2GXAA

Crystal structure of papillomavirus e1 hexameric helicase with ssdna and mgadp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
270
structure length
270
Chain Sequence
TEKFDFGTMVQWAYDHKYAEESKIAYEYALAAGSDSNARAFLATNSQAKHVKDCATMVRHYLRAETQALSMPAYIKARCKLATGEGSWKSILTFFNYQNIELITFINALKLWLKGIPKKNCLAFIGPPNTGKSMLCNSLIHFLGGSVLSFANHKSHFWLASLADTRAALVDDATHACWRYFDTYLRNALDGYPVSIDRKHKAAVQIKAPPLLVTSNIDVQAEDRYLYLHSRVQTFRFEQPCTDESGEQPFNITDADWKSFFVRLWGRLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*T)-3'
publication title Mechanism of DNA translocation in a replicative hexameric helicase.
pubmed doi rcsb
source organism Bovine papillomavirus type 1
molecule tags Replication/dna
total genus 83
structure length 270
sequence length 270
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Zinc finger, large T-antigen D1 domain 2gxaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gxaA02
1E9EA 3DVLA 2WMOB 2OLKA 1T5LA 2JGNA 3H1TA 4UNNA 2JLVA 3TNFA 4X8OA 4TLAA 4BZQA 3I92A 3B1VA 4IDHA 1S96A 5E7JA 1QHHA 2XNDA 1GUAA 4LBZA 3RS2A 5JFGA 2MSDB 4JVMA 3WHLA 4M22A 5JMTA 4A6XA 1JQLB 3RAPR 2CL7X 1E1QA 1CS4C 2RGBA 3CRW1 2IBMA 3BGWA 2ZAMA 4A9AA 4DSTA 1J99A 4KFSA 1QF9A 1W0KA 3PENA 1UKZA 1ZIOA 3NDBB 3FDIA 4TYWA 2IW3A 3AP3A 2R9VA 3QJYA 4B6EA 5AK0A 2J0UB 2ORVA 1N5JA 2XTZA 1N6LA 2XITA 3DOEA 3VU9B 1R0WA 3U7HB 2P0EA 1XD2A 1A4RA 1TL7C 3K70C 4G5OA 4DLVA 4LSGA 5LDDC 3M4YA 1J8MF 4B6FA 2XZOA 1QHYA 1XXHA 2PH1A 2Y8EA 4O0MA 2YOHA 3GLFE 4JMPA 5K8UA 2AD5A 1JEDA 1BH2A 3ZVLA 2QG6A 1HQCA 3CH5A 3QBVA 4MGKR 5E3HA 2CJWB 3OEHA 3WY9A 2JLQA 5KSPA 5LD2C 4HB2A 1Z0AA 4JSTA 2JIZA 1NN1A 3BBPA 1NG1A 2CNWD 2R8RA 4DDTA 1XMSA 2I4IA 5P21A 2LKCA 4KITB 3OE7D 4B76A 4JYBA 1KJWA 1KJYA 1I2MA 2VEDA 1XCMA 2KBFA 3OEEA 3VNUA 1J7KA 4Q18A 1TUEA 2AN9A 2ZU0C 2FPKA 2GCOA 3IPXA 4EPYA 3TUZC 3VR3A 2Q3HA 3C5CA 1JNYA 2IF0A 5EP2A 1PLKA 4LJ7A 5LB4A 1NBME 1XMIA 3LBIA 1UPTA 3J81k 1F2TA 2JJ1D 2QN6A 1RKBA 1E32A 5JJKA 5FUXA 4AYXA 3I5XA 2W6ID 2ZI6A 5TB5A 1IN4A 4KYIB 5JS7A 1YHNA 1YQTA 3VTKA 2IWRA 3I4LA 2O8CA 2QQEA 4YMVA 4AIIA 3CH4B 2V6IA 1E2IA 4QBFA 1DAEA 3B1ZA 2V7QD 8OHMA 1PUIA 1WRBA 3V4FA 1D5CA 1HY3A 1VYVA 4P4TA 3FWYA 1KZGB 2WWIA 1Q22A 4JBYA 4Q9KA 4LBVA 4QBIA 4Q5IA 2BIFA 3PQCA 2VHJA 5KPJA 3B1YA 1U8AA 4MKFA 5FBWB 4LI0A 3CKLA 4QFMA 4WXPA 2PLRA 4TYPA 2CE7A 4JLNA 3ZZTA 3ZS9A 2FF7A 2XJ4A 4QRHA 3SE0A 2GJ8A 4RD3A 4RJLA 4OK3A 2JCSA 4HAVA 3I8SA 1G5TA 4BWYA 621PA 4UNRA 1TUIA 4D25A 4A0HA 1FL9A 1WB9A 2R6GA 2PZFA 2FN4A 2G77B 1FMJA 3WP1B 4XWOA 3DMNA 3AF2A 3GCGA 4Q4LA 2VYFA 2H16A 4IRUB 2FFQA 4M1OA 2ZR9A 4YMTA 1R10A 4G5QA 2AXPA 2MMCA 2ZRBA 3KTAA 2PX0A 2IUUA 3WRYC 4Q9JA 3WYFA 4GZLA 2ODBA 4EPVA 4ZDWA 2PBRA 3SJZA 1T0HB 2Z5FA 4HUTA 1AIPA 1N25A 3QPVA 4DLRA 4PR0A 4CEJA 5G3ZA 1OH7A 3A8TA 3FHOA 5AUPB 3EPHA 1L8QA 4XWAA 4AYWA 2XXAB 4IDOA 3KJEA 3QSYA 1UKEA 2ANBA 1OHHA 2G0TA 1P9WA 2ZPTX 2ZROA 3FMPB 1Z07A 4DLUA 4IVPA 2FV8A 4KLZA 4PXAA 1M7BA 1NMXA 3W8RA 4EIWA 3FOZA 5GJBA 5J4YA 4GFDA 2A9KA 1KI6B 4M4SA 5DLQC 2VO1A 1G6OA 4EPTA 1LTQA 4KHZA 4BFZA 1U98A 4Q21A 3ZJYA 2O8FA 4TZ0A 3CF0A 4LY6A 3SU8A 1CJVC 3TW8B 5KDOA 1DEKA 4LV6A 2DYKA 3G0HA 1DPFA 3WMFA 2GZAA 3U6BA 2GVZC 5EE0A 1O3YA 3H2YA 4Z8XA 4I1UA 1JECA 2DCUA 1KDOA 5FL7D 3EA5A 3UWKA 4DDUA 1N5LA 1U90A 2WIAA 1W1WA 4B3DA 4D2IA 1Z5ZA 2F9LA 2QA5A 2VPPA 1OT3A 5H1YA 3N2IA 1BKDR 3ASZA 1SHZA 4IFEA 3RSLA 1D9ZA 3GMTA 2OBLA 2ZI5A 3KJGA 4ZI3A 2GNOA 1COWA 3EIEA 4ASUD 1GP2A 1GKYA 2EYQA 3B82A 3U3KA 2R44A 1JALA 2Z83A 3K0AB 5JEEA 2ZE5A 2OT3B 3QKSB 1QHSA 1W4CA 4TL6A 3SEAA 1V43A 1G8GA 4EJSB 4C7OB 1UJ2A 2GBLA 1P6XA 1SKQA 5FOSA 3U44B 2ZITA 1U81A 3L8YA 1S9HA 4JT2A 3O8CA 1KKMA 1FX0A 2ZRLA 1OYWA 3A1UA 3EC1A 2OBNA 2FSIA 2NZJA 1E3MA 3TUJC 4JKYA 4BE7B 1HE1C 4BFYA 3DKVA 2FFHA 4JJZA 2VP0A 4DZZA 2UVQA 4PX9A 2B92A 3W3AA 4OHXA 5GJCA 1CU1A 2GDJA 3Q7QA 3EZ2A 1WCV1 3VHXA 3H86A 4TTQA 2WZQA 3QXXA 4PC6A 3NBXX 1Q3TA 5E95A 1N3BA 1W44A 3K9LA 2IS4A 1ZRHA 4AYTA 3R8FA 2VHTA 3GEIA 3EZFA 3UANA 3GPLA 5JWRA 1KIMA 1NVXQ 1W5TA 2IC5A 3RRMA 5JLJA 2W00A 5H8WA 2H18A 1ONBA 1XX6A 1G3IA 2N1BA 3AF1A 5EXTA 1G64A 1JR3A 3KFVA 3ONWA 4AG5A 4C2UA 3ICQB 2WKRA 3KXIA 2OCPA 3MAAC 1VPLA 4LX0A 5CIWA 4DLZA 1RRCA 1AA9A 3GJ0A 4RD2A 1CTQA 1YZQA 3AKYA 3K53A 4LK2A 1P62B 2AXNA 4Q48A 4GMXA 4M1SA 2IYZA 1IXSB 4L8GA 3ZQ6A 1NSTA 2F1JA 3AF3A 2ZETA 4PQYA 4DKXA 1HTWA 5C4GB 3P1JA 5L3VA 5G53C 4EPRA 1KY3A 1ZINA 2OXCA 3Q9LA 3S1AA 2TMKA 4LC0A 4HATA 4NYIQ 4LHZA 1Z0KA 1IY2A 2C95A 3H4MA 2ODWA 3AF0A 2QM8A 4I1OA 1K5GA 2CLSA 3P27A 1XTKA 3CO5A 4Q1AA 5EXSA 5AJVB 4CIDA 4EUNA 1R7RA 3VX3A 3M6AA 2I3BA 4U5XA 4Q7LA 4B2IA 2P6RA 3EAQA 1OXSC 3EG5A 1QHNA 1FW6A 3CPHA 4D4JA 1ZYUA 1E9CA 1F6BA 3VMFA 4QJ3A 4TT3D 4ZKDA 2XTNA 4XVUA 3U5ZB 2NO0A 1ZCBA 2CL0X 2RGGA 2GTPA 1GNRA 4MKGA 4LYHA 5IT5A 3GJ7A 5IF9A 1FTSA 4AG6A 3EIHA 1ZUIA 2W0SA 2EU8A 3QF7A 1KJZA 3K9HA 1E2KA 2J0QA 2NG1A 4L5BA 5JECA 2GBLC 3SYLA 1NY6A 4P33A 3T1QA 4D0NA 4BASA 1SVOA 4KYUA 4PFSA 1WE2A 1UEJA 2A7QA 3U61B 1XZPA 4P31A 3BH0A 1P2VA 4K46A 2HF9A 4ILEA 2R2AA 2ZRGA 4KAXA 2JASA 1DG3A 1Q12A 3VR2A 1N0UA 4RD4A 1C9KA 3ND8A 3B7GA 1DAIA 221PA 1TQ2A 4KU4A 3EZ9A 1TU3A 5L8VA 1AKEA 2WJGA 1EG7A 1OYYA 1X6VA 1EK0A 1W7AA 