 2Y1KA 3O7MA 1B72B 3N53A 4EENA 2OBMA 2CLHB 2XTJA 1MNEA 4IRUB 3N2GB 5FI3A 4Z2AA 2WQ6A 4FOOA 2R7WA 2R7MA 2FRDC 2BZGA 3BF7A 1RYZA 3I2HA 5JVDA 5E2IA 5FUWA 2Z9BA 1I3MA 3OOSA 3CA8A 4Q4JB 1F43A 1A72A 1Y4ZA 4UOZA 5TMBA 4BNLA 1B76A 2JJQA 3P2EA 2JBWA 1E3MA 2QROA 2P91A 2C5SA 3L8FA 1QR2A 3A7EA 4V0LA 3SHQA 4PYOA 4ZARA 1L5GB 4DANA 4K5QA 3CQ9A 4B34A 1H8AC 3WXBA 1XZ8A 3I56I 2QD2A 3RJPA 3U44A 1R0LA 1A7JA 5AVYA 5EZ5A 3RUDA 4HR7A 3WGYA 3C41J 1AVTA 4KMUX 3FPSA 2OBFA 4MDYA 3OSUA 3QYFA 2Y2UA 4LJ7A 4ZVLA 5EERA 3JSOA 4QREA 5CDUA 3AR9A 3EYIA 1Z5GA 1EGAA 1QJ4A 5B37A 3EUKL 4Y9DA 2BV3A 4XSHA 2V74B 4QWMA 4AYBA 4DB4A 1B0ZA 1JXOA 2PXXA 1RCUA 1K78A 3WLRA 1TAHA 3E2IA 3COZA 4NCIA 5FKOA 1T8TA 4BRUA 4A3MJ 3WP1B 3B6JA 1U9IA 3EXEB 5E3HA 3Q3IA 1LZLA 4FYVA 1PDVA 3OYHA 4NF2A 4PGGA 4I9GA 4LBYA 4LTDA 1NP7A 3AEXA 1HKHA 2NXCA 4JI2B 4I14A 3L7KA 4MW5A 1PR1A 3RI3A 4ZTZB 5J2UB 4AKHA 2XDAA 3OPYA 1U7UA 1JMYA 2PBFA 3AP3A 4YK7A 3AP1A 2R62A 1IMOA 4K87A 4OI1A 1DFHA 4WFJA 3TLJA 3I12A 2OE2A 3ZQQA 2QMZA 1S2LA 5JVGF 1M1UA 1I8TA 1PYOA 3I1IA 1RQRA 3U60B 3DKIA 3F74A 3TOSA 4C0SA 2YY7A 5A0VA 4PO9A 5CLFA 2A7XA 4AJ1A 3TL2A 4I9FA 3EVTA 1YZLA 5BN4B 3WL4A 4WINA 3E5RA 3K2AA 3DEYX 3P9IA 3FPKA 5EQJB 2A68F 3FKJA 4K8OA 4KMRA 1R6RA 1RADA 3O6VA 3OO1A 5AW3A 3IURA 1YASA 2LDUA 1AS0A 2HVSA 4KQ1A 3AXSA 2QPOA 2X41A 4G0QA 4OHFA 5HLGA 4JQZA 2CFIA 1BMDA 1CTQA 2IDKA 1PL7A 4XUDA 3KVVA 3E15A 2GETA 4O2RA 2PJPA 4OFBA 1FU8A 3TPZA 4Y6PA 4JAVC 1SXJA 2QQ9A 2J08A 2FPXA 2RAEA 3LUFA 4ZKEA 2OWDA 3DFIA 1U3EM 1RUOA 1VDZA 4TMVA 4L4YA 4C7VA 2O2SA 1YIJI 4ZVRA 1ZOIA 2ES4A 1QC5B 1CJCA 4URZR 5EZQA 3OS1A 2W43A 5A7GA 3UVEA 5A0FA 2IXFA 3B6EA 4W1QA 2Z8YA 5DDIP 121PA 1CJKC 4WGFA 2YJGA 5ILVA 5E0OA 5BOSA 3J7YJ 4RQBA 4WWCA 5JV5A 1YA4A 1E2LA 3RWBA 4KPEC 2HLDA 3TQNA 2HWWA 2XX3A 3MWJA 1IN5A 2VBGA 3WK9A 4I55A 1ZI6A 2NNLD 3NKVA 2OCYC 4M0MA 5K4HA 3O4VA 4FZ5A 2TS1A 