2GXAA

Crystal structure of papillomavirus e1 hexameric helicase with ssdna and mgadp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
270
structure length
270
Chain Sequence
TEKFDFGTMVQWAYDHKYAEESKIAYEYALAAGSDSNARAFLATNSQAKHVKDCATMVRHYLRAETQALSMPAYIKARCKLATGEGSWKSILTFFNYQNIELITFINALKLWLKGIPKKNCLAFIGPPNTGKSMLCNSLIHFLGGSVLSFANHKSHFWLASLADTRAALVDDATHACWRYFDTYLRNALDGYPVSIDRKHKAAVQIKAPPLLVTSNIDVQAEDRYLYLHSRVQTFRFEQPCTDESGEQPFNITDADWKSFFVRLWGRLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of DNA translocation in a replicative hexameric helicase.
pubmed doi rcsb
source organism Bovine papillomavirus type 1
molecule tags Replication/dna
molecule keywords 5'-D(*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*T)-3'
total genus 83
structure length 270
sequence length 270
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Zinc finger, large T-antigen D1 domain 2gxaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gxaA02
3AKYA 5CITA 3U3KA 3FKSD 4IOJA 3BBPA 2WPDD 2CLDX 4Z54A 4LJ8A 3S1AA 2DBYA 2WKQA 2ZR7A 3K0FB 4XD7D 2PJZA 2ERYA 1LNZA 4MKHA 5KSZA 4G0NA 3SI7A 1ZUNB 3B9PA 3ZYCA 2IWRA 3AVPA 3GFTA 1BS1A 3BH7A 1G17A 3ZLJA 4D81A 2RAPA 3K9HA 3IILA 1JB1A 2DFNA 2JLYA 1E2PA 1M74A 1OFUX 2OBNA 1Q1EA 3IIJA 3QIAA 3MWLA 1D8TA 1VG1A 1VG8A 2PJRA 2HT1A 2RGEA 2W6IA 3TSZA 2OCPA 721PA 1XDBA 4Q7JB 2GEDA 2GZHA 2CXXA 1SVIA 2HEIA 2V7QA 2BMDA 1OXUA 2QAGB 3PG5A 2REOA 4DCNA 1HUQA 1QVRA 3FDIA 2ANBA 2UVQA 1XD9A 3I92A 1AS3A 1J8YF 4FCVA 2IXFA 1DEKA 5J5CA 2ZU6A 3RS5A 2Z0MA 2WPDA 3AUXA 4GI7A 4O3MA 1NVXQ 2QMEA 1MO4A 3QE0A 4U7DA 4Q18A 3X1YA 3UK6A 3M0EA 1MV5A 2JLXA 3T5DA 5FTMA 4WVFA 2HCBA 4IFEA 3QSYA 2YWFA 1J8MF 1XTQA 3HU2A 4FWIB 4K46A 4NE2A 1E9RA 3AEZA 5TDHA 4Q1FA 3Q7PA 1JBKA 3AM1A 3FGNA 2BM1A 5DN6D 3MFYA 1B0UA 5EE3A 4Z8YA 3SJAA 3UMFA 3PR1A 3QF7A 4KVGA 1TQDA 1ZNXA 2QGZA 4DIDA 4Q7KA 2D2EA 4F4CA 2GAAA 4MH0R 1XB2A 2WJGA 4KU4A 5JI2E 5CK5A 2ZE7A 3C16C 3WBJA 5H8WA 3QKTA 5AK0A 1ZD9A 2RGDA 2QP9X 1N5JA 3EPLA 1IXRC 2GNOA 3C41J 5EXSA 2D4HA 2FEMA 1CKEA 4QBGB 1U9IA 3ZS8A 2VHTA 3R9WA 4HZIA 4F92B 2J5XA 5JWRA 1E2NA 2ZVQX 4NHOA 3EAQA 4V0MA 1I4DD 3CIOA 4LX0A 421PA 3A4NA 4TZ6A 3SYKA 2YWHA 1FTSA 1GIAA 4UXIA 5EZ5A 4BWYA 3MJHA 4LK2A 1HQCA 2ATVA 2KBFA 3LQQA 1IM2A 3AGQA 1FNMA 1VPLA 1LF5A 2W2VA 3TLXA 2E9SA 3OE7A 2VTKA 5D3QA 4EPWA 5DHAA 5AJZA 4QBFA 1OH6A 3K70C 5UKDA 2C99A 2PT5A 2O8CA 3WXMA 2VP2A 3LQRA 1GITA 3BB3A 4BLPA 3IUYA 4A36A 1ELOA 5AUNB 1E79D 3LBIA 4YDSA 3NG1A 4UKDA 3GCGA 1G6OA 4TT3D 2Q9CA 1OB5A 4LJ4A 1NKSA 2VYFA 1U0LA 4A8JA 3A1UA 1Z6TA 5HCNA 2IYXA 1W4AA 3QXSA 3IBGA 4MUAA 3GEEA 5DN6A 4DIEA 3RABA 2WWWA 5L8VA 1GNRA 3WYGA 2QM8A 1G19A 3CNLA 1OFHA 3WYAA 1JPNA 1S9HA 4Q9LA 2BC9A 3IEUA 1JXOA 1CRQA 1YRAA 1FX0B 3THYB 1ZU5A 1EFHA 3K8YA 2WWIA 2BJWA 4R7ZA 1V5WA 1D9ZA 2ZETA 2YVUA 3LBNA 1SHZA 4JLPA 2REXB 5FOSA 3CH5A 4TLEA 4CIDA 5K8UA 3AVUA 2A3RA 3LFUA 1KNXA 4JLVA 4OHZA 5K8TA 1DARA 2FFBA 2ZI5A 4ZDKA 3GLGB 1BH2A 4HUTA 3ECCA 3FHCB 4FMDF 4OI1A 3ZJYA 4DEYA 1D2EA 1YZGA 1D5CA 4HDQB 1IXZA 3NIBA 4GMXA 4JLNA 3W6PA 1XWIA 3R7WB 3H4MA 3B1XA 2BKEA 4YMSA 1S8FA 1MT0A 2V6IA 3C5CA 1DO2A 4KCGA 4FXPA 5KDLA 3EPHA 3G5UA 4ACAA 4BFSA 4Q21A 4DLTA 1P75A 3C7KA 2GJSA 3A37A 1XFAA 3K0FA 3T15A 1Z3IX 4EUNA 2IK8A 3LRPA 4HAYA 2QPAA 3MWKA 3ZIAA 5LB4A 1DVRA 4KFSA 5DH9A 1IN5A 5DYGA 5FBWB 3TW4A 2GZAA 1NMZA 2O8BA 4OYHA 2F1IA 5AR1A 2IYTA 3SYLA 3CX7A 1QZXA 4UXJA 3UWKA 4DB2A 5FL7A 3RC8A 1JEDA 1CJMA 1OH8A 1JQJC 1T8TA 2JLQA 4D6PA 1AK2A 2HDNB 3HWSA 3TSOA 4PAMA 1N3BA 2RHDA 4N1AA 5JEDA 3B7GA 3B82A 4R71A 3K0SA 1F2TB 3L8ZA 1H8EA 2QM7A 4ARZA 3FKQA 4ZIRA 4QHYA 1KI7A 1RYHA 3NC0C 3BFKA 3AF2A 1ZIOA 2F43B 2VF8A 2ZYTX 2D7DA 4LJ7A 4H1VA 1AZTA 3A4LA 3FE2A 5L3RA 4Y0VA 1XTRA 5FUYA 1CR1A 3RWMB 4DSTA 3MCAA 3PIRA 1P60A 3W8NA 3HU1A 4M9SA 4EPYA 2YNMA 3GJ5A 3SJBA 1I4LD 3Q9LA 4OI2A 3EX7C 1E2FA 3KL4A 1FZQA 3EZ2A 4DBLC 1VYVA 5F9FA 2BHRA 4E09A 5BQ5A 5B64A 1LF0A 1P6XA 2FSGA 2QY9A 3NEJA 3QKUA 3MWJA 4C0BA 4ZCLA 1KDOA 4Q66C 3DO6A 2CDNA 3KZ1E 1VCIA 3OEED 4Z8XA 1JJVA 2WIBA 5KO2A 4PXAA 4B3FX 1F5NA 4BRWA 1X1RA 1OIXA 2ZE8A 4B3CA 1UM8A 3HPRA 2PBRA 3RS4A 4KLNA 3U6KA 4P4UA 2ZRMA 3ZZUA 2UKDA 2JAQA 3ZQ6A 4BRUA 3QPVA 1E4VA 2WMNB 2ZYVX 2RCNA 4EJSC 1RFLA 2A2ZA 2AWNA 4HUQA 1SZPA 3TIFA 2ZQ5A 4F91B 4RD4A 2AXNA 3GJ4A 1IN7A 2GRJA 2G3YA 3LD9A 1EGAA 4OJQA 4PSKA 2WJJA 5JRZA 3CM0A 5FOTA 2F7SA 1XEFA 2GVZC 3W6NA 3NVAA 1KDRA 4TQ9A 5KUTA 3QENA 5EXTA 4BECA 1F2UA 3JZAA 4A6PA 1QG4A 1X8LA 4JBWA 1H65A 4TYNA 1R5NA 4AYXA 4KLZA 1M34E 1N5LA 3DMDA 3KXKA 1GZSA 4Q4HA 4CZ2A 1W0JA 3AF0A 2P5SA 4X8MA 1L8QA 4MKFA 4QBHA 3W34A 4YMUA 1OH5A 2H5EA 2CCGA 4Q7LA 2J0UB 1G9XA 2O52A 4LPKA 3TH5A 4YMVA 4US2R 3Q3JB 2FSHA 4WA7A 2C78A 2OFWA 2BBSA 2FFHA 2HLDA 1KYIA 2ZUDA 2R6GA 2YINC 1E2QA 4DKXA 5B57C 1E2MA 2OAQ1 1Z5ZA 2ZREA 3OFND 2BCGY 4JL6A 4PFSA 1JNYA 1CRPA 2PEYA 1G8HA 1NBMA 3LA6A 1D6JA 3EPKA 1E1QD 1SHKA 2R2AA 4LYAA 1TAGA 2XITA 1VYUA 3OAAA 4NONA 3T12A 3QBVA 1JR3E 4L9WA 4EPRA 2ZRNA 1DTSA 3WHKA 3NBZC 1PUJA 2G9NA 3R8CA 3CLVA 2MSEB 2DB3A 1WA5A 5JS7A 4XVQA 4RY2A 4A6XA 4RCYA 4DHEA 3QOFA 1SKYE 3VR1A 4LV6A 4CEJB 3O8DA 3HR7A 1Z0IA 1Z47A 3L0PA 4E07A 2BMJA 4KAXA 2YV5A 2RGXA 1Z6YA 3KUCA 