2GXAA

Crystal structure of papillomavirus e1 hexameric helicase with ssdna and mgadp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
270
structure length
270
Chain Sequence
b'TEKFDFGTMVQWAYDHKYAEESKIAYEYALAAGSDSNARAFLATNSQAKHVKDCATMVRHYLRAETQALSMPAYIKARCKLATGEGSWKSILTFFNYQNIELITFINALKLWLKGIPKKNCLAFIGPPNTGKSMLCNSLIHFLGGSVLSFANHKSHFWLASLADTRAALVDDATHACWRYFDTYLRNALDGYPVSIDRKHKAAVQIKAPPLLVTSNIDVQAEDRYLYLHSRVQTFRFEQPCTDESGEQPFNITDADWKSFFVRLWGRLDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of DNA translocation in a replicative hexameric helicase.
pubmed doi rcsb
molecule keywords 5'-D(*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*T)-3'
source organism Bovine papillomavirus type 1
molecule tags Replication/dna
total genus 83
structure length 270
sequence length 270
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Zinc finger, large T-antigen D1 domain 2gxaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gxaA02
1G5TA 3KKMA 5FI1B 1HH4A 2WOOA 3QUSA 1CU1A 4HUQA 3IDQA 1Z5ZA 2C9CA 3DEFA 1JNYA 4O2RA 2NZJA 4YLGA 2ZREA 3CF6R 4GOKA 3T5GA 3AQ4A 2VIIA 2J46A 3AF0A 3GEHA 3E2IA 4URZR 5FUYA 5IRCD 3SQXA 1G3QA 4QBHA 1NLFA 3C14C 4O0MA 4QM6A 1KI1A 4Q7JB 1VG1A 2OCPA 3VR3A 4CW7A 1W7AA 3RVBA 1PVOA 2ZI4A 1M6NA 2R6FA 3EIQA 1SZPA 3ETLA 1BH2A 3F3YA 1RRPA 4CEHB 3DKVA 4XH9B 1M7BA 1GVNB 1H8ED 3WRYC 1IN5A 3FHCB 4Q03A 3KQHA 3IBGA 4YDHB 4EPVA 4LBYA 2CXXA 3QKSB 1K5GA 3DM9B 4TMXA 2GDJA 4QM7A 5FTJA 1S1MA 3SZRA 1D9ZA 5FOUA 2ORIA 4A1FA 3MRSA 5CLLA 5J5CA 4C0BA 3THXA 4LV6A 2GTPA 4KBFA 4PC7A 2JLSA 1E32A 3BH7A 4QFMA 1E9DA 5JEDA 2IWRA 2ANBA 2A3RA 4HEJA 2WWWA 1G5RA 4FMBB 3BFXA 4LGMA 3U2QA 4V0LA 1ZIOA 4X8LA 4FMDB 1ZM9A 2ZRLA 4OJQA 1ZNXA 3NH9A 2ZSEA 3LFUA 4Q4HB 4YDSA 4EKDA 1SHKA 2V6IA 5L3VA 3KQLA 1TADA 1EGAA 4GRAA 4JZKA 3T1OA 4AKHA 2VA8A 3VR4A 3CH4B 3W6PA 1D2EA 2C5LA 5JWHA 4I81A 4DSUA 