3IEUA 5B30A 3TR0A 2XAUA 4LYJA 2FNAA 1GSIA 3NKVA 4KBGA 3IGFA 4GRAA 3PUVA 3TVTA 1Q57A 2KI5A 4HDCA 4QG7A 2ZE7A 1NN0A 5D3MB 2G6BA 2A2ZA 1SVSA 4IFBA 1E9RA 4IXMA 2PEZA 5FBRB 1DADA 4W5WA 3R8CA 2QE7A 1OKKD 2W2TA 4IOLA 3R7WB 4EFMA 4PC3A 1I4DD 1C4OA 3AVWA 3SQXA 1RIFA 2D7CA 2OCBA 2D4HA 1N6KA 2RMKA 4S2EA 2IYXA 1ODFA 3NVAA 1XEXB 2QROA 1Z28A 1P4SA 1CR1A 2XEXA 5L3QA 4ACBA 3T1VA 4PPQA 4ZDJA 1VHLA 1RE0A 3KKQA 4XVRA 2QORA 1XEFA 5EE1A 5FOTA 2ZI7A 4DIDA 3IBGA 3MRSA 2W58A 3T34A 1Q21A 2EQBA 4Q7MB 2ZSAA 3AVTA 1DE0A 4MUAA 2H7VA 2IA5A 1E6CA 4EQ6A 2VP9A 1XDBA 2IF2A 3TVDA 2XZLA 2WPDD 5HCNA 2QSYA 2H17A 4CEIB 1W4RA 1RC8A 1QHIA 2V55B 4AKHA 1E0KA 5GJVC 3VR4A 4DC9A 5J47A 3F5FA 1E0AA 2QI9C 2C04A 4GZMA 3AV0B 4WZBE 3UWOA 1WMSA 5JBQA 1IBRA 4OL0A 3NXSA 3B8HA 1ZNYA 5DH9A 1ZUHA 3ZIAD 3RS4A 1RFLA 1JAIA 4US2R 2CVFA 1VMAA 1OH8A 2HCBA 2VP4A 2R6CA 4LHXA 3AVYA 3CF2A 3ADBA 4JLKA 5DO9A 5CK5A 3BAFA 4RD0A 2QP9X 2B7CA 5FPSA 3PV0A 4WW0A 4E22A 3G82C 1GL9B 2A30A 3LLUA 3FKSD 4IHQA 2G83A 5EZ6B 4B3CA 1IQPA 2WWGA 4CVNA 1M2OB 5LPNA 2AWOA 1ZNWA 4M9SA 4RZ2A 2J3EA 1N6HA 2UZ3A 1GTVA 1GKUB 2XNSA 4HDOB 5KDDA 1G17A 4Q1FA 4LYFA 1R0XA 4NYIR 4DUGD 1UKYA 2IS6A 3Q3JB 5C18A 4H9GA 4FXPA 3CF6R 2O8EB 5AJXA 4K81B 2FMXA 2IEYA 4NCNA 2ANCA 3ASYA 3B60A 4P3YA 1Q1BA 1P9RA 1JXOA 3AF4A 3R9IA 4UNSA 3B1XA 1CULC 4P4UA 1AJEA 2FFAA 1NJFA 2CK3D 1QZXA 1VYTA 3WYAA 4UXHA 1KO5A 1I4TD 3VFDA 3RABA 2WSSA 4QHYA 2J5XA 3THYA 2RB4A 1KMQA 3GEHA 1MKYA 1WF3A 3IDQA 3GJXC 4M1YA 3THWB 2WWXA 1G8FA 1AM4D 1XCGB 2QP3A 3CZPA 2IHBA 3NBZC 4ACAA 3B9QA 3LQQA 3A37A 5CDFE 3LO5A 2C9CA 4JLAA 2WAXA 2EFDB 2Z0MA 1IXRC 4C0KA 1G41A 4A0GA 1G7SA 3BE4A 4LBWA 3NDPA 3LV8A 2ZYWX 4V0ME 4XJXA 4D0LB 2VRWA 4J0QA 3HPRA 3KUCA 2WWHA 4DLSA 1DTSA 2BBWA 1KK0A 2HLDA 5EZ5A 5FH9A 3RLFA 4BPBA 5EXPA 1BMFD 1ZM9A 2KSQA 1AQYA 1JR3E 2DY1A 1ESNA 2P2LA 2HXSA 2ZJ8A 4WA7A 2NMVA 2JLSA 1DVRA 4GMDA 2YKGA 5CK4A 3RS7A 2X2EA 3WRXC 4PSKA 1KAOA 4U02A 4TL9A 1T3HA 1CLUA 2FA9A 3GLHB 3SC3A 5DYIA 2Z4SA 4PPFA 3WBKA 2RGAA 4NCJA 3MJHA 4PQFA 1CR4A 5CITA 4V02A 1BIFA 5DN6A 3W6OA 4OI2A 5HZKA 2IXEA 5J4VA 3EARA 2O8DA 2FWRA 1G8HA 3B5JA 3HWSA 4PZLA 3BFVA 2GETA 4YMSA 3TAHA 4QGAA 5KSOA 3TE6A 4N0EA 2OHFA 3FB4A 1SKYB 1A2BA 1W0JA 3GFOA 4TLCA 3BK7A 3KUDA 4ARZA 3NC0C 4DT1A 5FOUA 3TH5A 1M7GA 3X1DA 1LS1A 5JJIA 3K70D 4IOMA 1S4QA 4Q9HA 3SNHA 1JJ7A 4MRVA 1RYFA 2OSBA 4IEIA 2HXYA 2GXQA 3QPUA 3CNLA 3UIEA 2CE2X 3KDSE 2ZM5A 4A4DA 2RH5A 3C14C 4HDQB 4UXIA 1U2RA 3K9NA 3OIYA 3OESA 4B3FX 4LWZA 3VKWA 3A1TA 5FBLB 5GVRA 3AVXA 1KO4A 2QPOA 4QM7A 2IS2A 2ZAOA 1XFAA 2QAGA 1OXUA 2ZVQX 4PANA 2O5VA 2VF7A 1II0A 3GLHE 4I99A 4TMTA 4BLOA 2HJGA 4A92A 4DSNA 2GF9A 3QUSA 3CX7A 1GAJA 2XSZA 2ZJAA 3LBHA 2IHYA 1RRPA 1F48A 2BBSA 5HKKD 2JDID 1II9A 1FNNA 4RSGA 3O8RA 1ZM4A 5DGXA 3VX4A 1Z8FA 2JLUA 4GNKA 4JBXA 1P2UA 3NH9A 4UNQA 4K8OA 1E9AA 1D2MA 1XMVA 3A6PC 1G21E 3PEUA 1PLLA 2B6HA 4UKDA 3RWMB 3L0IB 3T15A 1ELOA 2YWGA 3TRFA 2N46A 1MRNA 2F6RA 5IDVA 3GLFB 4FMBB 4ABYA 1GNPA 2OCAA 2E9SA 5LB2A 3TSOA 4Q4HB 1VHTA 3CWQA 3JVUA 1NL3A 1HE8B 5BXQC 4C0QC 1XB2A 1P75A 4JLVA 1NSFA 2XTMA 4LGMA 4RCZA 3TQFA 4TN1A 2XNDD 2MSEB 2J7KA 3PEWA 3U3RA 3MLEA 2MMGA 5DI3B 4JYCA 2O0JA 4YDSA 3W34A 3WHKA 2ZI3A 2GK7A 5JI3E 1XD9A 2IYTA 3AB3A 4EPXA 4ZDKA 4PHGA 2KB0A 1E1QD 4N3NA 1CF4A 3OAAD 4KCGA 3LH5A 5GJWC 4DWJA 1SVIA 2GF0A 3SR0A 5TDHA 3TQCA 1W0KD 3EPKA 1TU4A 2PZEA 1KDPA 2WOOA 2CHQA 4LHVA 2XXAA 4NYMQ 2BC9A 3KQHA 2P3SA 4W7SA 4BRWA 1OFTA 2QMOA 4A82A 3IEVA 1E2JA 3CR8A 1EFRA 1JBKA 3W6NA 2OG2A 4D6PA 1MO6A 4AI6A 1S3GA 1OFHA 2J59A 4QC2A 2VSXA 4Q4AA 1XWIA 2F7SA 4LJ5A 3B9PA 4TWZA 3K0CA 3AGQA 4JLMA 4A8JB 1MO5A 3CX8A 5FUVA 1OIVA 2H8KA 5JCPA 1KY2A 4HSEA 3OEHD 4C4PA 4P32A 1G8YA 4ZDIA 2VLIA 1T6NA 2YOGA 2JIZD 2QAGC 1RW4A 4Q66C 4B35A 2VSFA 4A0RA 4ERNA 2E87A 4TLBA 4C0LA 2QM7A 3U3MA 4B48A 2ODNA 3M1IA 4UQOA 4UXJA 3T06B 4O3MA 1S1CA 2X2FA 1NVVQ 3BB4A 2GILA 3CNNA 5H68A 2F9MA 1KMHA 1H8EA 1W2GA 1UBEA 4F92B 4HB0A 2W2XA 1CRPA 1FQJA 5JSZB 4WBSA 2Q3FA 4BLPA 4FINA 4R2HA 1KNXA 4F4JA 3MD0A 2BWJA 2B8WA 4C7OA 2X8AA 3DM5A 3I1FA 2F1IA 4TLEA 4D4KA 3LQRA 4OHYA 1KI1A 3V9PA 5KYKA 2NOAA 4PHFA 1CJUC 4P4SA 1IM2A 1AK2A 4Q9IA 2QY9A 2ZYVX 2ZVPX 2IT1A 1UKVY 4JVSB 1II8A 1NNEA 1MO3A 1HT2E 4HLUA 5EE5B 1CIPA 1PVOA 2V8OA 2BEJA 3UPUA 1MT0A 4CW7A 1W48A 2RKOA 4PPGA 4Q47A 2I1QA 5KSZA 4Q4JA 3SJCA 2AR7A 2QEQA 1LY1A 1KK3A 4HZUB 1S8FA 1E0SA 5FUYA 3KQNA 1E2NA 1RJ9A 1GOTA 2VH5R 3R9XA 3O8BA 3C7KA 3U4QA 4Q1DA 1P3JA 3T61A 4WIAA 4NU0A 4XSGA 4BUJA 3LDAA 3QI2A 3RRZA 3GLGB 2IYWA 3T35A 5HCIA 4OQFA 2DPXA 5FI1B 2CNWA 4WZAE 1RRFA 2BCGY 4B47A 1ZW6A 3ADCA 3CWZA 3F0TA 3NC1C 2OFWA 4JVLA 3KL4A 3E2IA 4RZXA 4OKSA 5G40A 4KFUA 4OJKA 5EXXA 3WNDA 1JPNA 3KQUA 1CP2A 4QKQA 3GJ6A 4UJ5A 3AQ4A 3K70B 2AK2A 4OBEA 4F93B 1A82A 1E79A 1XNJA 4DSUA 5GVSA 4PSVA 3K0CC 3TK1A 4POAA 4L9SA 4G5SA 1AS2A 2ZRKA 3KKMA 1SQ5A 4EFNA 4B71A 2JJ1A 1IAQA 1G19A 3BORA 3B1WA 3BXZA 1I2DA 2NZ8A 2YVUA 2OILA 521PA 2ZXUA 1GIAA 4KXFB 3SBEA 1UADA 5LD2B 4FMCB 4DDWA 1IN6A 2ZYUX 1ZD9A 4Y0VA 1G7CA 3MWJA 4BRUA 4PZYA 1F2UB 4KSCA 3BH7A 1N0VC 2V7QA 2FE4A 3ZD7A 4CEHA 1OHHD 4G5GA 5FFMA 3FPAA 1FNMA 2WWFA 4M1KA 4UNPA 5IK2A 2F55A 4FIDA 3ZLJA 3N5CA 3GD7A 1DBSA 2IXGA 1B0UA 4ZKEA 