2C8VA 4PHHA 2NO9A 1KSJA 4L8GA 4QRHA 4ITRC 2Q0HA 1Z29A 1XJQA 1NJGA 1F6BA 3A36A 3B1VA 1TQ6A 2BIFA 2QPOA 1QRAA 2RGAA 2I1QA 3GFPA 3GJ8A 4LCBA 1A2KC 4EDHA 3QG1A 2BOVA 2J0QA 5HR5A 4QXAA 4P31A 3DL0A 1R10A 3BORA 3T06B 3GPLA 1QHHA 2VSOA 2D06A 3KFXA 1M8PA 3DM9B 4B2PA 3ONWA 3H86A 1AM4D 2CBZA 4XVUA 3HU3A 3NXSA 3OIUA 3Q72A 1O87A 1KO7A 3CZQA 3PUVA 1E2IA 2O0JA 4JLJA 2W83A 1E1RD 3W5IA 3EA5A 4O2RA 4WZBE 4XSHA 1FQJA 1P9WA 3KX2A 2GCPA 3SFVA 3QKSB 2P67A 5KSOA 4OBEA 4QGHA 5B30A 1GWNA 3HR8A 3TQFA 4NYIQ 4TMZA 4NCJA 121PA 1SVSA 1T9HA 2BWJA 2F6RA 2IUSA 3TMKA 1Z0FA 4D4JA 6Q21A 3K0EA 4AG6A 2BMFA 1F3OA 3P20A 5L3SA 1E9FA 1Z08A 3X2SA 1P72A 2JJ2A 1GM5A 1A2BA 2NZJA 2XJ9A 4OI0A 4OI4A 4A0FA 3BB4A 5AJVB 1R0WA 5DNYB 2R8RA 4IVPA 4P4TA 1ZD8A 1GUAA 4KXFB 2H8KA 1KI1A 3LDAA 1Z0DA 1G3QA 4BLOA 2LWIA 2RMKA 1HEIA 2NTYC 5JMTA 4DXAA 1QHXA 2V6JA 3GP8A 2F1JA 4DLVA 3X1ZA 4A8JB 4TMVA 1N0UA 1S2MA 2IXEA 4EJSA 5P21A 3EARA 5GJWC 4B3GA 5CB6A 3O8CA 1ZU4A 4B47A 1W0KD 2FNAA 4JMPA 3WRXC 4IXNA 2ZVPX 1VKJA 1YR6A 2GXSA 1OXVA 4DDUA 2OXRA 1NN1A 2WZQA 4KI0A 3VR6A 1U90A 4IDPA 3WNCA 4ERNA 2ZI6A 1GRRA 4CT4B 1S1MA 5CYPA 3VKHA 1AGRA 3NC1C 1MH1A 3RC3A 2EYQA 3RSOA 4B48A 2PCJA 3QEJA 2F43A 3PITA 3Q5EA 3Q8XB 2ANCA 3FYHA 4TN1A 4AYWA 1W0JD 5D3MB 4DRZA 4X8HA 5FTLA 4WBSA 1UBEA 3RS7A 4AG5A 3KQNA 1L4UA 1M6NA 3ADDA 2AR7A 3E5HA 3OIVA 1W36C 4Q1DA 1VIAA 2IS6A 2QUZA 3KTAA 5HE8A 5HKKD 1GRQA 1EFCA 1XTKA 1FMLA 1YQTA 5GVSA 2J41A 1GL6A 2ZRPA 5AJYA 4A4DA 3KJHA 1G291 3I32A 2UZ3A 2WAYA 2G88A 621PA 5JI3E 4PQYA 1NG1A 3PENA 3B5JA 2HF9A 1ZUHA 4FMBB 3CR8A 1U98A 1O3YA 1Q20A 2IYRA 1N6RA 4ZDJA 4ZO4A 4YXWA 1Q44A 3FMPB 4LHXA 1EK0A 2WMOB 3CBQA 1G3RA 1MKYA 4C7OA 4HAVA 3IPYA 1S3GA 2GBLA 2P3SA 1KJZA 4W9MC 1OT3A 2CVHA 4LRWA 5EP1A 1ZD1A 2Q3HA 4PPFA 1S9DA 4N3NA 4M8NE 3ZVNA 5AWFC 4PQFA 4UQOA 2OEPA 3P4YA 4RD6A 2W0SA 2ZTSA 2C2HA 2WBLC 4I99A 4NH0A 3TNFA 3GJ7A 2HF8A 3DMNA 3CH4B 2QMOA 2ZSFA 3AP2A 3U3OA 1QHGA 2EFGA 1IJEA 3EZFA 1HT2E 1W7AA 3EWAA 1P3JA 3AF3A 5FI0B 1W36B 1CS4C 1NL3A 4DB4A 4IVQA 1GOTA 2WKRA 2ZJBA 4AKEA 4JVLA 5BN3A 2IBMA 2OXCA 3ADKA 5JCPA 2CHVA 1XEWX 3D7MA 1RPZA 4PQRA 5FPTA 2ZRKA 2D7CA 4BZQA 3ND8A 4QGGA 3TQCA 3VHLB 4LY6A 3RAPR 1II8B 2A9KA 3AF1A 3B85A 2R6FA 1T3LA 2ZXUA 5LD2C 1TPZA 2J3EA 3OZXA 4JKYA 1Z22A 3W90A 2R6DA 1XXHE 2H57A 2ZM5A 2DFLA 3RLFA 1M7HA 5DYIA 4B6EA 1EWRA 4A15A 2GETA 3QEOA 2FZLA 2ORIA 3PXGA 5B2ZA 3KKPA 2PX0A 3CO5A 2ZSDA 1I2MA 4A2WA 2VPPA 3GJ6A 4I1UA 4TMKA 2OCBA 1E2KA 2KJQA 3SR0A 3RS0A 2IUUA 1UDXA 2J9RA 4UNSA 2WWHA 1XP8A 2QE7A 1W4RA 4UXHA 3QG5A 4M1MA 3KDSE 4DLYA 1ZM9A 2Z83A 4OJKA 1BKDR 1NIPA 4EQ6A 3TSWA 4DLRA 5KPJA 3QXJA 4GSYA 4W7SA 5HPYB 4M1TA 3QXHA 4TQAA 1NLYA 5KNDA 1OXSC 3RVBA 3TAHA 1TEXA 4M21A 4CEHA 4M1WA 1G20E 5HE9A 4YDHB 1COWA 3WMFA 5JECA 4AC9A 1GKIA 1HTWA 3C15C 2XZOA 1UKEA 5L3SB 2XZLA 1F2TA 1BMFD 1XMVA 5EP4A 1J2JA 2C95A 2YZ2A 3E1SA 2PL3A 3FOZA 4OQMA 5EE9A 4QC2A 3T61A 3UATA 2CHGA 4NYIR 4MRNA 2KWIA 4MUBA 4QM6A 1XD2B 2XOKA 4WZ6A 3WMGA 4BGDA 2FWRA 3TUIC 3FVQA 5EP3A 2IF0A 1FP7A 3WMEA 3K70D 1G64A 1NVWQ 1JR6A 1XD2A 4MRVA 2V1XA 2H18A 3WY9A 3PEWA 3WP0A 1CIPA 2QEQA 2OZEA 2CCJA 1ZC3A 1NVUQ 2ZR0A 3QJYA 1DS6A 2F55A 3S1AB 3B8HA 1NP6A 1SXJC 3BIFA 1G4UR 1YR9A 2CK3D 4GP6A 4ASUA 1C1YA 2DYKA 2V1UA 1MABA 1TQ2A 2G0TA 4MA4A 5FUXA 2BBTA 1UEJA 3K9GA 3BAFA 4L16A 3R7WA 3ZQJA 1CU1A 2OBMA 3P1JA 5BXQC 2WWYA 1KY2A 3KB1A 4TQUS 1NY5A 5J4YA 3BERA 5SZHB 2X19A 5CYOA 3EPJA 2G1KA 4A8JC 3U3JA 1KO4A 2HXYA 2XAUA 4DDWA 4Q4LA 1FUKA 2W6JD 4W5HA 3C5HA 4U00A 5GADl 4HAWA 1DE0A 1OW3B 3VAAA 1KDTA 1YR7A 4LHWA 1P2UA 1P2SA 3SNHA 3THYA 3TW8B 3FMFA 3KFVA 4PSVA 2WOJA 1G41A 4Q00A 2JJ1D 3PEUA 1FUUA 3LH5A 3Q5DA 1YVDA 1KAOA 2ZITA 2GXQA 3IBYA 4PC6A 4F4IA 3FHTA 1OIVA 2H7VA 3TR0A 2ONJA 4D82A 4ZV4A 4P33A 4P0TA 2VP0A 3W3ZB 2ZSBA 1MOZA 1KO8A 4HZUA 4GNKA 4TMXA 4OHYA 1RRGA 2EU8A 4M4SA 2X2FA 4GZMA 1WP9A 3UMSA 3B1ZA 3O8RA 1ZAKA 2GJAA 2VO1A 3AVTA 3VNUA 3LLUA 4DZZA 2PT7A 4JLBA 2QN6A 3GLHB 2ZJ8A 1AIPA 2ZPTX 3HYTA 4ESHA 4U02A 3SQXA 1IY1A 3AQ4A 3A6PC 1KJWA 1R6BX 4RD3A 5CDFE 3PV0A 2V8OA 1MO6A 1FPMA 3BH0A 1NI3A 3NWJA 3E70C 2FPMA 1E9EA 3GQBA 2A5GA 1N6HA 3W6OA 1N25A 1J99A 2R62A 4RFSB 4BZPA 2AD1A 3U4QA 1MO3A 1EFRD 2RGBA 3H84A 1TEVA 2CCKA 2ZSAA 3BXZA 2QQ0A 2ATXA 3GLFE 3VU9A 4OK6A 1VECA 1U0HC 5J40A 3CWQA 3LBHA 4B73A 3DZDA 3T1TA 4DC9A 4QKQA 5KNBA 1SXJE 1FMJA 3NBFA 2GESA 3QKSA 4TSFD 4TL6A 4JYCA 5GJBA 4NTZA 2GJKA 3VKGA 3I5YA 4DLZA 4YC7A 1UEIA 4GBMA 1KI9A 2GDJA 2Q21A 5J47A 5G40A 2KE5A 2RB4A 3HYRA 3V9PA 1HE8B 5G3YA 1AS0A 4YXWD 3MLEA 3B1YA 3NDPA 4A2QA 1PLLA 2O8CB 2QGNA 1R0ZA 4NYJQ 1U8YA 4URZR 3TUJC 2ZS8A 4NYJR 4GFDA 3V4FA 3F5FA 1G4AE 3A1SA 3NKVA 5FPKA 1CJVC 1NKTA 4J0QA 3I1FA 2JLWA 4WZAE 1ZINA 4LHZA 4WIAA 4Y0AA 3SJCA 3SJZA 3GLIE 4BEJA 4V0NA 5HKKA 2BBWA 1H8HD 1S0UA 1DAIA 1KOFA 5EP2A 4LJYA 5KSYA 4NPHA 4C0QC 1PJRA 3VR2A 4TLAA 5F98A 4RZUA 1LFDB 4F38A 2J45A 2JLUA 2WSSA 3CRQA 1E2GA 4TWZA 4QHSA 5JSZB 3LO5A 1N6PA 4OQLA 2CLCX 4LSGA 3RRZA 2XTMA 3AGPA 4I1OA 1LS6A 5FL3A 2NO6A 1EESA 2ODWA 1P9NA 2UZIR 1WXQA 1K5GA 2QT0A 3MG9A 2O0HA 4OHWA 3ZH9B 3QQ5A 3L82B 3FMIA 3B78A 4KYUA 3ZVRA 1XU4A 4FCTA 2XXAA 3CX8A 1W47A 1Z6AA 3VR3A 4V0LA 1OLOA 4C7OB 1MRNA 3BJIC 4PHFA 2CLSA 1JI0A 2L0XA 