2VPPA 4KO8A 3OEHD 3A58B 2ODNA 3NIBA 1E4VA 1DAIA 3DOFA 4TLBA 1NSTA 1NLYA 1EESA 3CLVA 1OXVA 4MYTA 3UATA 4TL9A 1S9HA 3K9GA 1XXHB 3L8YA 4URWR 2ZANA 3V4FA 3MJHA 1GRRA 4DSTA 4NYMQ 4ON9A 2FJUA 2B7BA 3VR6A 3MSXA 4LBWA 1RPZA 3B2EA 2ZE6A 1U94A 3AKEA 2VHQA 1NNEA 5EE1A 2XOKD 4NPHA 5EQTA 2BBTA 2F9LA 3SI7A 3QXCA 4NP6A 1C1YA 1VDZA 3HPRA 1HTWA 3NG1A 1J2JA 4URXR 2D7DA 2R2AA 1SVWA 3PUYA 1UFQA 1II9A 3ASZA 2PCLA 1DPFA 1BS1A 3CRQA 4NU0A 4OHWA 4TLAA 5AUQA 4UNRA 5JJKA 1CF4A 1GL6A 1M1YE 4LHWA 3I8XA 3U3KA 4PSVA 1L8QA 1OXTA 3W9YA 4HAWA 4H1UA 3NKVA 1E2QA 1VHTA 4OJKA 4MDEA 1SKYE 1VCMA 3CO5A 1FP7A 3EZ6A 1EFRA 2QAGC 4M22A 1HQCA 3L0IB 1E98A 1KSFX 1NBMD 1EK0A 4IVRA 2Z6VA 4Q4JA 3DKPA 3E1SA 3NBXX 4BUJA 2J5XA 2IHYA 3GMTA 1FQJA 1Z0FA 1LV7A 1IM2A 2FFAA 1GM5A 4Q5IA 2MSCB 1U9IA 4Z8YA 1JECA 2PT5A 3DZ8A 4P4SA 4LPSA 2REXB 4MKHA 5IK2A 1SXJA 2QP4A 3EPJA 2CCKA 4ZI3A 5FH9A 3QBTA 2CL6X 2GBLA 4JLNA 3AKDA 3BK7A 4A0FA 4HLCA 5HR5A 3OIUA 2LKDA 3ZQJA 1RZ3A 2ZJ2A 3WBKA 2QNRA 3VFDA 1G9XA 2H5EA 1W44A 1Q3HA 2Z0MA 5CIQA 3TK1A 4B3XA 3TUJC 2VP5A 4B33A 2VHJA 1YE8A 2IWHA 2VSFA 3W34A 1OE0A 1QHXA 3GLIE 3GLGB 2CMKA 4CDGA 2OEPA 4ESVA 5CLQA 2VP4A 721PA 2C77A 2Z4RA 4ASUA 1JAHA 3ZZ0A 3FTQA 1ANKA 4L5BA 4XTCS 3SJBA 1CJVC 4M0LA 1N5KA 3R7WB 4A8JB 5KUTA 1R0XA 4ZCLA 1ZUHA 3EWSA 4AKIA 4DUGD 2CDNA 3KJHA 1XEFA 4HYYA 2WWIA 4FMCB 4ZI2A 4F92B 1JALA 3QF7A 2GCOA 2JIZD 1E79A 3GEEA 2OHFA 4TSFD 2CJWB 3GJ4A 3TH5A 1OW3B 4C0LA 3MGCA 1VTKA 1COWA 2C98A 2ZYVX 3JVVA 1B0UA 1G19A 3LQQA 5D3MB 1DAEA 3E5HA 4MRPA 4S2EA 1TF5A 5B64A 4MQBA 2F6RA 1SKYB 1G16A 2MSDB 4KLNA 5FUVA 1KSHA 2WIAA 5DN6D 5IF9A 2JDIA 2ZPTX 3OHMA 1G8PA 1S0UA 3GD7A 5LPNA 3UMRA 2XZPA 4TN1A 4TYNA 1TF2A 1RRCA 4W5HA 2GEUA 1IHUA 5GJBA 2FX3A 1S9DA 2PJZA 3PR1A 3KB2A 4A0GA 1Q12A 2ZUDA 5TV2A 2H7VA 4ZKEA 1RYHA 2CLSA 1XTJA 4W7SA 4RZXA 3ZVRA 5TXGA 4M2LA 1GILA 1MOZA 2WAYA 2O0KA 2IS2A 3RWOA 1E2MA 4V0ME 3SJZA 