3THXB 2DB3A 3LW8A 4HUQA 5J40A 2F43A 4PQRA 3AKEA 3U7EB 1GDDA 4DLYA 3IQXA 1G6HA 2FEOA 3MGCA 3QIAA 4R9UC 5JRJA 3AEZA 2VHCA 4RFSA 5JZVA 3GLGE 5FTJA 5G41A 5IHPA 5KU1A 4NYMR 2IYYA 3BIFA 1Z29A 1ZU5A 1G18A 3TSWA 1XPUA 4HAWA 4HLUC 3GLIB 3T1TA 1FUKA 1NMZA 2WWWA 4ZI2A 2JJ2A 2ZSFA 4FMDF 2ZUCA 2REXB 4D0GA 2GKSA 3CRMA 1CJTC 1U0JA 3D31A 5LBIA 1NVWQ 4IOJA 4JKIA 2OEPA 3D6TB 4GOJA 4TMZA 3PIRA 4URXR 4GOKA 1COWD 1QHHB 3LRPA 1C1YA 1VIYA 1XTSA 2A5DA 4QBGB 3C4JA 4M9ZA 2FSFA 1ESMA 1YR9A 1IY0A 4G5RA 3DM9B 1R0YA 4BFSA 1AN0A 1QG2A 1FP6A 3LVQE 2QTHA 3RC8A 4M8NE 1G3QA 3ECCA 4PO1A 3MWKA 3CW2A 1W36C 5F2EA 3W5IA 3VAAA 1NVVR 1Y63A 1IJEA 1NIPA 2C8VA 2VSOA 2YINC 4QHSA 4DB2A 1L7VC 4AKGA 4NMMA 4L16A 1XD2B 1JJVA 1JI0A 3OHMA 3RANA 4TSFA 3WNCA 1Q1QA 2AFHE 3ZVNA 1XEXA 1XXHB 4OI0A 1MO4A 2WJJA 1UAAA 4MDFA 1ZP6A 2OAQ1 2DFKB 2WM9B 2BJWA 2IXFA 2R6AA 3K0FA 4US1R 1YRBA 5F9FA 1XCPA 3HR8A 4NCKA 2QGZA 4W5JA 1NP6A 3GFTA 3U60B 4IDPA 4NONA 5GADl 2GA8A 4LHWA 4E09A 3GLIE 1IN7A 4Q00A 5FOVA 1JR3D 5BN4A 3TMKA 1M1YE 3QEJA 1K5DA 3TW4A 4I4LA 2AKYA 3TGPA 4NH0A 4NYJQ 1KDRA 4LDJA 1UDXA 2R6FA 1BOFA 5CIQA 1ZCAA 3L8ZA 2G0NA 3X1XA 1DO0A 2IYQA 4GOXA 3MUFA 2GCOB 3HDTA 4N0DA 1A2KC 1E0JA 3Q72A 4G3XA 5AJWA 1Q0UA 2O0HA 3CNOA 1LW7A 1BS1A 4TTRA 4E07A 1NIJA 3REGA 5L3SA 4DHEA 1DAGA 2OFXA 1R5BA 1KKLA 1N6IA 3ZZ0A 4OJQA 2BM0A 5F3WB 2QGNA 2A3RA 2O8CB 4FI3C 4FW9A 1M6NA 4EKDA 2HYIC 1D6JA 2QL6A 2J46A 4BGDA 3EZ6A 1AGRA 4NTZA 3U6KA 4HEJA 3EWSA 4OQMA 1HUQA 121PA 1E2MA 2UZIR 4RZUA 5H70A 2ZUDA 1TEXA 1XXHE 5CM9C 2ZJ5A 1YZKA 3VKHA 3PUZA 4H1VA 1NI3A 3LWNA 4C0SA 2AHOA 2VP6A 2DWOA 1Z22A 1XU4A 2Q9AA 2OESA 1FP7A 4U00A 5JRZA 3LBNA 5D3QA 1OSNA 2R65A 4C30A 5L3RA 4HLQB 3KKNA 2ZUBA 3QOFA 5J5CA 4ZCIA 3SBDA 5F98A 1GVNB 3QKUA 4ON9A 5EUQB 1JAHA 4C3ZA 2E1RA 1T3SA 1W5SA 1R6BX 2VP2A 3DZDA 4QXAA 2ZJOA 2W2VA 4IW3B 3L0OA 1Y3AA 2J45A 2XX3A 2GCPA 1N6PA 4B33A 2YOFA 3HU1A 3WNBA 4FWTA 3E70C 2ERYA 1AGPA 3UMSA 5KPDA 1X86B 2EVWX 4M9XA 2GXSA 3OF5A 1LNZA 3RDPA 4HZIA 4ZO4A 5J4KA 1P9NA 2QBYB 2Q9CA 1U0HC 2RCNA 2IWHA 3KTAB 3LFUA 5K8IA 3M0EA 2ONJA 3SQWA 3LAWA 4DCUA 2P5SA 721PA 1Z2CA 1EFTA 2ZI9A 1YE8A 3I32A 4X8MA 4DJTA 2QP4A 2DFTA 2ZEJA 4CEJB 4FCVA 1D9XA 3BC1A 4ITRC 4M1TA 3PUXA 3P20A 4D82A 1OJLA 2QQ0A 4L9WA 5JJLA 3ZDQA 3OIUA 2QE7D 2IX3A 1U9IA 4DT1B 1MABA 3SN6A 1E96A 2DBYA 4V0LA 3L43A 2PZGA 1EGAA 3LX8A 4CDGA 2O8FB 2VTKA 3KKPA 4BEBA 4PC1A 1OFUX 2Q0HA 4WOPA 4Z1MD 4LRWA 3P4YA 5EE3A 2O8BA 1E98A 1E9SA 3P32A 3GJ5A 1CRQA 2GCNA 1Z6XA 1XTJA 4IVQA 4NP6A 5KTYA 3QBTA 4DSOA 2FPMA 3JZMA 3RHFA 4EAQA 4QM6A 4Q7JB 2RHDA 1X1SA 1RPZA 4LYAA 1OB2A 2WHXA 2F3RA 1ZC3A 2JEOA 1S3SA 2QTFA 3C41J 4DDVA 2VIIA 2YC2C 5TY0A 2ORIA 1X8KA 4A36A 4A1FA 4URZR 5IRCD 4BLQA 3QKRA 3NHBA 4URVR 3T12A 2WICA 4LJ6A 4O2LA 2AX4A 1E4YA 1SXJA 2NIPA 2ZJBA 2CBZA 3GFPA 4L4UA 1YR6A 4G1UC 4TQAA 2J7PA 2ECKA 1E9BA 1Q3HA 3KX2A 4NHOA 4LCBA 3BD9A 5AUQA 2FG5A 1GRRA 1M74A 5FR2A 2RGXA 2OXRA 4MRPA 4PSAA 3C5HA 1FX0B 4MRRA 4D26A 2D06A 2R6DA 4NYJR 5FUWA 5KDLA 1QHGA 3QF4A 5FTNA 2EWVA 1Z08A 1VECA 4BECA 4CGZA 1TQ4A 4ZIRB 2PCLA 3NH6A 2YZ2A 2BOVA 1P5ZB 5HE9A 2D74A 3L0SA 3JZAA 3H84A 5CLQA 4XH9B 4IDQA 3TLXA 4AC9A 1UEIA 1UM8A 2YWHA 2FSGA 3QVUA 3CONA 3LX5A 5HE8A 4HAZA 2QSZA 4DRZA 2ZS8A 1KO8A 3Q85A 1ZC4A 5BYKA 2X1VA 1E2EA 4TZ6A 4RD1A 3W3ZB 1GWNA 3TIFA 1K6MA 1U9IC 2WSSD 3C15C 2CLDX 1EWQA 4MYTA 1EFUA 3X1YA 2BMEA 3FFAA 1ZU4A 3AM1A 4ZCMA 4GDFA 4Q4HA 2CHGA 2AK3A 4BQSA 1FOEB 3S1AB 1P7CA 5J4HA 1P2TA 1GRQA 2REOA 3EA0A 1FMLA 3CPEA 1US8A 3Q8XB 2FGJA 1TQDA 3RSOA 1SVWA 2BMJA 1I4LD 3ETLA 3U7FB 4A6PA 4YLGA 1E2PA 1IY1A 2HLDD 5E7IA 3OFNA 3OZXA 1MR3F 3KKOA 2VL7A 1P60A 1GL7A 2P5TB 4YC7A 4QNRA 3UG6A 3FTQA 1SXJC 1JPJA 4QGFA 1U0LA 1WXQA 1HH4A 2FZLA 3W90A 3NG1A 2CDNA 2ZSBA 5DI9A 3RS3A 1NBMA 4BFVA 1LVGA 2CCJA 5TVKA 2EFHB 5DN6D 1T9HA 3RS0A 4B44A 4M2LA 4NKRA 2P6NA 5DYGA 1XZQA 1NMYA 4F91B 2CK3A 1E99A 4MDEA 1AZTA 3BB1A 1VTKA 2EFGA 2J0UA 4GPTA 3SJAA 3VU9A 4JJKA 1KI2A 3HPQA 3THOA 1CBUA 4IKEA 1X8JA 1GRNA 2GJ9A 3TSZA 2NQ2C 4MUBA 1ZM7A 1W0JD 4OQNA 2DR3A 2G1KA 1U94A 1WDTA 4W9MC 4NPHA 4YXWA 1PV4A 4BFWA 1QVRA 4MA4A 2HCJB 2CJWA 3MG9A 5FPHA 3ZVRA 1HQYE 3AH8A 1T3LA 4MGZR 2PJRA 1B23P 3KFXA 3RVBA 3RC3A 1OF1A 1YZUA 5HTKA 2RGNA 4I1VA 3HR7A 2D62A 1G16A 3NBYC 4M1WA 1FUUA 4LZZA 4TQ9A 1T0JB 1CXZA 1VYUA 1DOAA 2YWFA 5FTLA 4QJ5A 2IUTA 4PO8A 1WBDA 4YONB 2ZRIA 1PZNA 4NE2A 5FOWA 3CRRA 4C2TA 5KUTA 3L2OB 1SULA 2QTVB 1AS3A 3F8TA 3FMOB 1TF7A 3VR5A 5L3QB 4LC1A 3CZQA 1H8HA 3AUYA 3QVVA 2JLRA 3DKPA 5CJ2A 3JVVA 2XSZD 1G9XA 3AUXA 4C0BA 2PT5A 2D3WA 2OUKA 1XPOA 3NEYA 1P72A 3A1VA 2WSMA 4LPKA 3B2EA 4C0AC 4Q03A 4EQ6B 4JLDA 3AVVA 2V9PA 5DHFA 3UXMA 4GI7A 4BLTA 2UKDA 4TYYA 4FD2A 1GILA 3PUYA 1FFHA 1XEWX 2AD1A 2CHVA 4HB3A 1G1MA 2WIBA 5BN3A 4Q1CA 3PEYA 4LV8B 2F1RA 1TF5A 1RZ3A 2J41A 4E5UA 2J9RA 4TMKA 2BBOA 1E2GA 2BEKA 1DELA 1R8QA 2CMKA 4MRNA 1RYHA 3ZZUA 2RGCA 4AWXA 4LOAA 1YZGA 2BJVA 4RCYA 3EWAA 5JWHA 2KBEA 3CUEF 1FZQA 1JXMA 1S2MA 2IYVA 3W6PA 1HA3A 3C8UA 1G8PA 1KI9A 1QG4A 1WA5A 3W5JA 4ZV4A 2VQSA 3K8YA 2W83A 2SHKA 4NZYA 1G291 5AR1A 1Q20A 2V6JA 2ZRMA 5B64A 2C98A 1G4UR 2XOKA 2B7BA 2HUPA 3D7MA 1DAMA 1S1MA 2QPTA 1NG9A 3ICEA 2JA1A 3N2EA 1FQKA 1OIWA 3CX6A 1YVDA 3ZQJA 