1DAEA 1L4YA 5CJ2A 1HA3A 3K09C 3GLIA 4YMTA 1KTVA 4LOAA 4D4MA 4URWR 2HXSA 3DHWC 2FGKA 1LTQA 4IDHA 4LJAA 3SBEA 5H70A 4HLDA 1MR3F 3I3SR 3A58B 3MD0A 2ZSEA 2ZAOA 3SHFA 4KFTA 1FFHA 2QBYB 3WP1B 1L7VC 3BGWA 3DEFA 1OHHA 2Z5FA 1QHHB 5GJCA 5E7IA 1IN8A 2X77A 2IS1A 4XVRA 4FINA 2GA8A 4QBIA 4TMWA 5LBIA 2ZU0C 3MGCA 1TF2A 1E9CA 4E5UA 3GFOA 2JEOA 4PPGA 2NPFA 3BFXA 2VHCA 4D26A 1WBBA 1OE0A 3WBKA 1RZ3A 1SVLA 3CKLA 3TRFA 3VR4A 2HV8A 2XJ4A 4KYIB 4XJXA 2QA5A 2JJ2D 2XNSA 3CNNA 1LY1A 2VSFA 4IEEA 5FFMA 1GTVA 1MO5A 2REBA 2J0VA 2H16A 2JLRA 1UBGA 1GAJA 5LDDC 5LPNA 2GEUA 2F3TA 2A5FA 4C2UA 1XMIA 2AHOA 3ICEA 2P65A 3D6TB 4XSGA 4MKGA 2WJYA 1OFIA 2XX3A 5FBRB 3KJGA 5H68A 4A0RA 1U0JA 2WJHA 4S35A 4BFZA 3F3YA 4BEBA 2FDCA 1JECA 3FFBA 2QG6A 2OCAA 1CR4A 2FPKA 1KI2A 2F1RA 1QG2A 5EXPA 2SHKA 3THWA 3LW8A 4P3YA 3B1WA 3BWDD 4M53A 1YE8A 4JLOA 3VX4A 4B2IA 1G8PA 5CK4A 3LX8A 2B8TA 2C9YA 4URVR 1PZNA 2ZJ2A 4TYQA 1W4BA 2NIPA 4FWTA 2I3BA 4POAA 4NYMR 4BASA 3GJXC 4M9XA 4CDGA 1RKBA 1XMSA 3EZ9A 1EFUA 5IRCD 2FPLA 2NO7A 3ADCA 1XTJA 2MSCB 4V02A 4JSTA 3PEYA 4HDOB 1ZP6A 2P0EA 4MRSA 3BFVA 4TTRA 3QI2A 5JCZA 2GCNA 4CEJA 2JIZA 1E3MA 3O8BA 5EE5B 5HZKA 1XZPA 4IHQA 3ADBA 2QU8A 2XOKD 1TQ4A 4C3ZA 3SN6A 3TKLA 4CF7A 2O0KA 4M2LA 4ZIRB 4UNRA 1KMHA 3CRW1 4P32A 1T6NA 1XMJA 3T34A 4G1UC 1E4YA 2A5JA 2IC5A 5E7JA 4TLCA 2VQSA 2KSQA 4PAOA 3TUZC 1RJ9A 4C0JA 1W44A 3KKOA 2FGJA 1YZTA 3TVTA 2YOHA 3KQUA 3L0SA 1XD8A 2WWFA 5DE3A 3K53A 1Z06A 3B13B 4HB0A 2OLKA 3CB4A 1TTTA 2IYQA 1KSFX 3EASA 4DLUA 2J1LA 5C2JB 1GL9B 2WVJA 3LXRA 4MGZR 3QNUA 4DT1B 4LGMA 3CRVA 4O0MA 2DWOA 3L2OB 5CM8B 4B6FA 4RJLA 4EKDA 4DDVA 5FOWA 2HJVA 1T91A 1TNDA 3V00A 1A7JA 1ZUIA 4B75A 1KI6B 4LUCA 4L9SA 1KO1A 1Q22A 1IXSB 2VH5R 3QXXA 3NBXX 4EIWA 3RRYA 3RYTC 1GKUB 5JRJA 2NMVA 1RC8A 4OKSA 2NGRA 4BFXA 2GAOA 5AUQA 1CR2A 4KHZA 2IHBA 4IRUB 1MRSA 4R2HA 5SZIA 1NMYA 3ICQB 2QBYA 3BC1A 3G0HA 3AVWA 3FPAA 1Z0JA 4BQSA 1TF7A 5JBQA 2N1BA 3AV0B 3B9QA 2JA1A 1EFTA 1NJFA 1T3SA 4V0ME 2FZ4A 1US8A 1DAKA 1E2DA 1OFTA 2WAXA 4K81B 1R0YA 2GXAA 3QF4B 2RKOA 1PLJA 1Q1ZA 2ZE5A 1DAMA 3CX6A 3DKVA 3KKMA 4XTCS 5J4KA 1AGPA 1ZNYA 3IKJA 4B34A 1OXXK 1NNEA 5C1BA 1Q57A 1JJ7A 5AUPB 2X2EA 2P2LA 3MWYW 1SVKA 3VNVA 2GHIA 3QBTA 3IHWA 4UJ5A 3VX3A 1G6HA 3TK1A 3NHBA 4RVCA 5M04A 1OYWA 2J7KA 2OV2A 2IEYA 2KB0A 5IDVA 5IK2D 1II9A 4XH9B 3U61B 3OIYA 4PHGA 1KI3A 2CK3A 1S1CA 3RANA 2WOOA 1IONA 2ZRCA 2CE2X 4FMDB 2QI9C 3F0TA 1GP2A 1KMHB 4DLSA 2XTNA 2AWOA 2ZEJA 4MRPA 2Z4SA 1E2EA 1I4TD 2WHXA 1UKZA 3U2QA 3KQKA 2IS2A 2CE7A 2P6NA 4Q4HB 5E4FA 2OAP1 4Q01A 2ZUBA 3U7FB 4TL7A 3N70A 2ZI9A 3UMRA 2V55B 1F2UB 5DISB 5IK2A 2ODBA 4Q5IA 1E2LA 2FU5C 3I8XA 4JLDA 2N42A 3WYFA 1TUEA 2CVFA 4JVNA 2OFXA 2W6ID 4GL2A 1W1WA 2VA8A 3THXB 5TXGA 3LNCA 2MMGA 1QHYA 4O2LA 1VG9B 4D4LA 1U2RA 2PMKA 3B6EA 2IYWA 2RH5A 3KUDA 4Q19A 1NN5A 3GLHA 4QG7A 1N6LA 2GXUA 4Z51A 2R65A 4TL8A 2J7PA 1S3SA 4HB4A 2GWHA 2J87A 2AD5A 2AL7A 3ZGXA 5ELXA 1SKQA 3AVYA 4LWZA 4M1SA 1E1QA 3R20A 1GVNB 1RVDA 1RYFA 2C03A 4MQBA 4BLRA 2B7CA 2GKSA 3IIKA 2QTVB 4URXR 3CR7A 4B3DA 4NL4H 4P4SA 1XNJA 3P32A 2ZR9A 3U3MA 1B23P 1GNPA 2Q3FA 1W46A 5BYJA 5KYKA 3AF4A 1Z0AA 2ZRBA 4PHTA 4LYFA 4XTRA 2HUPA 4FI3C 4DCVA 3LVRE 4PO8A 3N2EA 4HLUC 2RHMA 1G5PA 1ZM3A 2HT6A 4TTPA 2OM2A 1PVOA 4ZCMA 2O8EB 2BEKA 821PA 2ZIAA 4Q1AA 4HLUA 2ZRFA 1OF1A 2QT1A 2ZRDA 3BK7A 5FI1B 3VR5A 1XPOA 5JWHA 2WIAA 4Q03A 2ZRAA 1XEWY 2CMKA 4ZPXA 4NCIA 4G5QA 4G5OA 4AYTA 4YQFA 1XCPA 2IHYA 3RHFA 5JWOA 3THWB 3NHAA 1P9RA 4PPQA 3W8RA 3BD9A 5DI9A 4OQFA 2DFTA 1JAHA 5KTYA 1DOAA 1AQYA 4KFRA 2VIIA 4MDEA 2ZANA 5DI3A 1G8FA 1E1RA 1KK2A 2C98A 2XNDD 3HJNA 4PANA 1NVVR 2ZJ5A 4G5SA 4M1KA 3GLIB 1NMXA 1AJEA 2IYYA 2ECKA 2AKAB 2WKPA 4URYR 4NCNA 2MMCA 4KSCA 4B74A 2LKCA 1R4AA 2A30A 4JJZA 3I5XA 2P5TB 2A78A 1E94E 3GEHA 4WOPA 1SGWA 2TMKA 3HPQA 1XPUA 2VBCA 1P2VA 3OIWA 4V0KA 3N5CA 1QF9A 3UPUA 2NQ2C 1IN4A 1UPTA 2QSZA 4BFTA 4JLKA 2FSIA 4A2PA 3T35A 1KGDA 3DPUA 4LJ6A 2W6JA 1N6NA 4HUQB 5JEEA 3EA0A 3KB2A 3ZS9A 1PV4A 5AJWA 4HI0E 1ZM7A 3RS2A 1JQLB 2IYUA 4R9UC 4C0AC 1N5IA 2IYZA 2F3RA 2B8WA 3KJEA 3GLFB 1T4GA 2IF2A 4KO8A 2NOAA 2W00A 4QL3A 1KI8A 1NN0A 4IOLA 4YONB 4JSYA 1RE0A 4TTQA 1P61B 4LI0A 3BRWD 4HATA 3TGPA 2QSYA 1NBMD 2Z4RA 4E22A 1IBRA 1SVMA 1E0KA 1EG7A 2EWVA 2JCSA 1J90A 2BMEA 2OO7A 4HYYA 2ZJAA 3AUYA 4G5RA 4AI6A 3WNDA 3ETLA 3IO3A 2VHQA 4LBZA 2QORA 5DSZA 5SZKB 3H0KA 3GLHE 2LKDA 2GJ8A 4PAQA 3L0IB 4HB2A 4D2IA 4A9AA 4YLGA 3AP3A 4QGAA 4IVRA 4RKFA 5BYKA 1KY3A 5KNCA 1VDZA 1KDPA 2CHQA 2JDID 4Z1MA 3IEVA 3MRSA 4I1SA 4DCUA 4TYWA 4QNRA 2GF0A 1KHTA 1JR3A 1JPJA 5EZ6B 3ZD7A 5BN5A 5FH9A 2J59A 1GSIA 1Z0KA 3JVUA 3DOEA 1X1SA 5B58C 1G7TA 1JALA 4DT1A 4MRRA 1DPFA 2J46A 4CVNA 4BZXA 1UBFA 4F7WA 1GRNA 1P4SA 3VKWA 1FX0A 2QE7D 1AS2A 1WQ1R 5LB2A 4DLWA 3QUSA 4NYMQ 4E03A 1A5TA 1UJ2A 4LYHA 3ZVLA 5EE0A 4W5WA 1JR3D 2FJUA 1ZMXA 2CL0X 3ASYA 1GFIA 1KI4A 1XZQA 2XB4A 1RJ9B 2V4ZA 4B3XA 1ZCBA 2N46A 5DIFA 3SOPA 1PUIA 2YJTD 4I4LA 1Z28A 2EFDB 2JIZD 2ORWA 1U99A 1Z2AA 5BN4A 3GD7A 3IO5A 4WW0A 1CTQA 1G5RA 4BUJA 3SEAA 2ONKA 2O8EA 2OFOA 2XGJA 1K6MA 4D80A 3QPWA 1T0JB 4PX9A 3QXCA 4OHVA 1YJ5A 2YC2C 1IOZA 2EFCB 4ZKEA 1YHNA 1Z6XA 1N2CE 1EFRA 3I4LA 4KBGA 3EWSA 4OQXA 4LJ5A 2ZRJA 2NZ8A 3P4XA 1DG3A 2EQBA 