3H0KA 3DM5A 1IOZA 1XMSA 1RRGA 3K0AA 1KI8A 2W58A 2BBSA 4EDHA 3QE0A 4KFUA 1P2VA 4AY2A 1F2TA 1ZNZA 3LH5A 1DAFA 2DFLA 1L2TA 2IUUA 5KDDA 1UPTA 1EWRA 4Q01A 1C9KA 3A1TA 2IS4A 1HURA 1BYIA 2V54A 5AR1A 2WWGA 3D3QA 1NMZA 2I3BA 5KSPA 5FTKA 3B78A 4IDNA 1X8LA 2C9YA 4ACBA 3GPLA 4L9WA 4DKXA 1AS0A 1H8EA 2BBWA 1QRAA 3TUZC 2TMKA 1DE0A 2V7QD 2PMDA 4JLJA 3FVQA 2W00A 4R7ZA 4TTQA 1DADA 2JEOA 4PPGA 2QM7A 3FFAA 4Z51A 1FPMA 1M2OB 1QG4A 3B9PA 2GZDA 1XD9A 4URYR 2ZI6A 4KLZA 3SU8A 3PV0A 2WWFA 2C9OA 3LRPA 1GITA 5LBIA 2LKCA 1GKUB 4B35A 4RFSB 2RGBA 3NWJA 3NBFA 3O8BA 2YOHA 1YZGA 3CX6A 2NOAA 1R2QA 4GNKA 4Q21A 3LBIA 1E3MA 3QF4B 2W0MA 3WHKA 4OHYA 2VP9A 1M7GA 4NH0A 4HAUA 1LY1A 4RD3A 5DYIA 1G3UA 1AIPA 4OI1A 5C46F 2FA9A 2C8VA 2X19A 2ZJBA 2GVZC 2QAGA 4IOLA 1Z8FA 4Q9LA 4EPXA 2R6AA 2XTNA 3O8DA 3L0OA 1WMSA 2ZU6A 4TT3D 1OT3A 3T5DA 1ZM2A 1E9FA 1ZU5A 3GJ0A 3OEHA 4LX0A 4LYHA 4AKEA 3A4LA 1IBRA 1DOAA 1WE2A 4BFWA 2R62A 3OFND 1MO6A 4GPTA 3A1VA 1AM4D 1W5TA 1P9WA 1F2UA 4QNRA 1Q1BA 4DIEA 4TZ0A 2PL3A 3AUXA 2GVDC 3SDZA 5BW8A 5DGXA 2BKEA 3C8UA 1KKMA 1X86B 2OESA 3BC1A 2FPLA 4JS0A 5FBQB 2ZI5A 4V0OA 5TMPA 1JB1A 1NG1A 2WPDD 1HUQA 3P4XA 2NPFA 4C4PA 1R5BA 4IFEA 2ZRIA 4EIWA 2WMOB 5E3HA 2G3YA 2XOKA 2YV5A 3WYFA 5FL7A 3P4YA 5J40A 1G64A 2XZOA 1Z2AA 3ZJYA 4PAOA 3GJ7A 2WVJA 3UK6A 3AKCA 1EFCA 5BN4A 4B48A 3E70C 1MT0A 4YMWA 3I32A 2BM1A 4PXAA 1Q3TA 4Z8XA 5JEEA 2BV3A 3HR8A 3QVVA 4QNMA 4F4IA 1L4YA 2QSZA 4Q66C 2GNOA 1JJ7A 4GDFA 1RJ9A 3GQBA 1AKEA 2P6NA 5SZKB 1ZC3A 4BFSA 5JECA 3ZZTA 2PLFA 3UG7A 4RFVA 1P4SA 3KQNA 1NBMA 4KITB 4M9QA 2ZRHA 1OFIA 2HXSA 5E4FA 4URVR 1QDEA 3GFOA 3ZDQA 5CITA 2HYDA 4A2WA 2B92A 2GWHA 4US0R 5JLJA 4M1TA 1MO3A 1CRQA 5FPHA 5CB8A 1O3YA 4QG7A 2WKRA 2ZR7A 3DVLA 4F38A 5EE9A 3ZD7A 1N0UA 4MGKR 4E5UA 4KYUA 3VR5A 1CLUA 2NZ8A 3LY5A 2OT3B 4QGAA 3F8TA 4C0SA 3KKNA 1QHSA 1OYWA 2YWFA 3PCRB 4ZPXA 4DCNA 3TIFA 3JZMA 4LJ9A 2GA8A 4TLCA 4MKFA 