2MSCB 2C78A 3AP2A 2WBLC 1EFRD 4MKHA 2C77A 4Q01A 3NTUA 4D80A 1E1RA 2FU5C 1T5IA 2OV2A 4LBYA 5TARA 1KSGA 1EWRA 2CL6X 5KNBA 4XD7A 2RGNC 2W6JA 3FHCB 2PMDA 3DHWC 2PLFA 1KAGA 4DB4A 2ZJYA 4KVAA 4EDHA 4KODA 4OK5A 2ZI4A 5BQ5A 1P2SA 2C9OA 3THYB 1XP8A 1UBFA 1KI6A 3DZ8A 4ESHA 1XJCA 2ZREA 4I81A 1MOZA 1OXXK 2W0MA 2WJVA 1J90A 2NO9A 1ETUA 4Q02A 1CR2A 4IEEA 4URUR 4Q1BA 1ZM3A 5JHHB 3QQ5A 5EE9A 3MWLA 3TUIC 1R0ZA 3X2SA 4JL6A 2C96A 1L4UA 1KDTA 1OB5A 3BS4A 3SFZA 2OLJA 1H8ED 2IL1A 2NPIA 3K0EA 3TJZA 2GWHA 2REBA 3PUWA 1CKEA 4QOSA 3OIWA 5FR1A 3I61A 2VP5A 3WBJA 2NTYC 1QHXA 2O0KA 5SZIA 5KNCA 2Z6VA 3UMRA 3O47A 3OAAA 1O87A 4QHTA 1TMKA 4X8LA 2ZR7A 1OH6A 4V0OA 2QRNA 1QBKC 3F3YA 4PZZA 3L82B 2ZU6A 3GJ8A 5DSZA 3GP8A 1GM5A 3OEED 1IOZA 4D4MA 1G3RA 3EPJA 3K0AA 4TYQA 3QKSA 3IO3A 5FPTA 2VF8A 4XTRA 1FTNA 1LV7A 4CT5A 3EX7C 4HB4A 1OW3B 4EJSA 1Z3IX 5SZKB 1XD8A 3K1JA 1VCOA 2QT1A 4B43A 1N5IA 4RKEA 1E2LA 3ADDA 2FOLA 1IJFA 3U44A 4EFLA 4OQLA 4W5HA 4B2PA 3B13B 3QXHA 1HV8A 2H1LA 3VR1A 2RAPA 5K8LA 5FBVB 2O8DB 1EX7A 2JLWA 3ADKA 2ZS9A 3FVQA 3HU3A 1ZJ6A 2GEUA 4TL8A 1TF2A 3I73A 3OIVA 1ZM2A 1CEEA 1D8TA 1M7HA 2P6UA 3P4XA 5BN5A 1UBCA 2ZSEA 3I8XA 3AVQA 4XSHA 1W36D 2V1XA 2GVDC 4ARZB 3H0KA 4KFRA 1JR6A 1P73A 3BH6A 1GKIA 3FFBA 1VG1A 1ZD8A 3BRWD 4C9BA 5FTKA 2EYUA 2QUZA 2GJAA 5B57C 5EJEA 1E79D 3PG5A 4R2IA 2D2FA 2WV9A 3KZ1E 4UJ3A 2EWWA 1KI7A 2A5GA 4DEYA 1Z83A 1G5PA 4ZCLA 3OE7A 4ESVA 4V0NA 3AVPA 3E1SA 4KSBA 2HDNB 2YV5A 2HT6A 1WP9A 1KHTA 2H5EA 3CRVA 4LHYA 2HJVA 2XJ9A 2C03A 1TADA 2P65A 3VNVA 5JHGB 2FJUA 4DVGA 5A4JA 1DARA 2KE5A 2QAGB 2ZQ5A 4PAMA 2V3CC 4R7ZA 1DG1G 2ZRNA 2WJYA 1LF0A 3Q5DA 2BBTA 1PUJA 1XJ0A 5DHAA 3U7GA 2QU8A 4LUCA 4GP7A 1F5NA 3ZH9B 5IK2D 2OFOA 3HYRA 5CB8A 5K8TA 1RRGA 2W6IA 3A36A 4E03A 1Z47A 2D7DA 1N6NA 1X3SA 1G7RA 4TMVA 1A1VA 3DL0A 5KSYA 3QKTA 2KWIA 4PC7A 4BFUA 3MFYA 3L0PA 1QVAA 2BMFA 2J87A 1UDWA 5UKDA 4C0JA 3BFKA 2BCJQ 3WMGA 2QNRA 1EFHA 1XJQA 2ZYTX 3CB4A 4B2LA 4OYHA 2JLXA 3HJNA 1TX4B 3NWJA 2F3TA 4M9QA 1NN3A 4JLJA 3IPYA 2ZR0A 1TNDA 2BV3A 2OBMA 2JJ2D 1TAGA 3K09A 3LLMA 3PR1A 1G4AE 2ZJ2A 4EJSC 3UMFA 4US0R 2AKAB 1XBTA 3B6EA 2OCYC 1CR0A 4S35A 2H57A 2XB4A 5J4LA 4N1AA 4PPNA 5B2ZA 2QBYA 2IYSA 5E7MA 2L0XA 4BZPA 3V4RA 4HLDA 1N0WA 2ERXA 5G3YA 3EPLA 4Z54A 4M1MA 3QXCA 6Q21A 1YKSA 2BVNA 1KO7A 3KJHA 1DAKA 1E2DA 3KXLA 4AK9A 4A2WA 3PJRA 1E94E 1U8YA 2JATA 2PL3A 2GHIA 3IUYA 1UFQA 4HYYA 1SHKA 3W9YA 1A7JA 3P26A 2GK6A 3RWOA 4B73A 3FHTA 821PA 3V00A 1EXMA 3BJIC 2C5LA 1IHUA 2ATVA 1Z6YA 2ZRFA 4KLNA 4AURA 2HYDA 3BOSA 3NHAA 4WXRA 4TSFD 2B8TA 3G5UA 4Q4AB 5D3MA 1UF9A 2FEMA 3AVOA 3U2QA 2C9YA 4BFTA 4HI0E 2FH5B 4Z8YA 4LV5B 2V4ZA 5CYOA 5AJZA 5TXGA 4JL8A 3R7WA 2ODEA 1R2QA 1KYIA 3HU2A 3SI7A 3TBKA 1DAHA 5JCZA 1Z0FA 2AWNA 4GSYA 2ZE8A 1R5NA 2V54A 3QPWA 4MRSA 3B85A 1L4YA 4OHWA 1WQ1R 4PC2A 2NO6A 2GZDA 2O52A 3NEJA 1KI8A 1ZNXA 3CRQA 3K9GA 1W47A 4GT1A 1W49A 1ZNZA 1KMHB 3R9WA 4DCTA 5FL7A 5A5GA 3EIQA 4MGYR 4U7DA 2DWPA 2X77A 4DLTA 2ZRPA 4AKIA 4OI4A 2YHSA 1G3MA 1S0UA 4RY2A 2NPFA 4CEIA 1EESA 3AGPA 1ZMXA 2ZRJA 4H1UA 3W8NA 5KO2A 4O25A 3AKCA 4JLOA 1T8UA 4P4SB 2N42A 1MV5A 1NY5A 1E2FA 1OXVA 1ZBDA 2OE2A 2ZIAA 5EP4A 4ASUA 4II7A 4FWIB 4B3BA 1II8B 1VCMA 1JQJC 4DCVA 2Q9BA 4G01B 4URWR 3K09C 4X8HA 3RRYA 1OIXA 2IYLD 3IIMA 1GITA 4ZIRA 2J0SA 4ZPXA 2VHUA 4PHTA 3GEEA 1G3UA 1J2JA 5CDFA 5SZJA 2ASEA 4BLRA 4Q4JB 5EQTA 1F2TB 5FI0B 4A15A 3BERA 4NCHA 2ZJZA 1LS6A 2GAAA 2GZHA 1MH1A 3NIBA 4V0MA 3BB3A 1RJ9B 2ORWA 3ND9A 3FE2A 3U4QB 3SOPA 4YDHB 2PT7A 4Q1EA 4A2PA 2ATXA 5SZHB 1E4VA 1W36B 1IN5A 2YYZA 4FN5A 1UBGA 2Q21A 1YR7A 2YNMA 1E2QA 2QMEA 3BFXA 3RYTC 2O8EA 1YJ5A 2FSHA 5F9HA 4AKEA 4DLWA 2AL7A 2NGRA 1OV4A 4IOKA 2ZSDA 5M04A 2PX3A 2XZPA 3MWYW 4BZXA 3ZGXA 4KFTA 1E9DA 4YMWA 4Z51A 1OPXA 1HT1E 1NLFA 3FMFA 1IN8A 1QDEA 3KJIA 5KNDA 1N5KA 1XTQA 4LJ8A 3GQBA 2OM2A 1SVMA 5KOYA 2VA8A 1KK1A 421PA 1XRJA 1R8SA 3FMIA 4XWKA 4GP6A 3DPUA 5HPYB 4RD6A 3VR6A 3O8DA 5BW8A 2QMHA 2C2HA 4QGGA 5KHOC 3GJ3A 4WZ6A 3THWA 2IK8A 3CBQA 5JEDA 2PJZA 3IBYA 3DMDA 1HURA 1NLYA 3T5GA 3CR7A 4CEHB 1E69A 3T1OA 1JEEA 5C1BA 2CCKA 1YU9A 4DLXA 1LFDB 3MJRA 1KO1A 4MYCA 1ZD1A 4MYUA 3LD9A 5CLLA 3VKGA 2GEVA 5BYJA 3ZD6A 1CJKC 4HUQB 2F43B 4NBSA 1XEWY 4D4LA 1KI3A 5DNYB 4D81A 1LF5A 1K8RA 2GESA 5B58C 2HT1A 2OAP1 1Z06A 2VBCA 4JZKA 4RFSB 3AP1A 4TT3A 3HYTA 3K0SA 1TTTA 2ZE6A 4CF7A 4CRWB 2JAQA 2GJKA 2QZ4A 4AY2A 3C16C 3UK6A 5E4FA 1KK2A 4RVCA 2WKQA 3SDZA 1LB1B 3I72A 2CCGA 2RGDA 3SYNA 2ZS7A 3GLHA 2B21A 2QMUA 2FX3A 2BMDA 4Q19A 4LPSA 3DEFA 1T91A 2EFCB 4F38A 5AJYA 2ZRAA 2WTUA 1SXJD 4TTPA 5CB6A 1OH5A 3DO6A 2FDCA 1VG8A 4IJMA 2J7PD 2G3YA 3VQTA 2DWQA 2PEYA 4A0FA 1HEIA 1XF9A 1NKSA 3IQWA 4DCSA 1T4GA 1TEVA 1DO2A 1L2TA 1VCIA 3QENA 4B3XA 2GXUA 2PMKA 3TR5A 5CJPA 3TAUA 2ZRCA 4QBHA 3REFA 4TQUS 1Z6AA 4JIMA 5BWMA 3UKDA 3T5DA 2QRZA 2ZRDA 4OQXA 5FPYA 1W2HA 5ANRB 3SS8A 1NKTA 2IYRA 5EP1A 1IONA 3KB2A 3AVUA 1ZUNB 1Q44A 3LY5A 3IIKA 3QY0A 4Z1MA 1W4AA 1E2HA 4M0LA 4B3GA 3A4MA 4JS0A 3EC2A 3ZS8A 3AKDA 5CM8B 1SGWA 1D2NA 1W4BA 3EXAA 3N70A 3IILA 3K0FB 1OKKA 1Z63A 4HAYA 4DXAA 5FTMA 4HAXA 2DHRA 1P61B 1CJMA 1X8LA 2G1JA 3UATA 5JWOA 2GXAA 1VKJA 4IXNA 2F1HA 3R20A 1GL6A 1Z0JA 3CM0A 4XVQA 4QL3A 5FPKA 1ZIPA 1JB1A 1SZPA 2LKDA 