2W58A 4XWKA 1HURA 1JEEA 4HSEA 1W2HA 3K0AA 1FW6A 1Q3TA 2OLJA 1AN0A 4DSNA 4DJTA 5G41A 3BB1A 2J7PD 3OEHA 4HDCA 4I1VA 2QAGA 2DWQA 4MGIR 4IDQA 1UKVY 4TSFA 3SS8A 2IW3A 4B2LA 5HZHA 2OG2A 4MITA 1DAFA 1KNQA 4Z1MD 3KXIA 4IFBA 1R5BA 1QVAA 3I61A 1G3UA 1WDTA 1RIFA 2IYVA 3CNOA 3W5JA 3U44A 1G3MA 4Q4JA 4ZKDA 3RS3A 2XSZD 5FPSA 3PUYA 5EUQB 2W2TA 3SBDA 3EG5A 1RRPA 3NBYC 2BCJQ 4TZ0A 4AKHA 1U8ZA 3Q85A 1ZNZA 1BIFA 4OHXA 5DLQC 4D0GA 1C4OA 2AK3A 2VP4A 1GILA 3ZIAD 2O8BB 2FMXA 2QPTA 3U6BA 4KVAA 4MYCA 4JLMA 4NDZA 2ZUCA 2H17A 4EFMA 1U81A 4NKRA 1U8AA 1G8YA 1KSGA 5SZJA 4GT1A 3GLGA 1EXMA 1RRFA 4C9BA 1VHTA 2OT3B 3X1WA 1W4CA 4DEXA 1NSTA 1LS1A 1XXHB 1ZNWA 4Q9HA 3SHWA 1XPRA 1G7RA 1AKYA 1CULC 1EX6A 1H8ED 4KFUA 1OXTA 4B35A 3X1DA 2QENA 3CONA 4DCSA 4DWJA 4Q9KA 4KITB 4RFSA 1II0A 3CUEF 3ZZ0A 2A7QA 1OH7A 3FB4A 2QP3A 4GOXA 4QJ3A 3JZMA 4S2EA 5A4JA 2QAGC 1FP6A 2CJWB 1GL7A 2ZROA 1E98A 3PJRA 1G21E 2H1LA 4NCKA 2EFEB 2E1RA 2GEVA 2IA5A 4FCWA 1CEEA 2JASA 4HAUA 5KOYA 3BH6A 2IYLD 2W2XA 2DR3A 3OAAD 3L0OA 3VQTA 5LD2B 4B33A 5JS8A 4O25A 4FW9A 4V0OA 1HH4A 2FX3A 3R8FA 5JJIA 4IW3B 1FOEB 5C18A 4B76A 2D62A 4MYTA 1COWD 4RD2A 1VTKA 1P73A 4OK3A 1ODFA 1US8B 1VCMA 2IUTA 4MGYR 3ZD6A 3I73A 8OHMA 1LVGA 2ZRLA 2ZI3A 4C0KA 4N0DA 2PX3A 2WSSD 1E9SA 4FMCB 3TVDA 1TL7C 3GMTA 3OHMA 3KQHA 5E95A 3PVSA 1T3HA 3AVOA 2V54A 3UWOA 1NY6A 4PC3A 1A1VA 3AVXA 2QRNA 2OE2A 4IDOA 1CBUA 3EIEA 3P27A 3QPUA 5CJPA 5FTNA 2ODNA 1WMSA 1E2HA 1XCGB 3FFAA 3PQCA 3D3QA 4GRAA 4QGFA 2DHRA 1E9BA 4FD2A 2YWGA 3B60A 4NZYA 5GVRA 1OPXA 2VL7A 4ZCIA 1QBKC 4A0HA 1DO0A 4X8OA 1TX4B 2P6RA 1N0VC 2MSDB 3QKRA 1WBDA 3IDQA 2QTFA 3FWYA 1BYUA 4ILEA 3BE4A 4KV9A 3THOA 4RFVA 1DG1G 2F9LA 1K5DA 4KODA 1ESNA 3PEVA 3CF2A 3MSXA 3EIHA 4CEIB 5C46F 1LV7A 3CPEA 4NMMA 4JL5A 4KSBA 5KPDA 1AZSC 2VEDA 5FPYA 4DSUA 1BYIA 2VF7A 4CEIA 4V03A 2G6BA 2G77B 1OKKA 2WWGA 3L8YA 1G8GA 1XX6A 2E87A 2FG5A 1AQUA 3IIMA 3OEEA 4M1YA 1OV4A 3U44B 1ZJ6A 4RCZA 2GBLC 2OSBA 1GDDA 4LYJA 5FR1A 5KDDA 5FUVA 1JAIA 1SULA 3WNBA 4F93B 1N6IA 3A4MA 4GDFA 1YRBA 2RGCA 2WJIA 2IS4A 1T0HB 1ZIPA 2J0UA 2YOFA 4AD8A 3IQXA 3K9LA 5IT5A 1R0XA 1XF9A 3OEHD 4UNNA 4PZLA 5TARA 3U7GA 2ORVA 3EC1A 5FTKA 1HY3A 5TY0A 5TB5A 2PLFA 4LHYA 4FN5A 2FH5B 2HJGA 5JZVA 2V7QD 1E0AA 3NTUA 4UNQA 3AB3A 1U94A 1ZBDA 2G1JA 2QZ4A 2WM9B 4C0LA 3SC3A 4TYPA 1D9XA 2GK6A 3ND9A 4JLAA 1VG0B 3GJ3A 3CW2A 4CRWB 1KMQA 1SXJB 3MUFA 1EWQA 3I72A 3UKDA 3DDCA 2IX3A 4FIDA 4TLBA 1AKEA 4HLCA 5FL7D 4Q1EA 4M22A 3WHLA 3D8BA 5FOUA 3ASZA 3DM5A 4QOSA 3QY0A 4FMCF 4EAQA 2XSZA 1P5ZB 5DHFA 4JT2A 4D25A 4Q9JA 4IOKA 4XD7A 1CJKC 1HQYE 1M2OB 1HE1C 5KHOC 4LBYA 4ZI2A 3TR5A 1E9AA 1XRJA 2QAJA 4R2IA 5IF9A 1F48A 2BDTA 4Q02A 5TMPA 1ESMA 1Z2CA 2AKYA 3TJZA 2OILA 2G83A 5G3ZA 1ANKA 4PC1A 4ACBA 2AXPA 3HP1A 3FTQA 3L43A 2KI5A 4Q4JB 4HEJA 1OKKD 3DZ8A 4MGKR 3CWZA 3U3RA 1E96A 2JJ8A 1IN6A 2IL1A 4EPXA 3CPJB 3CF0A 5HCIA 2OCYC 3A1WA 5KDOA 2V9PA 4JZKA 4MDFA 5BWMA 2WJVA 2ZJOA 1FNNA 4JS0A 1AA9A 2AFIE 3OFNA 1XEXB 1Z8FA 4K8OA 1FL9A 3GEIA 2QL6A 2WICA 2XZPA 5A0FA 3X1XA 4DUGD 1NN3A 4Q1CA 1R8QA 5IHPA 4ABYA 2YKGA 1OSNA 2GCOB 2VHUA 1Q3HA 5CDFA 2DCUA 2PZGA 4Q4AA 1NG9A 2Y8EA 1G7SA 2F1HA 4JL8A 1I2DA 4C0HA 2ZRIA 2BM0A 4NP6A 2C5LA 3NH9A 5JLJA 4DVGA 2DY1A 1KK1A 2EW1A 3QF4A 2ZI7A 2D3WA 3EIQA 5DGXA 1TADA 4W5JA 1W49A 1GKYA 3T1QA 3SYNA 1UFQA 1Y3AA 2Z43A 3LXXA 4H9GA 3GLFA 1W36D 1SQ5A 3LLMA 4D4KA 2RGNC 3C8UA 2GTPA 1R7RA 2Z6VA 2IEZA 5FOXA 5H1YA 4DDTA 2FOLA 2HYDA 2ZYWX 4XIGS 4AKGA 1R2QA 4G5GA 1WB9A 4GPTA 1E0SA 5FUWA 5KSPA 3EZ7A 4B3BA 4CYMA 1FTNA 1VIYA 3K9NA 3RDPA 3AVVA 4C4PA 1GNQA 1HV8A 1M7BA 4TMTA 5K8IA 1HT1E 2GVDC 1CJUC 1XTIA 1CXZA 3U7EB 1HYQA 2JATA 2ODEA 4CGZA 2ZJYA 3K70B 3T1VA 1KK3A 1OIWA 3M6AA 1DADA 1LW7A 3RNLA 4DLXA 3R9XA 4LPSA 1SVWA 2QP4A 4JJKA 5JFGA 4MYUA 1Q21A 1G3IA 1NBME 1D2MA 3PUZA 1KIMA 5J4LA 1XJCA 2C9CA 1FQKA 4HAZA 1CLUA 5EJEA 1MABB 1QHIA 4ZDIA 1E0JA 2QTHA 1E79A 3HDTA 2FFAA 4Q47A 3SQWA 4G01B 1T5IA 3KKNA 2FF7A 1KKMA 2ZS9A 4RZXA 2EWWA 2NO1A 2PZEA 3TAUA 4XWOA 2FEOA 1SXJA 2G0NA 4JVMA 4AK9A 3THXA 5HTKA 3AKCA 4QJ5A 1N0WA 1YR8A 2FV8A 5C4GB 1S96A 4XWAA 3T5GA 4BFWA 2YC4C 3C4JA 4PPNA 2ZE6A 1UF9A 1WCV1 4Q9IA 2I4IA 5L3QB 1BO6A 4ON9A 1NSFA 5K8LA 1KKLA 3RRMA 3QVVA 3DOFA 2VP5A 5L3QA 3KXLA 1XCMA 4L4UA 3AH8A 1X8JA 3TE6A 5F9HA 1QHSA 2EFHB 2QRZA 1CR0A 4P4SB 2YHSA 1QDEA 4M0LA 4A92A 3Q7QA 2ZRGA 4RZ2A 3PFIA 4ARZB 1YZUA 1J70A 1UDWA 2AX4A 1VCOA 4US1R 1RRCA 4IXMA 3BOSA 5CIWA 3UG7A 2O8DA 1W5SA 1P7CA 1Q1QA 5DO9A 1YZLA 5E7MA 2BV3A 1KZ7B 3M4YA 2KBEA 2R6AA 4HZUB 5FOVA 1NF3A 3UANA 1IHUA 1WF3A 2DPXA 4HAXA 3B2EA 3LX5A 1CP2A 1EX7A 4JBXA 1Q1BA 4IDNA 5JJKA 3MAAC 3K0CA 1KK0A 2ZYUX 4ESVA 2B7BA 3GJ0A 4B44A 3KJIA 5TV2A 1IY2A 4R98A 4URUR 3VMFA 3FKSA 1ZVQA 3QKRB 1N5KA 2OESA 2RGGA 3KTAB 1M1YE 1XJ0A 1II8A 2FA9A 2XEXA 2FE4A 1ZCAA 4A1FA 1D2NA 2HLDD 3OESA 4LDJA 4RZ3A 2OBLA 4CT5A 3AKEA 4XOIA 1UAAA 2WSMA 4LBVA 4II7A 4GOJA 4HLQB 4LHVA 1V43A 2JLSA 1TU4A 2P6UA 2WV9A 4BPBA 2ZJZA 1W2GA 4UNPA 5KU1A 4DSOA 1DELA 2K5UA 4A0GA 1KZGB 5JHGB 1KJYA 1WRBA 4TT3A 3K09A 1ZM4A 2X1VA 4US0R 1NRJB 3VFDA 3DVLA 2WWXA 2ERXA 3REGA 4GZLA 2B6HA 3AKDA 2HYIC 4PC2A 4IEIA 5FR2A 4DUGA 3IHLA 5ANRB 2O8FA 3GLGE 2VSXA 1E9DA 4EFNA 3CF6R 3CRRA 5JHHB 3U7HB 4OL0A 