4RHFA 4OX9B 4GH5A 3D4BA 3HPRA 2E4AA 1YZ3A 1U6KA 4INOA 1R27A 3V00A 2YNMA 3VDMA 3R4VA 3VOAA 3GFJA 1US8B 4A5NA 3CXRA 1AX9A 1XHLA 1X1EA 4HKTA 1LLUA 1HFJA 3FMOB 2JGDB 1HKUA 1PLKA 4YR7A 3GH1A 3FYUC 3RARA 3ROXA 3IAM6 621PA 1ZDMA 1R2QA 5ABPA 3F73A 2NU9A 2NLOA 3TAXA 1Y7LA 2P5YA 3L84A 3SM3A 4CKXA 4CM8B 4F06A 3L0CA 2PZFA 4U7GA 2DPXA 1Y9EA 1QFZA 4BLVA 5ESDA 2TYSB 2BBTA 4UVEA 2LIVA 3F8BA 4RS8A 3ODPA 4DWOA 4TMXA 4A3BJ 3V3TA 2FJPA 5BYJA 1RZUA 3T12A 3FCXA 3LCMA 1G5PA 4YUYA 4LIUA 1WCXA 1TWHJ 3C3PA 5HFAA 2P27A 3K1AA 1ZUHA 2OMEA 3D5LA 4OBXA 3ZX4A 5L3RA 1XS9A 3PXEA 4PZEA 1L6RA 1B8IB 4FDLA 2WV9A 2Q6VA 2PE5A 2QYTA 3T3PB 3U4IA 3N0WA 3WGHA 3F21A 3SBOA 4D80A 2V1NA 4W1RA 5DEQA 1LK7A 4EEKA 1SFUA 2II6A 2BCJQ 4MV7A 4CTJA 1N9KA 2Z1MA 5D6EA 1NBME 1SUBA 3BB3A 5BR7A 5CG1A 3G2OA 1OBFO 1LF5A 1JP7A 3HDQA 5C8XA 1POXA 3DBLB 3HL2A 1W5BA 4FP9A 3ONFA 3HCCA 1RWXA 5EP4A 3X1YA 1XZKA 4AFNA 5EMHA 5ITZB 1N3IA 4WCFC 1VSVA 4PS1A 1R00A 1RFLA 3RK0A 4HLDA 4F4FA 3EOZA 2KJQA 2C77A 1V45E 4C4OA 1E99A 2WB2A 2H1LA 4MUIA 5EUBA 3A28A 4OEHA 1OU0A 4QPQA 4RL4A 4F71A 4I50B 3C43A 4FGUA 5AUQA 4N7JA 4TRNA 2XRYA 1WBDA 4CQNA 3ER8A 2XB8A 1A35A 1JLLA 5KJCA 4ZDIA 5H5JA 4HNVA 1YL5A 3DVRX 4F93B 3H0DA 3I9NA 4BO1A 4RTJA 1XBTA 3QMWA 3F90A 2PMZA 3S2UA 3LUBA 1KQ9A 1RAAA 5EDNA 2WM8A 4C5AA 4PLTA 5KDOA 5LRSA 4JQOA 5C53B 1A5BB 2RNJA 1WDKA 2PMUA 3ZJYA 4JWTA 3IXMA 5CXQA 1LNSA 3I61A 4D1YA 3R7LA 4AD9A 3EVZA 1Z0SA 4JBAA 4PCUA 4UFPA 5TMPA 3VDRA 5B2FA 3DEEA 2A9VA 3OCJA 1KU6A 3AP2A 5DO9A 3R3VA 1FYXA 3ZXSA 1NK2P 4YJ3B 2XF7A 4IJVA 4ZT2A 3NGXA 3OWHA 2XVAA 2KIFA 1YU9A 3CF2A 1R16A 1JQLB 3GOQA 4F55A 4OINF 1UXHA 4KL8S 5CW1A 1NNUA 2WTBA 4PPYA 3P2JA 1KSFX 2RH9B 1CHDA 1WSAA 1QYWA 5EXPA 2XE4A 5DV5A 1GVDA 4IEJA 1DTWB 4FR0A 4WKCA 2CGEA 3HM9A 4MJLA 1UEXC 1UFVA 3OEHD 4BMNA 4DUYB 3HVKA 3HSSA 5EXTA 3ENZA 2C8LA 1M72A 3L9WA 1FUEA 1TZ2A 4D82A 3HE3A 4AYBN 1LWOA