2X19A 2BDTA 5CYPA 2WVJA 2WKPA 3SHWA 1YRAA 2QPAA 3Q7PA 4RKFA 5FL3A 1T8TA 1OFIA 3A4LA 4JT4A 4GBMA 3QEOA 4B75A 3CLVA 4PAOA 3MCAA 3I5YA 3LVRE 4IVRA 2JJ8A 4FMCF 4JBWA 1YZTA 1KSFX 3VHLB 2K5UA 3PFIA 2WPDA 3PXGA 5L3SB 1NVUQ 1SVLA 1YZLA 2GAOA 4V0KA 3U3JA 1DS6A 2DFLA 1KGDA 3SFVA 1YR8A 1ZAKA 3MSXA 5DE3A 1U99A 1D2EA 2YC4C 4B32A 1Z6GA 4LJYA 4TYNA 2DFNA 3GLFA 4PO9A 1M34E 4LJAA 2G9NA 1G7TA 4MGIR 3LXRA 4I1SA 1KSHA 3WXMA 3RRNA 1RVDA 2FPLA 3OFND 5AUNB 1KOFA 3ZIAA 5TMPA 4G0NA 5DI3A 3UG7A 2LCFA 2I1VB 2IUSA 3WMEA 2NO7A 4TL7A 1KZ7B 5EUMA 4PTLA 4NCIA 3SHFA 4F7WA 1NBMD 3FKSA 4B34A 4YQFA 1EFCA 5TV2A 3IHWA 3A58B 1V5WA 4FCWA 2BM1A 3DOFA 2YJTD 4QNMA 2JLZA 5ELXA 3IO5A 2BKEA 1GFIA 4DUGA 3A4NA 2A5FA 1BO6A 1MRSA 1PLJA 1XTRA 2RHMA 2CVHA 3B78A 2LWIA 4L15A 2NO1A 3A1WA 1F3OA 3FKQA 4DEXA 2CEAA 1BYUA 3PEVA 4MH0R 4YXWD 1AS0A 4NDZA 4A8JA 1Q1EA 2JLYA 1S9DA 2XGJA 1Z0IA 2GJSA 1GG2A 2C99A 4LJ4A 1ANKA 3WYGA 3SZRA 3FGNA 2BKUA 4KI0A 3ZVMA 5HZHA 1U8ZA 3BWDD 4PHHA 4GL2A 1NF3A 3LXXA 5EP3A 3GJ4A 4B74A 2RGEA 1Z6TA 4KJZA 4XTCS 2G88A 5FBQB 4F4CA 2GRJA 2ZRHA 2AFIE 4CYMA 3QG5A 4TMXA 1NJGA 3TKLA 1AZSC 1MABB 1R4AA 2KJQA 5JSZA 4EPWA 1VG9B 1OXTA 4OHZA 4FMDB 1IXZA 1XTIA 3Q5EA 4LJ9A 2P67A 5JS8A 3KQLA 2HF8A 1EX6A 2O8BB 5JI2E 3E5HA 1H8HD 1BMFA 2J1LA 2YWEA 1PJRA 4R71A 2H92A 1VDZA 2IYUA 5C46F 3A1SA 3I3SR 3QXSA 1Q1ZA 3PCRB 4JVNA 1R5OA 4MYHA 2HV8A 3DDCA 2PCJA 5AWFC 4Q9LA 2IS1A 1VIAA 3EW9A 1G5RA 5C4MA 3FYHA 1ZVQA 1AQUA 2IEZA 2WJHA 2OO7A 4QJ4A 2EFEB 3KB1A 3D3QA 3LA6A 4MITA 3NBFA 4HLCA 4HAUA 4PAQA 4NL4H 2WMNB 2ONKA 4HZUA 2A5JA 3QKRB 5AUOB 2XB2A 3I62A 2Q3MA 4KV9A 3X1WA 1SXJB 1TPZA 4P0TA 3HP1A 5A0FA 1QRAA 1NRJB 2Z43A 4M21A 2FFBA 2WOJA 1WBBA 4FCTA 4RZ3A 1Z2AA 4MQBA 3GLGA 2A5YB 2R62A 4KO8A 3SJBA 1VCNA 3ZYCA 4CZ2A 2WWYA 1G20E 3CIOA 4OHVA 1J70A 3LW7A 2OZEA 1NN5A 4C0HA 4WVFA 1OE0A 2WAYA 2QAJA 1DAFA 3QF4B 3U3OA 3X1ZA 1XMJA 2A78A 1W46A 3IHLA 4OK6A 4QGHA 5HR5A 4TMWA 1F60A 1H65A 2ZANA 1KI4A 4OI1A 3SYKA 4YMUA 4V03A 4TLDA 2XOKD 3QXJA 4BLSA 2D2EA 3IIJA 4A8JC 4BFXA 1E9FA 1GZSA 2CXXA 2QENA 2CLCX 5DISB 5C2JB 3EZ7A 3KQKA 4F4IA 1NLZA 1AKYA 4KBFA 4M53A 4A2QA 1KTVA 4BEJA 1OLOA 5FOXA 1VG0B 1E1RD 3WP0A 2J0VA 4CT4B 4MKIA 3QNUA 1N2CE 2FZ4A 2BHRA 1N6OA 2W6JD 3PVSA 4XD7D 3KXKA 4RFVA 2GEDA 5DIFA 1SVKA 2V1UA 1F2UA 2VHQA 2HEIA 4O2RA 4URYR 3RNLA 1YZNA 1SKYE 4JSYA 3LNCA 4Q7KA 1KSJA 2FGKA 3IKJA 4WAUA 2WJIA 4AD8A 3THXA 1TQ6A 1N6RA 2EW1A 2Z4RA 4IDNA 4R98A 4XIGS 1SXJE 1HYQA 3CPJB 4JLPA 4Y0AA 1A5TA 5HKKA 1Z0DA 4DBLC 3D8BA 2JDIA 4JL5A 4XOIA 1M8PA 3RS5A 4DIEA 1J8YF 1BYIA 3MMPA 3QG1A 3PITA 4JLBA 1XPRA 3EASA 2ZTSA 1US8B 1KNQA 1GNQA 4KVGA 4DCNA 1FPMA 3GLIA 2Q6TA 2QT0A 3QE0A 1X1RA
chains in the Genus database with same CATH superfamily
2VASA 1JXAA 3JALB 1S96A 2XNDA 3K5IA 3AHJA 1T35A 2EBIA 3W0LB 3BGWA 1P1HA 1Z5PA 2QVOA 1J99A 3FUUA 3P0JA 2CLOB 3KM0A 1E5DA 1I80A 1N5JA 5K5QA 3ROMA 1WUKS 4B6FA 2YOHA 1ISRA 3I5MA 1SQGA 2BHLA 5D85A 5DVZA 3WRYA 1CT9A 3WY9A 5LD2C 3QLJA 2R1UA 3SIPA 4YAUA 2PSFA 3NPAA 5JRDS 4WERA 1HW2A 2VDRB 2GT1A 2CNKA 3UJCA 4EY3A 1T10A 3EF1A 3LIPA 4FD3A 3FFXA 4RGBA 4CXMA 4I55A 2IHVA 5FUXA 5MF6A 5NLLA 1YS9A 3B6JA 2O8CA 4YMVA 3WGGA 3ZJ5A 2QD1A 4ZVLA 3IH4A 1N57A 2PH5A 2VIXA 2PUFA 3V4FA 4JBYA 1KOLA 3DCJA 2CNDA 1VPWA 4ESOA 3BXGA 4GD3Q 4WY2A 4WXPA 3ZY6A 4B0PA 1H66A 4HAVA 4BNDB 4DY4A 1HSTA 3AF2A 4C2AA 4Q4LA 3L46A 3VZQA 4YCSA 5TQ0B 2IUUA 4UVIA 2FHPA 3VZDA 1YVRA 1NG6A 4ZDWA 4L8VA 4XWTA 3R3VA 3Q1KA 3FHOA 5AUPB 1HE5A 3RPEA 4AYWA 2ANBA 4IVPA 5K01A 2ZROA 4HS4A 1B14A 3QFFA 4OFZA 4NU5A 2A9KA 1LTQA 2ZDGA 4HDKB 3CF0A 1GCOA 4UTNA 1NXOA 4BJHB 3WMFA 4OOFA 1A8PA 3UWKA 1KDOA 3V3KA 3CZAA 4E3ZA 4AIHA 3HVUA 4IS3A 3N3AC 3AIIA 1HQKA 1IEWA 4BVJA 2ATCA 1QQTA 3V8QA 1V0JA 4XLFA 4TL6A 1FYDA 1HKHA 1FBSA 1P6XA 1K63A 3HA3A 2O8XA 1XTUA 2R86A 3KG2A 1PV1A 2EBFX 2OORA 4JKYA 1NVDA 2KPMA 1VE7A 4V3BA 4DLKA 1W6UA 2WZQA 1O5TA 4K2HA 4UPDA 2V03A 1HOXA 3VVBA 3OC6A 4HWSA 1WMBA 3O31A 4RMHA 3WL6A 1HDGO 1VPLA 3GJ0A 9ATCA 1UPAA 4N5MA 3E5XA 3VJRA 4RB0A 4PQYA 3N7TA 4EARA 3AJEA 3FTPA 3CVXA 3PNPA 4Q6WA 1ZK0A 4AF8A 3Q9LA 4ZYVA 3GA7A 5I7WA 1INLA 1QHNA 3ZH2A 5C7IO 3ERCA 1P0MA 4LVCA 2BGJA 2Z08A 1ECLA 5IT5A 1C0KA 3M5PA 1FS4A 4YFXF 1GCIA 3HKBA 2W6PA 4P33A 3JQGB 1XDSA 4D0NA 2ZCWA 4ARBA 3HJAA 3OC0A 3V97A 1T1GA 4P31A 3BH0A 1IRZA 3QX8A 1N0UA 4RL4A 4HNHA 3ND8A 1NR7A 4TRRA 2HPIA 4KU4A 1CUJA 5I01A 2GBIA 1W7AA 2WHYA 2J3QA 5TQJA 1LDGA 3TR0A 2W24A 3PUVA 2NV2B 4EY7A 1I0IA 1SEUA 4O4IA 4EGFA 1FDTA 4HRVA 2PEZA 3UK0A 3NXKA 2A61A 1LVKA 2HO4A 4PC3A 3VRHA 4O4JB 3L4EA 2CC2A 3GRKA 4IP0A 3QLTA 4HNAA 4XX0B 2OXTA 1ZEJA 1BGWA 3CCYA 2XYRA 1TJ3A 1FVOA 4EQ6A 3QE3A 2XZLA 3IV5A 5AH0A 1HDIA 1L3CA 1RKTA 4AKHA 3WGUA 1FMWA 3DLPX 1EKEA 3AV0B 1BMQA 5IDQA 4OL0A 3ZIAD 2ZZMA 2FFRA 3BRCA 1Y4DE 2ZBQA 2VJIA 1U8TA 4HDOB 1JTEA 1MXHA 4M54A 2O06A 3G2LA 1FTYA 4JU9A 3W2EA 1H2AS 4FKMA 3N6RA 4G1CA 1WZCA 2PS1A 3AF6A 1NJFA 4YJ2F 3GQBB 1LPOA 2CK3D 2OO5C 4UXHA 3AUTA 4C2BA 5D2CA 3HM9A 2EPFA 3DAGA 4FOTA 1KJ8A 4FLMA 4GLOA 5IZ4A 3ENNA 3H2SA 4ACAA 4V1CI 1UXKA 1MVNA 4TKLA 1ICIA 1OJ7A 3JPYA 4YRIA 2CLEB 4L22A 4LBWA 3O8LA 4MCHA 3DUFB 4JP1A 4PO3X 1BXRA 4DJ5X 2P7HA 2JLSA 4C5CA 1JHZA 4YT4A 3CIFA 3T5MA 2EG9A 