4PO9A 2ZI4A 4QJ4A 1G16A 1F60A 3LV8A 4AURA 4X8LA 5J4HA 3MJRA 1ZC4A 2WTUA 1Z63A 3BS4A 4EJSB 1VCNA 2XXAB 1X3SA 5EXXA 3OF5A 4Q4AB 5CLLA 3QVUA 3PUXA 3F8TA 5C4MA 2HCJB 2ASEA 2NG1A 1NLZA 2XTZA 1E6CA 1SKYB 1OJLA 2QMHA 3G82C 3PUWA 4HB3A 1NIJA 1OHHD 4LJ9A 5FBQB 1T5LA 4ZI3A 2R9VA 5J4VA 1WE2A 3AVQA 3LVQE 2FN4A 3FHOA 3U5ZB 1BOFA 1N6KA 2IT1A 4OK5A 2EVWX 3JVVA 4B71A 1Y63A 1X8KA 2VP6A 5FPHA 5JJLA 4EQ6B 1C9KA 2JGNA 4RSGA 3IGFA 2R6CA 3NEYA 4JKIA 4DCTA 1A82A 1ETUA 1GG2A 2PZFA 3EZ6A 4M9ZA 2Q9BA 3UIEA 2BVNA 2OHFA 4BFVA 4EPVA 4PO1A 4AIIA 4D0LB 1CJTC 3ZZTA 4C0SA 4RKEA 4JIMA 1VHLA 1P62B 2JLVA 4OQNA 5F3WB 4TL9A 1A4RA 1IAQA 4D0NA 2QMUA 4C30A 2GK7A 5DI3B 2IWHA 2NPIA 2JJ1A 4AWXA 2R44A 3VHXA 2AK2A 1ZYUA 4L5BA 1Q0UA 3O47A 4MKIA 3LWNA 5EE1A 2RGNA 3LY5A 2B92A 3K1JA 2Q3MA 4PR0A 4AY2A 2FFQA 1Q12A 1VYTA 3E2IA 3RSLA 4LZZA 4IJMA 2VP9A 2A5DA 1UADA 1R5OA 2BKUA 2J0SA 1W48A 1E99A 2GILA 4M1OA 4ZDWA 2C96A 3U60B 4LV5B 4JVSB 5L3VA 1OB2A 4B32A 4QHTA 4LBWA 1JXMA 4L15A 2O8FB 4PC7A 3U4QB 3R9IA 4LV8B 1OYYA 2IYSA 2XNDA 2O8DB 2JDIA 2PH1A 2CEAA 2A5YB 4KBFA 3VTKA 1W0KA 4BLSA 1SVOA 2BEJA 4AKIA 4CEHB 4TLDA 3H2YA 2ZAMA 2V3CC 2YWEA 5AUOB 4QFMA 3UXMA 3EW9A 1YZKA 5FBLB 3I62A 1H8HA 2GF9A 2ZS7A 3WRYC 4I81A 3CPHA 3LW7A 2QQEA 2I1VB 4RD1A 2C04A 1P2TA 1BMFA 2DWPA 5FBVB 2CNWD 4LC1A 2Q6TA 2PEZA 2EYUA 4LC0A 5EQTA 3NDBB 3DKPA 4JBYA 4PSAA 1DAGA 1IQPA 1KI6A 3C14C 1W5TA 3EC2A 3CRMA 4A82A 2VLIA 3SDZA 2ZRHA 2QNRA 3SZRA 4GOKA 221PA 2CL6X 2AN9A 4KJZA 1VMAA 3CZPA 4ASUD 2XB2A 1E32A 2D74A 4WXRA 1YZQA 3REFA 4UJ3A 5FTJA 3MMPA 3N2IA 1XBTA 3A8TA 4C2TA 4Q48A 4B43A 1X86B 3H1TA 1UBCA 4G3XA 4PZYA 2IXGA 3T1OA 2CL7X 2W0MA 1DBSA 3TBKA 3OE7D 4Q7MB 5TVKA 2Q9AA 4H1UA 2CNWA 3SU8A 2PLRA 1XTSA 3D31A 4JT4A 2DFKB 3A1TA 5A5GA 2OUKA 3EXAA 1IJFA 1PLKA 2O5VA 3NH6A 2PCLA 4RD0A 5F2EA 1ZM2A 4QM7A 1K8RA 2QROA 4BLQA 4IKEA 3W9YA 1KO5A 1RW4A 521PA 1YU9A 4EFLA 3P26A 3J81k 2FSFA 1TF5A 4Q1BA 5CB8A 1ZRHA 5CLQA 5E3HA 2GJ9A 3LAWA 3SFZA 1ONBA 3K0CC 3K0AB 2JLZA 4PZZA 1KSHA 5BW8A 1T8UA 3M1IA 1KAGA 1NLFA 1ZW6A 2VRWA 2LCFA 1U9IC 4BLTA 4M9QA 1DAHA 2BBOA 1E2JA 3ZVMA 1SXJD 4GMDA 5G53C 4IOMA 3AP1A 4WXPA 4EPTA 4BFUA 1IY0A 2X8AA 1S4QA 5CM9C 1G1MA 1L2TA 3PCRB 3IQWA 2AFHE 3I8SA 2C77A 2C9OA 3KQLA 2BJVA 1Z6GA 3FMOB 3IPXA 1R8SA 2VHJA 1J7KA 3RRNA 4N0EA 5EUMA 1LB1B 1YKSA 2CJWA 3RWOA 1G5TA 3VU9B 4QNMA 2D2FA 1UKYA 1TMKA 1XEXA 4PTLA 1Z83A 1X6VA 3A1VA 3W3AA 4JYBA 4NBSA 4BFYA 4BE7B 4F4JA 5JSZA 1TUIA 4NCHA 2PMDA 2GCOA 4GP7A 5AJXA 1YZNA 2B21A 2YOGA 3KKQA 5CIQA 1G18A 1QHNA 1XXHA 3V4RA 1G7CA 1Z07A 3ZDQA 4CW7A 4WAUA 1TU3A 2GZDA 5GJVC 1N6OA 2F9MA 4U5XA 2NO0A 1M7GA 2YYZA 1E69A 1NVVQ 5D3MA 1CF4A 4YMWA 3UG6A 4MYHA 4NU0A 4TYYA 3SE0A 2H92A
chains in the Genus database with same CATH superfamily
1ZOOA 5CITA 2CFIA 3RRBA 4MJLA 3HP7A 4OLHA 3FKSD 5LBTA 3VV2A 2CLOB 3DEYX 3R5SA 2HDHA 2XXJA 3OYBA 2EGUA 1J0CA 1F8YA 4HQLA 4KRGA 2ZR7A 3MWFA 3ZOKA 4XD7D 4QQNA 4Y17A 2PJZA 4BKQA 1YBFA 2DR0A 1WXXA 1EQAA 4Q6WA 1JFFA 3SZTA 4X92A 5EPEA 2GTIA 4XGIA 3UANA 2TSYB 3GFTA 1T2DA 4AKSA 1BS1A 5CVIA 4BH9A 2DJIA 1WPGA 4ZHSA 3IILA 4RNCA 1QH1A 2DBZA 2GFIA 4OH1A 1MX1A 3S17J 2HU7A 1YBHA 1XNGA 1UMCB 2BEUA 4MGEA 3IIJA 2HDOA 3VJMA 5LVAA 1Q1EA 3QIAA 1SOMA 1VP3A 3MWLA 4YRQA 3V4SA 1JQ5A 4MVWA 5CXUA 2MIIA 3FYDA 4OMCA 5KVCA 4IDFA 1D8AA 3UHAA 2RGEA 5HZGA 4NJEA 2HA6A 3GLVA 1XTBA 3N59A 3NDRA 3UK1A 1TAUA 5TMEA 3NRBA 4KDRA 2PD4A 3TLKA 2HEIA 4E11A 4R0VA 1EI9A 2V7PA 3BVPA 1I3NA 2QAGB 2FQXA 4EQZA 5I4BA 4C03A 5B5SA 3ABLH 2ANBA 4JQYA 1LNWA 4I0BA 2O9JA 2UVQA 4ZJYA 1TEZA 2OQVA 3ZCXA 2CUEA 5B7QA 2Z0MA 4GI7A 3AUXA 2ZQZA 1QG0A 5B36A 1VI6A 5DCWA 2HFJA 1SZCA 4KX5A 3FRIA 3M0EA 4MHGA 4Q3KA 3A9TA 3H11B 3RBAA 4DWVA 2X14A 1V5EA 2ZATA 1LDMA 4JU8A 4Y2RA 5EMLA 5FTMA 1A4UA 4JR0A 5B6IA 2D6FA 4FWIB 3D7NA 4KH0A 1T0IA 3KEGA 1R3UA 3HOZJ 3AFOA 1SZDA 5L6MB 1E3OC 1O5IA 3VI4B 2CF6A 1I2AA 4JNCA 1CIVA 4Z8YA 2HA3A 4XVHA 4YRBA 3PR1A 4YFXF 1C9YA 2IRWA 1WJCA 4KMOA 4DIDA 1V96A 1WXDA 2FQ3A 3PM1A 3JWGA 5HDKA 2C61A 3N86A 4C22A 1SIUA 2GAAA 3BFPA 1BA2A 4NQWB 1XB2A 2WJGA 3KAPA 3DDZX 2MC4A 1MA0A 1ZLYA 3JR9A 4JJ8A 3U3DA 1B0PA 3WBJA 3L1HA 3WADA 4ZN6A 4I2OA 2YX4A 4E7HA 3ONDA 4CCYB 1XMXA 4QATA 3KSDO 1RZUA 1Z9BA 3UAOA 1IXRC 4PSWA 5JI6A 1FZPB 2GZSA 2GPAA 3C41J 3H9CA 2FEMA 1MUUA 3QPBA 4L8FA 2AOXA 4HZIA 1FIAA 5D1HA 4NV1A 4B8XA 1LDEA 2FP4A 2O3UA 2JB9A 4CFSA 3EAQA 4C0WA 3UFXA 1I4DD 5AKHA 3SPXA 1KWKA 2X51A 1T43A 2Y69H 1S72I 1X0VA 2LW7A 3GG9A 2EZ4A 1G6KA 2AE1A 1NBAA 4NBRA 3SYKA 3UEOA 2YWHA 5F1OA 3KQTA 2ZBVA 1HW2A 1IM2A 1D5VA 1PNTA 3R24A 3AFHA 1JIVA 1LF5A 2W2VA 2XMPA 2E9SA 3OE7A 3IV6A 4YJ2A 3O84A 4MQEB 1N75A 3N0TA 2VCEA 1H89C 1SU6A 1NF2A 2HPIA 1DWUA 1G2PA 1BRMA 2Z2YA 4L9TA 3GT4A 3QMMA 4KL8S 2HNHA 3GO5A 3K70C 1HL7A 3EISA 2C99A 5UKDA 3WXMA 2MSNA 3EJ6A 3MRXA 3LQRA 3BB3A 4BY9E 4NZ9A 4EA9A 2VBYA 3FK6A 5J23A 2V7EA 2X8JB 4MWTA 1RWQA 4FB4A 3DD5A 2AQ8A 1OQAA 3WDSA 3O2SB 1OB5A 3PO3J 5F2KA 5BSKA 2XTAA 5EC8A 3A1UA 4BMZA 2J3JA 5HCNA 2JEZA 2IYXA 4WN3A 3ESWB 2ZQYA 4FGWA 2XUKA 3S14J 4K9OA 4NJMB 1NMSA 3IXLA 1GGHA 1RNLA 2CQQA 4E4RA 4IJUA 1FDUA 1ZRCA 4WMLA 5BN3B 5DM70 1X1CA 1PBTA 2CJJA 4N5MA 4E1AA 1GNRA 3MS4A 1E2UA 1CRLA 3IRRA 1G19A 2AJBA 4KN9S 1DKNA 