4PSKA 3V8BA 1IV8A 4TROA 1BIFA 1CETA 1KQ8A 4D9FA 3RJMA 5AVJA 4PZLA 3EGWA 4XRSG 5KSOA 3FB4A 3GYBA 3GWZA 4L3OA 2XDQB 4XQCA 3TGLA 4MMXB 3N2GA 2YJGA 3VFZA 4L8WB 2YBDA 1OCTC 3D7LA 3IR7A 4CDMA 1N8SA 1V55H 2KZGA 1E1YA 2X9VA 4CKWB 1K8ZB 1LDKB 1ZG1A 4ZYWA 1YA6A 2HX1A 3QNMA 2HK6A 3LP8A 2DVMA 5AW7A 4CKCA 1Y9EA 2EFPA 3RAGA 3N2KB 1E9AA 3ZMVA 3A6PC 3ZHQA 2DOAA 3M4JA 1QZEA 1H1TA 5CPBA 1NL3A 3WLPA 4UZEA 2A0KA 4YCBA 3PEWA 3S2DJ 2F3SA 3AB3A 4HRXA 1T1RA 3AR9A 2PN6A 4DWJA 2BYVE 1HWYA 2O6LA 3ODPA 1K9VF 2QTGA 4GAEA 2A7XA 1E2JA 2ZJQF 3CR8A 1JBKA 4QC2A 5LMUB 3K0CA 3WGYA 3Q8WA 5LBQA 2H8KA 2PBZA 4WQMA 3RFFA 2Y4OA 3I0MA 2JIZD 1B16A 4FFNA 2VSFA 2OZUA 3HXTA 4MUJA 1SCNE 2A4KA 1D4ZA 4F92B 4R2HA 2XAGA 3VO9A 3PS9A 4RHCA 3M4OJ 5FHQA 3ZGNA 1AK2A 1X7XB 2QY9A 4KLAA 4OQYA 4YYEA 3AZPA 4Z9FA 5KSZA 2HXIA 1THTA 3DS8A 2P0YA 1S8FA 4GL4A 5HTOA 3KSZO 3O8BA 1RXEA 5IT9Z 5AK5A 5D5QA 2RHGB 5HCIA 1DRKA 2DPXA 4JUDX 2YJ6A 3E2IA 1UQRA 3TPZA 1QPIA 5EXXA 1SC6A 1NFQA 4E88A 1A9ZA 3NT4A 1D5WA 4RLSA 3G2NA 5LQDA 4G5SA 1AS2A 4B71A 1GPH1 3BORA 5JW6A 2NZ8A 2JGKA 1SBZA 1QRYA 5LD2B 1QLHA 1MV8A 3LA8A 1ENHA 5EWMB 2ID6A 5I7UA 1P0IA 4M1KA 4RIGA 3SXJA 1DPRA 5HNKA 4HUQA 4Q3AA 3DEUA 1UT8A 1G6HA 3BREA 4TKUA 4HBZA 2PX5A 5JRJA 1C7FA 3GLGE 2ETHA 5EZGA 1QGOA 3PNLA 4UUPA 4AO7A 1S2OA 4HH4A 2WWWA 2NOGA 2BFFB 1CJTC 3GLTA 1EVKA 1KONA 4IOJA 4GI3A 1MBKA 1QQAA 1QQBA 1ZH6A 5L3EA 5BQPA 3GAFA 2EHJA 4CCMA 2A3NA 1ZJZA 5TISC 1YR9A 3S14J 4DW8A 4RE5A 1JEYB 4C43A 2AZ4A 1R3DA 2TMGA 2Z2SB 2Q5CA 1LBSA 4EGJA 4IIJA 1M5RA 4GZ5A 1ZLXA 1L7VC 1POXA 3O4JA 2KQUA 2Q3BA 4WBXC 3WZ2A 4OI0A 3IHTA 1QE0A 4QYSA 2JTVA 1RAAA 2IXFA 1TYZA 1XCPA 2RBEA 1RRKA 3GFTA 2P4SA 2JVHA 4IDPA 3GLIE 1U3DA 3GUYA 2G08A 3LUPA 3K2ZA 3EVCA 2IQIA 2KRHA 1AKRA 1HNXB 5CIQA 5IC5A 3OI7A 5D8DA 4W99A 4TTRA 3REGA 2SKDA 2OFXA 4IIBA 1YTLA 2MINB 1Q1NA 3ZXUB 3RAJA 2GHQA 4EKDA 1M3SA 4RDHA 3PQ6A 2XWQA 4OQMA 1XXHE 1YZKA 3D2AA 2VP6A 1TLLA 4BYMA 4C30A 4M9RA 2Y75A 1DXHA 1H42A 4OHFA 4H2DA 1L4KA 1SFKA 5M5WJ 1JA9A 3SXUA 4BB6A 1Y3AA 2C5GA 4M9XA 1VNDA 1J2RA 2O3TA 2PJUA 2F64A 4CV2A 3RDPA 4HZIA 1HMPA 2ZJPF 3DW3X 3ZWQA 2H51A 3SF8A 1CNEA 3LSHA 4ND2A 1Z2CA 2F8SA 1UH5A 2QIOA 1BXKA 1N1MA 1G20A 3VJLA 3OZTA 4D41A 4H27A 5C37A 1S8AA 2AXEA 2DBYA 1XLWA 4PC1A 4WOPA 2Z16A 3PF9A 3I6MA 4NP6A 1ZHHA 4DSOA 2PV7A 3NWSA 3L06A 1GZHB 1YB5A 1LSJA 5TGZA 4CLHA 4ZT6A 1WJAA 1XD7A 2H08A 3MB8A 4URZR 3N76A 4M0FA 4RA2A 3O9MA 2ACVA 1HETA 3T12A 4HLXA 3P5JA 3FGPA 1SXJA 3BP8A 5EGOA 1I4EB 3KOWA 4PAGA 4XDZA 2FQ3A 2W2PA 4PSAA 1FX0B 1K0FA 2ZZKA 3BPSA 3RC1A 1VECA 4Z6YA 4I9FA 1L4MA 3HSRA 3JAKB 5C32A 4L85A 5EF6A 1P5ZB 4PFKA 5LA6B 3W5AA 4AC9A 1UFRA 1UMDA 1GNLA 2JA6J 3OS2A 2DTXA 1C1XB 3A6DA 4NCXA 2Q46A 3PU6A 4FFOA 5TEWA 3UC9A 4GDFA 4Q4HA 1ZK4A 5BY2A 3CPEA 1YA4A 1XKTA 3ZI0A 2HLDD 1GL7A 3FYUC 2NQTA 1WM1A 1HH4A 2XASA 5EFZA 3GG2A 3OETA 1LSSA 1VTKA 3C3AA 3UBMA 3WHPA 2NUTB 1KI2A 4DMGA 2NTNA 3V1TC 4HQLA 4YP0A 5BYAA 1T3LA 2LZ0A 1QNTA 1SBNE 4S0XA 3EYIA 1T0JB 1CXZA 1DOAA 5K7ZA 4AO6A 2CMPA 4NE2A 1IULA 4MV3A 1JE0A 1B8IA 4LC1A 3AB8A 3CZQA 4DTIA 5DD8A 2CUFA 2JLRA 2PMHA 4YNBA 3JVVA 2P9FA 3I5UA 2H2FA 4MQEA 3T3IA 3WKDA 2V9PA 1KAHA 1LXCA 1U8RA 3WLFA 1GILA 3R7FA 4GZ6A 1I3NA 5FV4A 3PA6A 4E5UA 4YBRA 3R09A 2H4FA 3TOXA 5K1YA 1DELA 1UBNA 1RYHA 2NT3A 4AWXA 1W9HA 4J1TC 1O2DA 1Z9BA 1ESEA 1C9NA 2WD8A 1WA5A 5ILSA 3SDSA 1FDSA 5AR1A 1CUHA 3IMGA 5DLDA 4G0YA 4DZPA 1UWKA 2H4ZA 5TARA 2E71A 2L0KA 1EWRA 3NKLA 4XD7A 3DHWC 5HLGA 2VDMB 1CLEA 1YGYA 5HGJA 1UBFA 3QW4B 1IVYA 4GVPA 3HOTA 3GZNB 4URUR 2G9UA 3UJNA 4HWOA 1LW6E 3JATB 2I0FA 2REBA 3PUWA 4R84A 2P9EA 1QF7A 1CRLA 2X5NA 4RTQA 1SK8A 1D4OA 3GJ8A 3L82B 4M8KA 4FYYA 2K4MA 1V7CA 4TYQA 3QKSA 2WT4A 1VCOA 4B43A 1N5IA 2HPAA 3NTVA 4MV7A 2XOEA 1NOJA 5EIBD 2V79A 1RYMA 4P8RA 3FWNA 3FPGA 2V59A 4CMEC 2VXZA 1GPYA 4N8SA 2GJAA 1DCTA 2W90A 2VC2B 3QEKA 2FMYA 2A5GA 4C7MA 2WQ7A 2VNAA 1ORIA 2AC2A 1Y8RA 4QE3A 3CRVA 1ODJA 4WNCA 1GPAA 1E5VA 3SMVA 1DC6A 2PXHA 3MUOA 2DULA 1TTYA 1O3SA 1OFGA 4E03A 2WY8Q 4NMHA 3DL0A 5C1PA 4YEDA 4RVFA 1QVAA 4Y6SA 2ZULA 4HPJB 3HYNA 4OYHA 5H16A 4IHYA 3PQJA 1O5OA 1TNDA 1TAGA 3K09A 3PR1A 4J7XA 4NEGA 1XNRB 5LC1A 4B3MB 1ZL2A 3GRVA 3H92A 3ESBA 1XGMA 5J4LA 3FXQA 3OJ0A 3EVAA 1SCDA 2EP5A 2ODQA 4QUDA 2GK6A 3OOSA 3R0ZA 3R5FA 3JW4A 1Z6YA 1V8PA 4WXRA 1VYHA 3MHTA 1FYXA 1ZIDA 2C9YA 4HI0E 4D42A 1CQTA 2XUFA 3EXHC 3LQ4A 2EFWA 1UXGA 1FTTA 3V3TA 3QPWA 3PXCX 4FB4A 2O52A 1KI8A 3CRQA 1TGVA 1S2IA 1W49A 2QRLA 1T6ZA 3QEMA 1U1CA 3GT4A 5A9SA 1QAOA 4DLTA 1SMTA 3KZYA 4IOAF 3GTJJ 2ZIAA 3LT4A 2HTEA 4D46A 1MB4A 4ENNA 2NZUG 3AT1A 4OFBA 3OM9A 3TFOA 5F2KA 3GEPA 3NIBA 4FFWA 5AVOA 4JB3A 2QVXX 4PSUA 3NM4A 4Z4EA 1SD5A 2HQOA 1IN5A 1NVFA 4YFNF 1KVQA 3F49S 4HNUA 2O3QA 5FA8A 5ALUA 5CGQB 5M04A 4QPPA 1HT1E 3BF7A 3DVAA 1XTQA 1KEUA 3B52X 4BDSA 4OIRF 4YGYA 3S81A 5LYYA 1AX9A 1GPUA 2W4QA 3FMIA 1F38A 4QGGA 1APLC 4PRYA 4Y18A 1ZK2A 2QUHA 1E69A 4MYCA 1ZJ4A 4YVFA 2JWTA 4A1OA 2ZWOA 1JG2A 4GEGA 1WI3A 4H77A 4KVFA 4NEQA 1MMGA 1JKJB 2XNJA 4LG3A 2QVYX 1Z25A 3I72A 4BNYA 1QNFA 2WJZB 4Q5SF 4MYSA 1JUDA 4ECAA 1W5BA 3L6DA 4E5KA 2BGGA 4AJOA 4RIEA 4C04A 3VQTA 1L5FA 1N8KA 1UK6A 4DWVA 1KEEA 1QMGA 1U7ZA 3TFWA 1A9XA 4G86A 4REQB 1UBKS 4UEOA 3FYCA 