1ZJWA 1GFZA 4C08A 5DBIA 3E15A 3DQPA 2L9NA 3CTPA 3O95A 1DZ3A 3KO8A 4Q9LA 1FYDA 2BC9A 2ZYAA 4RC9A 1CRQA 2V98A 3CE6A 4JDUA 4J6EA 3IVRA 1XKQA 3I3OA 3BHNA 4U39A 4YV7A 5DX8A 1BVHA 1YU6A 2BJWA 4R7ZA 2FR8C 1MBFA 4BRZA 1I94B 3IOEA 3AI1A 5EMNA 4M0DA 4WXCA 2GF2A 2LNDA 4JLPA 2REXB 3SHOA 5CCBA 3UWDA 3LFUA 2M34A 1WU7A 4CODB 5K8TA 3DHVA 3AG4H 3AHIA 1YB1A 1ITYA 1F6WA 3H9UA 4CLDA 4Z9XA 4UEQA 5TPWA 4DZTA 3QWAA 3C3WA 1LWOA 2C2GA 1YZGA 5EZYB 3TNLA 2JLCA 3NIBA 2PN6A 2VPYA 3EEQA 3KLPX 2XCRB 1OZAA 1JEYB 1ISPA 2Z08A 3A9UA 4OA8A 1LFAA 1LH0A 2VLAA 1YB4A 3ZV6A 2BKEA 4EWLA 3F73A 2V6IA 1QF6A 3EPHA 4DMLA 2C54A 3HIFA 2TMYA 1AKRA 5C32A 5CCDA 2XUDA 4AQDA 4DA6A 3HOVJ 3BTIA 1YIAA 2GJSA 2YBEA 4BWVA 3HSYA 4K9LA 1Z3IX 3HZOA 3T15A 3GFLA 2IK8A 3IQZA 3LRPA 3A9SA 2HK6A 1PJ3A 4HAYA 3Q3VA 5CD9A 4Y6GB 2DUNA 5DH9A 4YG2F 1H4VB 2H08A 2KL4A 4B6QA 1EFDN 1WJGA 1YOVA 2PQ2A 2XIQA 2F1IA 2ZYRA 2IYTA 4PPYA 5AR1A 2EZKA 3CX7A 1JW9B 5C8XA 3VR3D 2Y1GA 3NBMA 3RREA 4FTHA 4JZYA 1AE1A 3WMXA 1ZHFA 4NC6A 3A4TA 1VI2A 1ENHA 2JLQA 2WKSA 2HDNB 3WWOA 1SXGA 4PAMA 3UNXA 4XDZA 3BOQA 3KP5A 4DZPA 1TTQB 1Z8HA 2B35A 3N75A 1N3BA 2RHDA 1ZI6A 4ND4A 2CQXA 1RQ7A 2Z3VA 4QU0A 5FAXA 2QQAA 4L2IB 2P2SA 2W98A 4CI0B 4Q39A 3L8ZA 4LXYA 3HXMA 4ZIRA 3OOYA 1WNTA 5FKNA 1RYHA 4ZYXA 3K1AA 4PGGA 2F43B 3AF2A 1JILA 3DKKA 5K5RA 1JKMA 1HG1A 1SCUB 4HNUA 1YI0A 2FN8A 2FFRA 2VRCA 1BG6A 1JYFA 2XADA 4H1VA 4LJ7A 4BLUA 2D7DA 2PFSA 2P4EA 3E35A 1XTRA 2A9VA 4LE1A 4IYJA 5FUYA 5ILSA 4DSTA 5IMSA 2HA5A 2JBAA 2JGFA 1EZ4A 4B40A 3OCJA 4MRAA 1PZHA 4EPYA 4I55B 3BP8A 3EVNA 5E0KB 3IPAA 3CWCA 3KL4A 3NT4A 3OJOA 1OU0A 5EGOA 1VYVA 1Y6QA 4TZTA 3M07A 2ZB8A 3HA5A 1RPTA 1UXJA 4XWTA 4ZD6A 5GIPE 4MTEA 2UZAA 4HNTA 1ZSYA 3BE8A 3P9CA 3MBKA 3OLVA 2OV4A 1V4RA 4MS3A 2IYEA 5ARCA 3AR6A 3MWJA 2GZ1A 4ZEMA 3NALA 3DDUA 3DNFA 3DO6A 2Y9ZA 2E85A 4BJ6A 3KP4A 3PQKA 1VCIA 3OYMA 3OEED 7MDHA 4FGKA 1G3SA 5F78A 1WG8A 4HRAA 4DG9A 2WIBA 4CKEA 4XQ0A 3GYGA 3HBFA 4BRWA 4DM4A 1X1RA 3JQAA 1UM8A 1WM1A 2II6A 4I1YA 2PBRA 5FKLA 4KLNA 4D96A 2V3VA 2WU0A 2WTMA 2IHNA 1SHLA 1KFEB 3HB7A 3KQPA 1EP1B 3HJAA 1I14A 3KDPA 3VPFA 2DERA 3SD7A 1XNQB 4KN7X 3NAUA 3PDIA 4K6CA 4MDYA 4KMUX 4AL4A 4C3OB 1LNQA 2VQFB 3OIPA 2EKDA 3DLTA 3OBIA 1WPXA 4EDFA 2A0YA 3N8KA 3AWDA 4EJSC 1RFLA 1IEXA 3RIMA 3TIFA 1XKTA 2ZQ5A 3ZUPA 2GD2A 1TC3C 3HVKA 5JSFA 3HVIA 4M88A 1O4VA 3GJ4A 4N7BA 3LD9A 5F35A 3V8PA 5ITZB 1GVJA 3GPDG 5FOTA 2ZFUA 2F7SA 5D51S 1Z0ZA 5J59A 5LGNA 1ECGA 3NVAA 1KDRA 4QTTB 1BFUA 4O2BA 2HKXA 2B1RA 1RXSA 1YO5C 2C2BA 3L79A 1PVDA 2IOFK 1VOTA 3ZV3A 4JBWA 5KWVA 3VVBA 1USUA 2RBEA 3HWRA 1QMPA 1HSOA 1SEVA 2C83A 2EJTA 3WB9A 1O0SA 3EXHA 2VODA 1N5LA 1PNQA 3DMDA 3PPIA 4KLZA 3X44A 2XF8A 5E1XA 2FZCA 1L4BA 2P5SA 3RKQA 3P9XA 1NRIA 3W3AH 3U1TA 1T8YA 4MKFA 3T3IA 4C5CA 1ACJA 1T5HX 4M99A 1I7DA 3A11A 3L7BA 1DC3A 4L18B 5DHUA 1CF2O 5F5NA 1WLYA 1WD5A 2WT8A 1V3FA 2J0UB 4Q7LA 3TL6A 4UU1A 4ZTUB 3Q3JB 2NVBA 1BE6A 1PV2A 2XQIA 4S1PA 3CN7A 1PCXA 2AMJA 1YR2A 4CHTA 4H15A 2JPBA 4ZC1A 4XUEA 3TI9A 1AA7A 2XYPA 3PXCX 4NCAA 1E5QA 1NYTA 5DWVA 4N9WA 4Q1VA 1SO8A 3LQ2A 2R8BA 3PXAA 3ZXUB 4KUMA 2BCGY 3JRNA 3WGZA 1UK6A 4OOFA 2Q28A 4LTDA 3GAFA 5FLXK 1TT7A 2D5VA 4JXKA 1G8HA 3H8VA 1MX3A 3LA6A 1E1QD 4UXNA 1GAQA 1H69A 5AKLA 5J3JA 2P91A 3O38A 4FLMA 3G85A 4MUYA 1VYUA 3IMCA 1OTYA 4NONA 1R5ID 1ZELA 3D5QA 3QBVA 4QWMA 4HEQA 4EPRA 4M54A 4MR8A 4ZOLF 3IJEB 3R8CA 3KVRA 4P58A 1HSZA 2MSEB 2DB3A 1TGVA 3VOAA 5JS7A 1ZOPA 3QQPA 2AG1A 1S5LC 2JVIA 3MS7A 5DWQA 3TTSA 4PRYA 3DW1X 1O2DA 4TRNA 4Z2YA 3CZRA 4LE2A 5AM0A 3C97A 4D3DA 2C2KA 4D9CA 3KR9A 4C4YA 2F6CA 1Z0IA 1ZUWA 1RQXA 3LSHA 4PSXA 4RPHA 5IM5A 1RI3A 2BMJA 1C3VA 4MAFA 5JS2A 1Q91A 2O1WA 4KYVA 4PHHA 4DZRA 1ODCA 1JKFA 1NUUA 1QRRA 5EN4A 4HBZA 3BZUA 2ZCUA 4L5EA 1T13A 1Z29A 2Q0HA 1DTWB 2YQ4A 4JVOA 5FFZA 1U0NA 2G70A 3B1VA 3GJ8A 4R2KA 4ARAA 4EV0A 1QRAA 1WSWA 1JKRC 1Q0LA 3C7CB 3GFPA 4COOA 3RUAA 4Z4IA 1IUYA 3NVDA 3OPQA 1R10A 2IDJA 2PZJA 2WUFA 4Y2PA 2LGJA 3T3OA 4KIGA 2M2EA 2H00A 4YDQA 3J81K 3KFXA 4B2PA 3WICA 3MCUA 2N1MA 2XPVA 3ONWA 3VZBA 3KPYA 3Q0WA 2WU8A 2ORED 4MWSA 2YJ5A 3WAGA 3JRBA 2DPDA 4N41A 5TQ0B 2W37A 3CZQA 3VSKA 3O5AA 3TPZA 3RTEA 2L4MA 5I4KA 2W4SA 4WZBE 3N58A 4OHFA 3U9LA 5H4GA 5BPFA 4DGQA 4YRLA 1H6AA 3QKSB 3QP6A 3RF6A 4TV8F 6YASA 3BZWA 3HRSA 2V96A 2YX1A 4PSCA 4FYXA 1GWNA 1L0BA 1F06A 4CBVA 1NUSA 3WK9A 4W7IA 4EKEA 1NVMB 2PQ0A 4UE2A 2BWJA 4ZCTA 1T08B 1FYKA 1GA4A 2XV4S 4I01A 2AFIA 3EXG2 1DIOB 3P7MA 4RKQA 4XRMA 4MX8A 2VZ8A 4ZVLA 5TGDA 3TMKA 3TD6A 2IIBA 6Q21A 4C1NA 1KU2A 2DC1A 3ZMTA 3H2IA 3ECHA 1FRNA 4ZV7A 3VZRA 3ZWBA 5IZCC 4BNFA 1HK7A 1F3OA 1QRDA 3P20A 4DNQA 4EGYA 1L5FA 2HDWA 3TSCA 5AICA 3RBXA 1A2BA 1M9NA 1SKBA 1EMDA 3G6WA 3KHTA 4BMNA 3O8LA 1WCYA 1L5GB 3NASA 3H5AA 1R0WA 1O94C 1LBHA 2V74B 2A1UA 4IIFA 3TQNA 1ZD8A 2F5VA 1GUAA 1XALA 2OO5C 4KMFA 5IY5H 2NV6A 1JEQA 3LGSA 3T41A 5JZBA 3QU6A 2LCIA 4RHYA 3WZMA 1GEEA 3B02A 3G4SI 1NW5A 1YAJA 1A35A 1T9DA 2I8CA 3IHUA 1JT9A 3CJQA 4OHMA 5K6TA 3M9WA 1HEIA 2FPRA 2NTYC 4DXAA 1PKEA 5BS6A 4KYWA 1QHXA 4YR7A 4L4YA 2F1JA 1Q1AA 3AF5A 5GOTA 4XQFA 2R97A 4RTKA 2ZMEC 1QG6A 1R0KA 1S2MA 2JPDA 3B6MA 5P21A 7REQA 3OJ0A 2O7QA 3IRUA 5GJWC 1TYAE 3BWMA 1JT2A 3E3OA 3RVJA 3T9AA 2PZMA 3WIEA 1O96B 