5ANRB 3MJTA 3Q0UA 4KWHA 1NKTA 4M88A 5TGDA 5FT9A 2XXJA 4Z1MA 3ENVA 5AO9A 2FF5A 1U5TC 2WLSA 4JS0A 3EC2A 4QFCA 2XRLA 1ZMBA 3EXAA 1ML4A 4ZYUA 3QVGA 3IR6A 4XRGA 1ZARA 2OZLB 3VHXB 4R8SA 1Z0JA 4MQFB 3PZRA 2QPAA 3Q7PA 3RTGA 3VDNB 4IJUA 3QSGA 3AX6A 2PX2A 1VJ5A 4Z49A 1YZTA 2L9SA 4C05A 3H99A 3FZGA 4KR7A 1A9SA 3FUTA 2P77A 3ILSA 2LCFA 3K20A 5AVYA 1ISFA 4DG8A 2VBXA 4JAVC 4HQNA 1CR6A 2QZZA 2X9LA 2EATA 3J81Z 2A5FA 3RG8A 2AQKA 2L17A 4DS3A 1RWBA 1DKLA 3FKQA 5LHHA 1FFXB 1FX7A 4YFKF 4G1FA 4XLCA 2IIPA 2UU9B 1MJBA 4A8JA 5BVGA 2O59A 1U8XX 2NYXA 3WBBA 4CCYB 2UUOA 3SZRA 1K4YA 4XEUA 4PBRA 2F6CA 1WVMA 2OLEA 1X13A 3C7DB 3OPYA 4YIRX 2AFIE 2VT3A 2HQNA 3NWBA 3LX4A 2P67A 5DBOA 5BV0A 3VR5D 3HBNA 2F4NA 1NP3A 4S1NA 3N9IA 3A1SA 1UZNA 3PE4A 4P4GA 4JVNA 5D1HA 1ZSYA 4CDNA 2RG7A 3CHYA 2WJHA 2X0KA 4IJQA 2Y2VA 3GQVA 2XZDA 4NL4H 2MBFA 2ONKA 3FYUB 4HZUA 3RBZA 4W6QA 4L1KA 4MSUA 1QRAA 4D4IA 4HOBA 3EBPA 5CH3A 2VBWA 4FNOA 1NN5A 1J75A 3GAZA 2PMZN 4TLDA 2I8LA 1U80A 3LC2O 4G24A 3GRCA 2IKSA 1GHTA 5FOXA 3RIHA 4RS4A 3ZMSA 4Y2VA 4XE5A 5KNBD 3BWYA 3L3BA 2Z5UA 2VT7A 2R2GA 4JSYA 3ZW7A 4ONEA 4AD8A 3M3YJ 3R61A 3DTEA 4B31A 1C30A 1IYZA 1VM6A 1V25A 1U8UA 4HWRA 1J8YF 3KWMA 3DD5A 2OV7A 2QK4A 2GZWA 1EP2B 1US8B 3G6WA 1DKRA 1UINA 2EGGA 1EA5A 1FJGB 2H8WA 1OLSA 5JFGA 2IPLA 4YJ3A 3ACBA 3WO0A 5TQ2B 5EJ8A 3QTLA 1GZ3A 3K9BA 4E1AA 3PENA 3CLRD 3QJYA 3VU9B 5IVHA 5EHNA 3K6SB 2XZOA 1LDBA 2OAEA 4MGKR 4DIKA 4G4SP 3WBFA 4GYYA 3JYLA 1Q77A 4TLMB 3ABSB 1LD3A 5JVGF 5JTUA 4PYRA 4JFRA 2QD2A 3L7JA 1UJMA 4RMNA 1PNOA 3IIEA 4LLGF 4L0DA 4C4YA 4WWHA 2NVUA 2ZT6A 3CW8X 3MHPA 3VTKA 4ZT3A 3E6AA 3L79A 3B1ZA 4B3AA 1QCZA 5K0ZA 2P5VA 4RHUA 1A9TA 1ZICA 3QLEA 3QPBA 1U31A 4QOHA 3PFWO 3MZHA 3L8GA 3TZKA 6YASA 3OSGA 1RCTE 5H3CA 3ZS9A 1V4NA 2NU8A 1O97C 2NRAC 5KYWB 2I33A 3ZV4A 3GCGA 2VYFA 2XCRB 4RMJA 4HHEA 2PBLA 4IO0A 3IAM6 4OGFA 4Q9JA 4OWRB 3P4UA 2ZIWB 1T0HB 2PY6A 4HUTA 4I3HA 2IUFA 1ZUWA 4XORA 1QYVA 4MUXA 3CD6I 1F8UA 2BXZA 4BLSA 3LQYA 3W8RA 1M7BA 5SYMA 3EVDA 4GFDA 2EIXA 5B7PA 4KHZA 2P3LA 2MSYA 1TWGJ 1X4PA 4RGXA 4BEWA 5EE0A 4Z8XA 2Q1WA 2FF4A 1LQ1A 3C18A 1K4SA 2C3MA 2FWPA 4B3DA 2O54A 5IC6A 5CP8A 3AJRA 1L4GA 4XB6B 3BK1A 4UZFA 4EY8A 3KJGA 1COWA 1K79A 5IM4A 1GQOA 1H4QA 5AK4A 4ZU6X 2I2DA 1ESDA 3S99A 1DBVO 5GOTA 5EKDA 2W6ZA 5E3LA 1ICEA 1Z5UA 2FUEA 2I71A 4OHXA 4QSHA 4TTQA 3QXXA 1P1KA 2B8NA 4BNLA 3LF1A 3HDVA 3UANA 5HGXA 4K03A 2RD2A 1TEZA 3IT2A 1RRCA 4Z2YA 1Z33A 3PNOA 4KBYA 3VYSB 4KR6A 3HCWA 3EXHB 1FDUA 4CMGA 5L3VA 1M73E 2TMKA 1DQZA 5HS6A 2ODWA 3AF0A 5C53B 3ERED 5KNLA 4EUNA 2R7TA 4MGHA 2VUSA 3QELA 4NU8X 4ND7A 1P91A 4D92A 3AY7A 3K0LA 4DR1B 3O6VA 1ID1A 2PKXA 2XAHA 1PNQA 4MUFA 4I50F 2NG1A 1CUCA 3CUYA 2FMUA 1IM5A 2XAAA 5JHFA 2LW7A 1P2VA 3DWGA 1C80A 5AHWA 221PA 1TQ2A 1UM9A 3EZ9A 3DKXA 5ERXA 1Z2DA 3IEUA 5D51S 4MQ4A 2IV3A 1NNLA 3RYHA 2KI5A 2V4UA 4FYMA 5FPPA 3KUUA 1T25A 4W5WA 2WADA 3OKAA 3C8DA 1F0KA 1TZMA 1U2GC 4S2EA 4DA9A 4B4WA 4N6GA 1Y1QA 1ZR4A 2J5BA 1SOUA 4BMOB 3S2SA 3KV3O 2V3VA 3LTEA 5BOVA 1YJQA 3ISVA 4ZYHA 3OT1B 3W2IA 5FB3A 4DC9A 2JCGA 2K3PA 1CVLA 3JQ8A 2W7TA 2QTCA 1R1TA 1CUBA 3M7GA 2HRZA 5DGDA 1M2OB 2PXCA 1LX7A 2UZ3A 1GKUB 3FM5A 4Q1FA 4DUGD 1D2AA 1RYBA 1IGNA 5A3QA 4CYCA 3CF6R 3BSWA 4ENMA 3WGQA 1XVIA 2QN9A 3B1XA 4QPCA 1U5TB 3KYIB 3KJNA 1PR2A 2WSSA 5HFNA 4JI2B 3ZJVA 3GJQA 2VKTA 3BG3A 1FPQA 4MAAA 4TXLA 5CDFE 1L5QA 4NICA 1RHMA 2XUHA 3ZU2A 2DEUA 4NR0A 5ED4A 3REQB 4GH5A 1I39A 3F7TA 4MS1A 4CFSA 3CKKA 3IS3A 3G2QA 5ADWA 4RV4A 3W6UA 4KNYA 3R4CA 3OZRA 2IYOA 2OQIA 4PPFA 3TP0A 2NZYA 4UD2A 4WLNA 5CITA 2XR1A 2QRQA 4NMXB 4XJSA 3CESA 2Y66A 3RSZA 3G8YA 3EN0A 5BSKA 4FVTA 1QCDA 2VDKB 5JYEA 1RYFA 2Q8QA 1CY2A 2HXYA 3QPUA 3RYIA 4Z2AA 1CRWG 2JFFA 5BPDA 3RREA 3QPHA 2FSVC 1XFAA 1YT5A 6PFKA 1U3TA 3HHHA 2QPLA 3NTQA 4PZ9A 4JHLA 4ZN6A 4QSMA 5CCXA 2V9CA 2XA2A 2QQ5A 4G25A 3BZUA 4EG0A 1HZJA 1WSBA 2GA9A 1PBNA 3PEUA 1G8AA 2CYBA 3CURA 1ELOA 3E9QA 4BO4A 3W4KA 5BSGA 2ZBVA 2GO7A 3KT0A 2O8VA 2IUYA 3QU2A 4GI2A 3U3RA 1YW8A 1KEZA 1IOWA 3OPYI 5I7RA 1SCQA 4UBMA 4KICA 5FNVA 4XB1A 3SR0A 4P7JA 2WOOA 3P8ZA 4YRMA 3O8NA 4QREA 3D8HA 2QGUA 3OG9A 5F78A 1Z7BA 3JRAA 1CK4A 1GKKA 3M1EA 3H1PA 3JQ7A 5FUVA 3C3XA 3BR1A 2Q1YA 4ZDIA 3GZJA 1F2VA 1AKVA 1IFXA 4B8XA 2NU7B 2OGZA 4RGVA 2VXOA 3F0CA 3CNNA 5H68A 5I8WA 2JHGA 5LGNA 4WBSA 4BLPA 4KXUA 4M0DA 4CTKA 3TRIA 4FZRA 3AETB 5KYKA 1J0CA 5FRNA 1KU0A 4EG6A 2CLKB 4J0EA 3QKWA 1J49A 4ZK2A 2ZYVX 1WNTA 1WU7A 4OH7A 4C3IJ 1F9AA 3NJRA 2W8BA 1ZY2A 3C7KA 4LXTA 1H9GA 2Q1ZB 4UVAA 1JFRA 2ROQA 3SSOA 3LDAA 3GLGB 1LV8A 1Z88A 1NW7A 3KQUA 1AY0A 3NDRA 1GPDG 4M0KA 4XKWA 3DE7X 1U2TA 2JJ1A 3PXDA 1TKCA 2PUVA 2DFDA 3Q98A 3OPQA 4E7OA 2V7QA 1DT3A 2FE4A 4JI7B 1T15A 1VZ0A 1NYRA 3ZLJA 3IR5A 4CN9A 4ZKEA 2ZSKA 1E3HA 1BDBA 5BQTA 2FEOA 3OPVA 4FGSA 4B46A 3I4CA 3UWPA 4ZYLA 5FTJA 3FMQA 2AB0A 3E9MA 5IHPA 2GCGA 3GLIB 4U5QA 3ZQKA 2JJ2A 5FFNA 5LBIA 2JK1A 1NVWQ 4IMIB 2YVQA 3INRA 3DWIA 4ZVPA 4BQPA 2WIKA 2DHQA 4F8YA 1D8AA 1R0YA 4MW9A 3TMAA 4Z3OA 1N36B 3ZWYA 5DUIA 4JK1X 3ZTYA 2VDVE 3JARB 3ED5A 4NMMA 4BGUA 5THXA 1XD2B 1D0ZA 2VPIA 3RANA 1XXHB 1B6AA 3WL8A 2HA0A 4AX8A 3E9DA 2JEYA 3U60B 4LHWA 2J0EA 3RS8A 1MMDA 5FOVA 2O7SA 4CF6A 4I9UA 4WKGA 3L8ZA 2UV8A 2PQMA 3DAYA 4XM2A 3BTOA 3T8YA 4H6VA 5PNTA 1YXMA 2I9PA 4KXWA 5KYXA 2QX6A 1ML3A 2ES4A 1A50B 3T8TA 4HNQA 1M2EA 4BMYA 3U6KA 3EWSA 2JPBA 3LWZA 3EBOA 3PUZA 1NMSA 4H1VA 1T39A 2DWOA 4ZMBA 4DA0A 4K3VA 2PJDA 3G7UA 5HX7A 1OSNA 4MNTA 3AYXB 3WL4A 3RUFA 4EX6A 4LJSA 3FCEA 2ZUEA 2L01A 1D0VA 1R6BX 4QXAA 2X5XA 1B4DA 1IY9A 3FZNA 3VVCA 4NE7A 3HVJA 2XE4A 3LFUA 2P5SA 4ENWA 3NT5A 4IFTA 1UPFA 1YE8A 5CVRA 1H6AA 4FCVA 5LGTA 1D9XA 1C8KA 3NHSA 5JJLA 4LZNA 3HEMA 2XCQA 1LRJA 1KP2A 4UMDA 2O8BA 4DG5A 1G66A 3GJ5A 3HXMA 4PLVA 3PM1A 2HFHA 2BEWA 3CMCO 1VBNA 2QTFA 4HX8A 5DWQA 3GOQA 2HGSA 4O4LB 5IXYA 4URVR 1E4YA 4XGQA 3DE2X 3KX2A 1AQNA 4MNUA 3NVDA 3GUHA 5BMVB 1XN7A 2XY4A 1OYOA 4N18A 4EMSA 4IXDA 2VYVA 1Z08A 4BECA 1TQ4A 1IUOA 3KSRA 4DDMA 2NSLA 4PFQA 3QVUA 3E3LA 2GFQA 3VJMA 2CQXA 1E92A 4DR6B 4Q7QA 1V8DA 2X1VA 4D9CA 4JD5A 2Q3LA 3E3OA 4U1RA 5U9CA 1LX6A 1O7JA 1JA0A 4EB6B 3D0RA 2AK3A 4YK7A 1ZFNA 4A73A 1SIOA 4KP7A 3UZUA 1IY1A 2PUCA 3ETGA 1E3EA 4X84A 3VH3A 1FUEA 1QRDA 3NG1A 1G8SA 4K9OA 3DHNA 4XIIA 4B44A 1TW3A 4C1NA 3WV4A 4YUAA 3FA2A 3W4IA 1CDZA 1F8FA 3A9UA 2GJ9A 1R88A 1TA4A 4LZAA 1U94A 2FX0A 2L7FP 2QZ9A 4G8CA 4O2BA 3TLEA 1F2DA 1VRWA 1B23P 2DBQA 3ROXA 3HR7A 2IUEA 3RO7A 1YQDA 3O03A 3QJ5A 2LGJA 1JHFA 2P2YA 2ZKLA 2I5PO 5AVXA 1GGMA 5LU9A 1KQNA 3NEYA 1P72A 4LPKA 4C0AC 5DHFA 5K8JB 3PQ2A 2CHVA 1XQ6A 5ECDA 1ETYA 2WY2D 2HZBA 2BBOA 2VQHA 4ZC3A 1B74A 5FFZA 1VQLI 3T0IA 2W6MA 1QH1B 4TRJA 1YZGA 4NECA 1QZYA 1HA3A 3W5JA 2O2IA 3GAAA 1R1UA 4UPEA 5ED0A 2AMYA 3ZLBA 4CTOA 1GGHA 3UUEA 3ZQJA 5JDIA 3TVYA 3COAC 2NVWA 1EHCA 4KVAA 4FNMA 4GWKA 2XHEA 1XJCA 1MOZA 1ETUA 2FBHA 1JFFB 4DHWA 5CT4A 1DRUA 4W8GA 1C7JA 3PCXA 4XRRA 1Y1WJ 5B1DA 5HF6A 3L7DA 2Z6VA 2ID7A 4NBTA 2X7JA 2RHHA 2EGUA 3IH5A 5JS6A 1D04A 1D07A 3I30X 2QRNA 1UPUA 2QTLA 1NXXA 4HQOA 4JI0B 4QZVA 2VF8A 2XVMA 5F5LA 4BE0A 2Y27A 3BL5A 2ZSHB 3VV3A 5JI6A 3L7YA 2BFDA 5CNKA 1IHDA 3GFIA 5CG1A 2GEUA 1TF2A 4FZ3A 3WRVA 1ZH8A 2YMPA 4YH1A 5E6UA 1P73A 1ZZEA 2XPVA 3BIJA 3VYRB 1Y4AE 1KI7A 1CERA 2EKQA 2VWQA 2EDCA 4L27A 1D4FA 4L18B 5EUCA 4N47A 4ME6A 5M3FJ 4DVGA 5A4JA 1QUFA 4OHRA 2QU8A 3TKAA 3ZQQA 3HYRA 1VZ3A 4N5HX 3A36A 5GMOA 4BYGA 1DGWY 4ISCA 1L1EA 5C7LO 5F5XA 4B3JA 2O7OA 1BG6A 2FPGA 2VJOA 1HLFA 4KIBA 2J87A 4QOEA 1W4ZA 4ZQFA 5H4GA 3FCYA 4JLJA 1V35A 1USIA 4HFJA 3R7NA 2I03A 1USGA 4YCLA 1N1DA 3R3ZA 1YJ8A 4M1MA 1LJLA 3S2WA 3KPWA 4CIVA 4WKCA 3R7SA 5EWJA 1EH7A 4GSLA 4MS4B 1HDRA 1XHLA 3BJIC 4WCDA 3MS2A 3BGVA 2JGFA 3CEPB 2Y1KA 3NYRA 3ZWBA 4QDTA 4GR5A 5JCZA 1J0RA 1G8KA 3TD9A 2C7GA 2FUNB 1SBCA 5ICEA 4P38A 4NARA 1NUUA 3WNVA 2E34A 4HSTA 4O4HF 4BDTA 4YV1A 4F60A 1HM5A 2NSYA 4NMWA 2ZW9A 3H6HA 4ZDLA 1HTTA 1TYCA 4D3YA 4W5QA 1DU0A 3G4SI 1PK8A 4UM9D 1QIJA 4X45A 1BFKA 3EIOA 3IBSA 2GAAA 1WVRA 2V5VA 3FE2A 4LYGA 4WK8F 1PTJA 3SOPA 2P68A 2PT7A 2Q21A 1YR7A 2L7KA 3UAWA 3AHEA 3PYLA 1SCUB 4EKIA 4RK5A 4BZXA 3OCJA 4FYWA 1D1TA 1RZ4A 1Z0ZA 3EPRA 4WNAA 5CB0A 4GP6A 1F5TA 4KWTA 1RWWA 5I9IA 3O8DA 4J16C 3Q88A 3LOCA 5JEDA 3FIWA 3GT7A 1VE1A 4P5PA 1F1BA 2ESHA 3B9BA 3VO1A 2GEVA 1RLMA 4AU7A 2BFCB 5JPDA 1DDOA 2HT1A 4RFSB 4JI8B 2BUAA 4MRMA 4JK3A 3SDZA 2B21A 3LC7O 1KVSA 5JNRA 2WTUA 1QYIA 3FF4A 1D3YA 2C5FA 4TTPA 5LP6F 4X90A 4C4TA 2EZ8A 3HB4X 1ABBA 2XCOA 1L2TA 2PMKA 3KP1A 3CISA 2MA3A 4JR2A 1M0TA 4U9UA 1IONA 3THRA 4B45A 2GK4A 1T0PA 5AVKA 1G9SA 1X7GA 1YRWA 4ZALA 4DMLA 4Y7DA 2NYVA 4FKZA 4UATA 3KPYA 2CUTA 3H3VK 1BQ4A 1GL6A 1UAGA 4L4XA 2LKDA 4YMGA 5CXSA 3N6VA 4AY3A 3SHWA 2X5JO 2WZDA 4HQKA 2K5UA 2WPDA 3HV2A 1YZLA 4B5LA 2HWKA 3RJTA 5ALZA 1GUUA 3H83A 3G2BA 3D4PA 1X7WB 2N0SA 5NULA 3ESQA 2AFIB 4G0NA 3R3JA 1XRPA 5CFMA 1JUPA 4XLTA 2FRXA 1LPSA 4R1SA 4UHJA 4H3SA 3FKSA 1R36A 4YQFA 3IHWA 4KIFA 5L4LA 1H89C 2ZVDA 5ELXA 4OHBA 2RHMA 1PZHA 2Q0XA 4B79A 2QJRA 4ITVA 1TQPA 2JLYA 4PGMA 3I52A 2XGJA 4JNKA 5BN1A 2MD5A 2C99A 3QVLA 5HZHA 1GD1O 2H4YA 1VE6A 3BZBA 2RNGA 4CYMA 3QG5A 4TMXA 1W5FA 3AHDA 1IXZA 2POCA 1H4VB 5AM3A 2B4KA 3HUGA 1XTIA 2BZGA 3CS3A 4GPIB 3E5HA 1JG7A 1QAMA 2RGVA 2NU9B 4NC8A 2H92A 4RDIA 5AIBA 3QXSA 4IL6C 2CW0F 2O2DA 2CJFA 1G5RA 3FYHA 3WK9A 1MIJA 4IUBS 3TCKA 2XB2A 3WU0A 4KV9A 3Q40A 1B8VA 1FCJA 3BMCA 5FKNA 3QA3E 5THQA 2J3DA 3EAFA 3VC3A 4X61A 3IODA 4AZSA 1OCZH 4UQPA 4YRRA 2K3FA 1R8YA 2JAXA 2WAYA 2HMWA 4AULA 3BQYA 4QGHA 4Z99A 4NFLA 2PVPA 3UN1A 5A71A 3B7WA 1VQNI 1DMRA 5C2JB 1AV6A 1S29A 4BEJA 3HFRA 2TDXA 3QNUA 3GCWA 2IQ5A 5DIFA 2P4QA 3T3NA 2ZTUA 1MTZA 4G8JA 2FGKA 2XYPA 1AE1A 1N6RA 2YUTA 1Z0DA 5EZQA 5B6IA 4L57A 3GA0A 1U78A 5AIPA 2CO5A 2EP8A 3FPEA 1ZESA 4D43A 4I09A 4BZQA 3EWIA 2VE8A 2HMUA 5EMHA 2BSQA 2FVYA 2RGBA 2XMGA 2EFNA 1MGPA 1CPYA 3FW1A 5FDFA 3I34X 4TYWA 3NOQA 3AP3A 3NGXA 2R9VA 1RZRA 5B64A 2COKA 4CWAA 2XITA 1J23A 4A26A 4LSGA 2GZ3A 4IWYA 4M0UA 1RJDA 1CD5A 4RIFA 1UJ4A 2V8BA 1L4BA 2OQVA 3TB6A 2J9ZB 2JG3A 3P9RA 1AB6A 5KSPA 1L5WA 4EMUA 2JFQA 4DDTA 1C2TA 1R64A 2CDBA 3VNUA 3I2GA 5CU7A 1BS2A 2NPOA 2GCOA 3CMYA 4HTFB 3C5CA 2HRBA 2N3ZA 5EP2A 4LJ7A 5LB4A 3LBIA 3MBKA 4ESBA 5F0FA 4RL6A 2P1ZA 4EM6A 1R3UA 2ETXA 2WIFA 5JH7B 2FWBA 4M6VA 4AUXA 3UUFA 8OHMA 1PUIA 2ME6A 4DBQA 3L77A 1NK2P 4IF4A 4MKFA 1K92A 4P08A 4YA6A 5BR7A 2PL5A 4TYPA 1HFJA 4LKOA 4QULA 4WLOA 4F11A 1I2CA 3KU1A 2RI6A 1HKUA 2HFKA 2AQ8A 2OGTA 3FNQA 5D3ZA 5J2TB