1PZEA 2BR5A 5DYNA 3RASA 4BBJA 3O8CA 2YJNA 4B47A 1FRVA 5IJXA 1JLLA 4WK2B 1FSHA 4AICA 1T0FA 1POWA 1W0KD 2FWBA 2FNAA 3O8QA 4ZU1X 4IXNA 3W3CA 1VKJA 3KP1A 2ZSHB 4H4CA 2C88A 3KJZA 2CRGA 1NN1A 3KOMA 5J2TB 1U1DA 2YUTA 3KE8A 3CJQB 1ACIA 3O92A 3WNCA 3ETCA 2DTDA 2R7SA 1S1MA 1P2BA 4L5JA 2P4QA 1NASA 2L7FP 2NNNA 3JQRA 2O05A 1J2EA 1VHWA 3NC1C 3RC3A 1SFEA 1PK9A 1QU2A 1PJTA 3EUEA 2JW5A 5ECGC 1TTYA 2HF2A 4UUQA 3COJA 3EG9B 2G25A 1CUAA 3AG5A 3FYHA 4TN1A 2HA0A 4TGLA 3WIOA 5KOIA 2EW8A 4F5DA 4F96A 4I5GA 2ATEA 3JD3A 3W8EA 2Q6OA 1PX2A 3EEFA 4J1QA 2VP3A 1UBEA 5C8ZA 3RS7A 3T5BA 1MAHA 1L4UA 1O9BA 2BGLA 2RHGB 1M6NA 3QUAA 2OHOA 3KQNA 4A3JJ 5JMTA 2I8LA 3FCSB 1RQ2A 2VDMB 3ABTA 2W4MA 5DOVA 2IS6A 2WAOA 2QUZA 3KTAA 2WV7A 1XZBA 5EXEA 1GRQA 5HKKD 1JTFA 2I4MA 4B3MB 3CZ9A 2J41A 2P9FA 1P1RA 4YQYA 1XTTA 2CSOA 4LXTA 1DP3A 5EPUA 3ROUA 4MR9A 1GL6A 4CMJA 3DHEA 4ZRMA 5HZMA 1JAZA 3LZDA 4A4DA 2E55A 2W90A 4GW3A 2G88A 1Y4ZA 1HYGA 1VSUA 1SC1A 5JI3E 4GBED 1NG1A 3NCHA 2Q3JA 4DV4B 4MTDA 2X6YA 3B5JA 5F9MA 4EO9A 5KQGA 1U98A 1YLFA 2IYRA 4G8XA 2BKLA 4ZDJA 1SPBS 3N97A 1H2EA 3FUUA 4RA6A 3AR3A 5C4JJ 4MVCA 1JU4A 1VE9A 3MPUA 4V2FA 2CXHA 3FMPB 4ZWNA 5H9VA 3CBQA 4G7OF 3JASA 1P0CA 4ZU3A 4E1BA 1P7JA 1MKYA 3BQNB 3IPYA 4EI7A 2GBLA 1YDHA 1KJZA 3JYQA 1X7WA 5FWAA 2ZO4A 2CVHA 2FQ4A 4LRWA 5JSYA 1CHDA 5LDHA 3OUUA 2DF8A 1BW5A 2H09A 1T0BA 2Q3HA 2D5IA 3MW8A 2RGYA 2O3SA 4PIVA 4X00A 1Y8RA 2FPGA 5AW9A 3IBTA 5K8VA 4GRIA 3ZVNA 4K86A 2Z9BA 5BNZA 3P9SA 4IDAA 3FMSA 2WFMA 3NGLA 3WODF 3AFGA 3KOYA 2RBKA 1M2VB 2XUAA 2ZTSA 2ENWA 4JQSA 1B4DA 3I0ZA 3GRYA 4NH0A 2HF8A 1IHXA 2WEKA 5A2QZ 1XTVA 1MZVA 1R74A 1QHGA 1RLIA 1GZ6A 1IJEA 3BSYA 4BQOA 4IUCS 4Y6QA 3PFNA 4ZYZA 2K4JA 1O6BA 1EH6A 2A67A 2P9CA 4QUJA 1PJCA 5FI0B 2HV9A 2IIQA 1FP4A 3C3XA 3AFMA 1HDYA 1OI3A 3NTLA 5L3CA 1GDTA 3PLAE 2XDVA 2W2QA 1BMTA 3PA8A 4AKEA 1AQ6A 2IBMA 1RKTA 2OXCA 3JRIA 1UXKA 2IEBA 4G6DA 1NOJA 3ADKA 1K63A 2XGMA 2KISA 4Y33A 1Z45A 4FFDA 5M5XJ 1H3FA 4M7OA 3C1OA 4PQRA 4QYWA 4ZANA 3LF2A 1XGOA 1T2CA 5FFFA 4HYQA 4NBLA 2VRCD 3FGOA 4HA8A 3S8YA 4DUZB 2QN1A 1RI1A 3QY9A 2H11A 2A9KA 1L4EA 1V8ZA 5E1MA 2BEWB 4IDCA 4MIMA 3GVXA 4TRRA 4JKYA 4QOGA 1OYVA 3CSUA 4ZO6A 2KFDA 3RLFA 2PL9A 3DAPA 1SKMA 4OKNA 1B1BA 3RSQA 1G6NA 4B6EA 4HAOA 4BFCA 5LQKA 4A15A 3CH7A 2QKYA 2VJMA 1QYIA 3U4DA 3L7NA 1CGPA 1DPGA 2GETA 2Z3ZA 2FZLA 4HDMA 4X20A 2IEAA 5KTRA 2CHEA 2PX0A 4UMDA 2EX4A 1VGVA 2ZSDA 3K71B 5JVTA 2PK3A 4A2WA 3P9YA 1A3CA 2PO7A 4JR1A 1H8AC 2P1ZA 1FBSA 3ZMDA 5CGZA 3SR0A 5A9SA 1AMUA 3RS0A 3ANTA 3BGSA 1CQIA 3H3FA 4EELA 2KKOA 2J9RA 1CE8A 1S29A 4FLFA 1ODIA 3KLMX 3W34A 2VDLB 5JQGF 1HC8A 1F4KA 3KDSE 5KAPA 4O2BF 5CGQB 5JADA 1EDZA 3HYCA 2R8ZA 2Z16A 2Z83A 1BKDR 1NIPA 4ZAZA 1C4WA 4EQ6A 5KPJA 4W7SA 4QDOA 4JI8B 3HBNA 1IZYA 1U0TA 1RTTA 5HPYB 2R7AA 1A9TA 4M1TA 2I9KA 5CVJA 1NLYA 2ZJ0A 1XQVA 4LRUA 3RUCA 3P9KA 3TAHA 3ZVLA 4ABTA 4M21A 2EIKH 1IZ0A 4KT5C 4G1CA 1UHWA 1B2RA 4AC9A 2QYSA 4IKPA 3QOYA 1JG4A 1KMIY 2B1QA 2HBRA 3QHPA 3C3PA 2ZSIB 1MTOA 2C95A 1ECPA 2R79A 2A9JA 3NWTA 3AFNA 1TVMA 1DT3A 3GCXA 4OQMA 3C2GA 2OUMA 3KL2A 1DC7A 3ILHA 4QC2A 4RPJA 4TWIA 5G4KA 3K9FC 2R92J 1XD2B 1XT6A 1MJBA 1EJ9A 3F6VA 4WN9A 3J7AC 4BEHA 1FP7A 3HZJA 3WMEA 1AK9A 2NU6B 4PF1A 4PK4A 1CY4A 3FCXA 4X5OA 4WV3A 5KYTA 4FT2A 3IAM1 1JLMA 5LHHA 2B4KA 3H17A 3NV7A 4INOA 4WKNA 2QEQA 1NNI1 5AKZA 2Q45A 4V1CI 3WS7A 1W6RA 1XA3A 4NDNE 2F55A 2V6MA 4L3VA 1FJHA 1YZ3A 1NP6A 2QTGA 4PFKA 3BIFA 5LQRA 1YR9A 2YYYA 2JJMA 2CK3D 3P0HA 4ASUA 5KINB 3DV0B 1KP9A 1MABA 4YCMA 4UTOA 2W4QA 4MIYA 1V0JA 2BBTA 8ABPA 1DZIA 4M1QA 3PQEA 4AYBN 2PGOA 2IZOA 2OBMA 2Q3LA 2J08A 3I04M 4N4NB 1TIKA 3K1AB 2FOWA 1QLWA 3KB1A 2AX3A 4GI2A 5BXQC 1RZRD 2QLZA 3Q3CA 3RAGA 1EUZA 5JY6A 2MH9A 2RVCA 3A31A 2BD0A 2Y93A 3L5KA 5EOVA 5SZHB 3AX6A 2X19A 4MI1A 1V1JA 3MB5A 1E3PA 2KIMA 2B34A 4OUDB 4XGQA 5CYOA 3TBHA 1X94A 4WWHA 4D0SA 2XAUA 3UAWA 1FUKA 4W5HA 5C4GB 4J3JA 4U00A 5CW1A 1IEQA 2EJWA 2NZUG 4NG5A 5GADl 1BDIA 4YN3A 4EB3A 3D54D 4EHNA 1KAHA 2WT9A 1QFJA 1PK8A 2XD4A 3E7PA 3Q3HA 2LIPA 4L5AA 4LNUB 4MVJE 1YR7A 1YW8A 1Z4PX 4GG1A 4KDEA 5JXWA 1P2SA 1SUPA 1BQEA 2DAOA 2AF3C 2OCKA 2KIFA 3BRCA 3KFVA 3QUCA 1KQNA 2BY3A 3IR5A 2DSNA 4Q00A 3PEUA 5CUQA 2B30A 5JPDA 1Q2XA 3KALA 5EGSA 1IZ7A 5U4QA 4F4IA 4LZAA 3TR0A 2FR8A 3TP0A 2Q0SA 4P0TA 4P33A 5H4HA 2OKCA 2Y0DA 2ZSBA 2BHYA 1J97A 2O2JA 4FS3A 5AKGA 1RRGA 3OSFA 5FLEX 4M4SA 4M98A 4LGWA 5KYUA 1IXYA 3FDJA 3UF0A 2ZUFA 3CUKA 3B1ZA 3C4VA 1NPTO 4ER7A 3O8RA 1ZAKA 3UBTA 2PS3A 5E79C 2VO1A 3AVTA 3O83A 3UYLA 4DZZA 2H6BA 3RPUD 3KBBA 3H5OA 5LXTB 1IMOA 1VYHA 4KKXB 1CNEA 3GXBA 2D5LA 1TCCA 4JK1X 2BW0A 2C1ZA 4U02A 3UO8B 2I7VA 4HK4A 1UDRA 2NSYA 1YS4A 2VA9A 4TTSA 4D98A 2GMWA 2ME0A 3AXTA 3C45A 4MR9B 5AVQA 1R6XA 3JZDA 3G2OA 1YTLA 2E2HJ 2QMZA 2K6GA 1UELB 3O9VA 4AJLA 5EKXA 3E70C 2FPMA 3UKGA 5EYPA 1R22A 2FG7C 3KYJB 4P34A 5IS2A 1N25A 4RE6A 1RVV1 5IC6A 3HRMA 1VMKA 4BZPA 4IO0A 3E6MA 2AA3A 3BJEA 3DLAA 4OUDA 3K4LA 2DVMA 2X3YA 4U63A 4PIMA 4CV3A 3FNRA 3NR2A 4AJPA 2CCKA 3BE6A 4BO2A 4FN4A 1F4VA 2B78A 3DCNA 3LCCA 2EFNA 1VECA 2ZRQA 3LBHA 4B73A 1XEAA 3DZDA 3ID6C 3ICOA 4AP9A 5G2OA 1SXJE 2Y71A 1FMJA 4W63A 3NBFA 5CDUA 2GESA 2KDZA 4G0VA 3LX6A 3LUKA 4RGVA 2LR8A 4NTZA 1UDBA 2FSVC 4A3LJ 1BD4A 2ETXA 1YTYA 4YFYA 1NU8A 2Y1KA 4YC7A 5IYZF 4DLZA 5FV4A 2YV2A 4GBMA 2QU7A 1KI9A 5TEWA 5FRNA 1MIOA 1MKMA 2Q21A 5G40A 1KS9A 3ZCTA 2RB4A 4EI9A 3KDAA 1E1CA 1G20A 3OJCA 4GE0A 4ETMA 3IULA 3GDOA 4OU4A 3LSTA 4MIKA 3FBNB 4N9QA 3BG7A 3I1IA 3NDPA 4O4IB 3HSSA 1ZGZA 2PMUA 1OBCA 3GP5A 2RDMA 4GBGA 4KTTE 3GP3A 4G85A 4NYJQ 4URZR 3N8IA 3IRQA 2ZT5A 4Z4EA 3TEJA 1DP7P 3N6XA 1P9OA 5HVQC 1U3DA 2C29D 2IITA 1GFWA 1IUPA 3LHFA 3QE2A 2I6TA 5KVVA 2VHVA 3KTFA 2HM7A 1T9CA 1T9AA 4WUVA 3W77A 4BVBA 2OL4A 3FISA 3R6SA 4DWOA 4J0QA 5CG2A 4PLYA 1ECJA 3GEBA 4UAUA 1ORVA 1QOPB 1PEKE 4OX9Y 1UOQA 1YE5A 3OS1A 3VPRA 1USTA 5DYWA 3RVMA 4BEJA 1GV2A 3GVAA 3K4MA 2BBWA 2PS0A 4FOTA 4XB2A 4CKWA 5HKKA 4O29A 3VR2A 4CF6A 1DX6A 3AUAA 2C82A 4YT5A 1G66A 2QVLA 3NWSA 5C4IA 1WXFA 3JXEA 3DCJA 3JD0A 2WSSA 2VOPA 3A2NA 4PO3X 4TWZA 3STUA 4G1EB 1F2VA 2CSUA 4D6YA 4K9QA 5JSZB 1MHPA 4D4IA 3AR9A 3ZJTA 4FD3A 2A84A 4AC0A 4CLOA 5JTTA 3K6GA 1I6HJ 3DF7A 5FL3A 5BWCA 4R7GA 1Y8ZA 5DSXA 2HR3A 4CLXA 1C7ZA 4U7WA 1DO8A 2UZIR 1VQ6I 2Y1WA 3R3UA 2AN3A 4BQQA 3WTWC 5F77A 4FPXA 3ZH9B 3TG8A 5FLMJ 4KYUA 4IKFA 3M8JA 3B78A 3I9V1 4E94A 1H5NA 1R5JA 1XU4A 2HYGD 1I30A 3JQAB 5BV0A 3ZJVA 1GV1A 5KTMA 1GXQA 1AKHB 2XXAA 1O7LA 1W47A 1ZSNA 3CX8A 1YA4A 3UHPA 4DSZA 3GLXA 5LLQA 2V7FA 3PRKE 1IATA 3BJIC 3S44A 3GA0A 2KLOA 2Y0SA 5BUQA 5CEFA 5DULA 2B0JA 1L4YA 3K72B 1J8QA 3GLIA 3OT1A 1VJGA 3B5EA 3BMXA 4B83A 2UZ0A 2XB9A 3N5KA 3JCZA 2QJOA 2WJ3A 4DCJA 3OWTA 1A9SA 2GCGA 3S2GA 3QK7A 5L3GA 3A58B 1E3EA 2PKWA 3KV3O 4S05A 5J2UF 3AR8A 2I10A 4C3IJ 1H0RA 3WGVA 3DF8A 3G5MA 4K40A 4KPGA 3WP1B 1L7VC 4TUYB 3FK7A 2BDUA 3ABQB 2P6PA 3STXA 3DEFA 1XC5A 3TB6A 1OHHA 3TQRA 1KEEA 1LBTA 4K9RA 1IN8A 4LOCA 4UVIA 4H3KB 6REQB 4QBIA 2HHHB 4TMWA 3ABUA 4U2EA 5ENZA 5HMLA 5HSGA 2IBTA 2R00A 3ZMVA 1JKQC 2UYOA 3D7RA 1E9CA 1Q17A 1U9JA 3EPRA 3IDAA 3GUYA 1MDMA 2XNCA 4GX0A 4IGFA 1L7MA 3KR0A 1YGYA 3V2HA 4CM1A 3D6UA 1ZR4A 1IC6A 2XGEA 1BA3A 2YASA 4JQZA 3WBKA 3ZE0B 1WBBA 3N3AC 2C4TA 1SVLA 3CKLA 5FA6A 3TRFA 2HV8A 1FDWA 1LRKA 4XJXA 1U6GA 2QA5A 4RFLA 1PYDA 4U0KA 4A3SA 1LY1A 4GSLA 5F08A 1GTVA 1MO5A 2REBA 3EDPA 2XMCA 3FA2A 3LP5A 5EJIA 1ABEA 1ST3A 2OXIA 3HEBA 1JUDA 2F3TA 3NWOA 4A1OA 4ES6A 1BWSA 3TOBA 1U3TA 4KQ1A 2A5FA 4UHFA 3EVFA 4UNOA 1ICEA 1XMIA 3HRTA 2P65A 1FFEA 3D6TB 2G7UA 1DQPA 4MKGA 1XNRB 4DR6B 1UCFA 1S4MA 1TYCA 1XZMA 2ZIWB 1OBOA 3KZVA 4Y2TA 2D5CA 3OE5A 4BEBA 4TMYA 2HMSA 1JLLB 2QV7A 3C5EA 3QA9A 1NZJA 3WYBA 2I99A 5JC8A 6CHYA 1CJSA 4MQVA 3FAKA 2F1RA 4OMZA 1MBJA 3WYNA 4KSYA 2QTLA 3D0QA 2X40A 1EM8B 1JG1A 1YE8A 3M89A 3N2GB 3R3XA 2XKBA 4O4IF 4BIIA 2NV0A 1QR2A 4OATA 2F48A 2EJCA 3VX4A 4D45A 4B2IA 3FTEA 4ZO7A 1GQQA 1HEUA 2P6TA 2B8TA 1RYDA 1Z4IA 2ZJ2A 4RF4A 3OKCA 4TYQA 4UEOA 5EZYA 5ADUS 1W4BA 5G0SA 4DCOA 5HIKA 1IF1A 3G9XA 4WVLA 3GJXC 2ACVA 2QL7A 4NFLA 4WK4B 4ZVVA 4CWAA 4EKIA 1XGNA 1M2WA 3AINA 4B6GA 1XMSA 1WJEA 2VDRB 3ESXA 3RTBA 3K4PA 1JVBA 1WDLA 4UMFA 5FUMA 2MSCB 5AM4A 4KIBA 2JH9A 2R4QA 3H42B 4JSTA 3SKXA 3PVCA 5THQA 1D0XA 3GZ6A 2WVAA 3W05A 3SMVA 4R8SA 5LYJB 1GUUA 1ZEMA 1W88A 3FUTA 5HZKA 1XZPA 4IHQA 3PYLA 2Z2XA 1ZH8A 2QU8A 3CEHA 1V9LA 3A04A 3GMDA 1TQ4A 3IQGX 3L02A 3E23A 2RSLA 2QZJA 3TKLA 4OXNA 2BFEA 4L73A 4OJYA 2W6PA 4RXUA 1KMHA 2YX7A 3G7NA 4XLEA 4PCAA 5LLTA 4IRIA 2NP6A 3BMOA 5T8KA 2BE7A 3GLRA 5BQPA 5K51A 1JE8A 3R5JA 4IGKA 3RW9A 2VAWA 3CEJA 2IC5A 3ETGA 5IDQA 1I1GA 3RD5A 2G07A 2P9ZA 4R83A 5E7JA 1QLHA 2FEXA 5H3HA 5KEIA 4TLCA 4OYLA 3PYXA 2KSQA 1RZVA 3I9V6 1RJ9A 4LDQA 1JQAA 4C0JA 4EJ0A 1IIBA 5A1TA 1H3EA 1RWOA 3IP4B 2WDZA 5ABPA 3TE7A 4P5PA 4WECA 3ROXA 3A6ZA 3E81A 3LCUA 1KPHA 3TVTA 4DA8A 4JT8A 1LX6A 3L0SA 1E60A 4OB6A 5C8DA 2QN3A 4XNFA 1G8MA 1OPCA 1RMYA 1TO2E 3B13B 2YXBA 1GLNA 1ISRA 3CB4A 4HB0A 4BATA 1P80A 5JAOA 2YVKA 1BJZA 1WSAA 2J1LA 2DA3A 4OD0A 2GR9A 1GL9B 1IXCA 4IZOA 1D0ZA 1FXUA 4MGZR 3QNUA 3AUSA 4F06A 3LC7O 2BGMA 1UXIA 4JYZA 3U4AA 3VH1A 3JAMA 3E82A 3W0LB 2QA4I 1KEEB 3ACDA 4RJLA 4DDVA 1TNDA 1G3WA 4ZT4A 1LLFA 2OZUA 3V00A 1Q0PA 3AZPA 3ET4A 1MBHA 2R7OA 1IXSB 3EC7A 3ULKA 2FQWA 3I53A 4FHCA 3A6FA 2B8JA 1XSDA 3IE0A 3W06A 5CQGA 3R0XA 2ZSUA 5AUQA 5LXTA 4CMIB 1Y6IA 5FA5A 4OQZA 2IHBA 1GHCA 4FZJA 3IR7A 2KIUA 1FFWA 2GYYA 5CDTA 1TK9A 3NOXA 2Q5LA 4Y2SA 3FZGA 3OLQA 3C18A 4PWZA 4YJFB 4AFNA 3FPAA 5AVRA 1RCUA 1Z0JA 4BQSA 4Z1OA 4V19K 1TF7A 5I8PA 1B72B 1SCQA 3VYTB 3WLRA 5JBQA 3LSRA 2J4FA 4UUPA 3B9QA 4FYIA 2YHBA 2LMDA 3GD5A 2G17A 1NJFA 3JASB 4HGOA 4V0ME 1U31A 5I8WA 1U2GA 5LMUB 2QLJA 1US8A 1X2EA 1E2DA 4OSEA 3ZKAA 1G38A 3S81A 2ZTMA 3CLRC 2PD3A 4WA7A 2E49A 4DQDA 2GXAA 2UUZA 4C3JJ 1PLJA 1R5HA 1Q1ZA 1C0WA 2YMLA 3DOIA 3NYQA 4KQGA 3TTXA 4I99C 3ZN2A 3E9MA 3E22A 1L5HA 4Y52J 3DKVA 3KKMA 4G5YA 4XTCS 1BMQA 2XVCA 5G4LA 3IBCA 1OXXK 4CQMA 4CV1A 4I8DA 4LG1A 5AUPB 2X2EA 4E1VA 1O3TA 2WD8A 5HJEA 2VIXA 4RB2C 5AW5A 3QMPA 2CDAA 2GHIA 4W1QA 4B3CA 4TXNA 1BW9B 1BCSB 1G6HA 3NHBA 4MVJD 5BSMA 4RMJA 4HDRB 1UC4B 2BEOA 2CQ7A 2P5LC 2GBPA 4F11A 2IEYA 2KB0A 4HR7A 1C3XA 2EBHX 4KR3A 2JLAA 3CMEI 1KI3A 3CQ9A 4QLAA 4LF9B 1S1CA 3RANA 2GCEA 3FMRA 4HQEA 2WF8A 2CE2X 5DHRA 4ASNA 3LPAA 1U6KA 2XD9A 2B94A 2HIGA 4LNUA 1KMHB 3HYSA 2DUUA 3SOZA 2AWOA 5JCJA 4DLSA 2HBYA 4MRPA 2CXRA 3Q6MA 4WBXC 4ZYLA 4BX3A 3NRVA 1UKZA 3DO8A 4NJEB