3FMFA 3QXXA 2ZJYA 2GF9A 1W4RA 3ONWA 4NL4H 2O8DA 4M4SA 1OHHD 5EXPA 2HF9A 4JLOA 1YU9A 3CNOA 1FUUA 3KJIA 3MWKA 3AVTA 3S1AB 3NC1C 1YZLA 3C4JA 1E99A 2QPAA 2AR7A 3PUZA 4GOJA 4LC0A 3VX4A 3OE7D 4NYJR 2OLJA 3B1VA 3B60A 5J4VA 3M1IA 1AJEA 2JLVA 4OK3A 4RKEA 1MO5A 5LB2A 4KHZA 5JCZA 3W5IA 1E69A 5CDFE 3WHLA 4BFXA 1IXRC 1VHLA 4KYIB 3EXAA 3I1FA 4H9GA 1DEKA 3BH6A 5H68A 4HB2A 5CYPA 4LUCA 1Q1QA 2UZ3A 1OXSC 3ZIAD 3WP0A 621PA 3VKWA 4IOMA 2BEJA 4OYHA 1N6RA 1E2LA 3RS4A 1II8B 4PC1A 4TSFA 2JLUA 1KK2A 1P6XA 3L0PA 3FHOA 2N42A 3H2YA 3C15C 1E2NA 3RS5A 1FNNA 2FOLA 3CNLA 2P6UA 1UKYA 1S3GA 2GAOA 4IVPA 2JLXA 1D2MA 5TY0A 2X1VA 4EUNA 2XGJA 1GWNA 1KZ7B 1VPLA 4PC3A 1GOTA 2CHGA 3EG5A 2X2FA 2HUPA 4MYUA 4YQFA 1YVDA 4CZ2A 2FZLA 4C2UA 1KDRA 1BOFA 3ASYA 1ZBDA 2J9RA 2PZEA 3EAQA 4EFLA 2MMGA 4U02A 2BDTA 2RHDA 1HT2E 4Y0AA 4DSNA 4US1R 2OO7A 2FE4A 3T1QA 3TR5A 2ZITA 2J0VA 4HUTA 2ZI3A 2J0UB 5JRJA 2RAPA 3C16C 4Z1MD 1ESNA 4IVQA 2ZR0A 1S96A 3REGA 4HAVA 5B57C 3U7HB 2OFXA 3P27A 1NP6A 1HE8B 2QQEA 1FTNA 3EIEA 3RC8A 2IS6A 1EFUA 4Q1BA 3U44B 4AC9A 2D62A 2QGZA 1NG9A 1Q22A 1ZMXA 2KSQA 1YZTA 2WKQA 4LHVA 4PHTA 4A82A 1VG9B 3W8NA 4HZUA 4OI4A 4NYIR 2YOGA 3FKSA 2C78A 4DLRA 3ADCA 1Z0DA 2BKUA 1I4TD 2O52A 3UANA 4NYJQ 2IYWA 5DLQC 4TL8A 1P60A 2V7QA 5EUMA 5FFMA 2OCAA 4C2TA 3RS2A 4F4CA 4WBSA 5FPKA 3AB3A 1Z63A 5HZKA 3CRW1 5KSYA 4UNPA 5JSZB 4CYMA 2E1RA 2YJTD 3X1YA 3ZGXA 1G21E 4CT5A 1OYYA 3U4QA 3IPYA 1TAGA 4IDQA 3FKQA 2A2ZA 5C4GB 5K8LA 1XRJA 4C0KA 4D25A 5HKKD 5IT5A 1OLOA 4LPKA 1N6IA 5EZ5A 1ONBA 2XTMA 1G18A 2ZYTX 3FB4A 3PJRA 1N0VC 4JVSB 1B23P 5D3QA 1SVKA 1D8TA 5DISB 4KVGA 2GJAA 4HLDA 4C0JA 1LS1A 1AS3A 4PX9A 5EZ6B 6Q21A 3I5YA 3WYGA 2FSIA 2Z4SA 2BM0A 1SVLA 3A1SA 4TT3A 3MMPA 4PPNA 1KYIA 3RNLA 5KO2A 2QEQA 3I61A 1R6BX 4AURA 1EXMA 1VYVA 1W4AA 4ESHA 1JPNA 1QHHA 2YC4C 1AZTA 3F0TA 1BMFD 521PA 5HE8A 4Q9IA 3TSOA 3UPUA 3A4MA 4RZ2A 5FOSA 1KAOA 3NHAA 3IGFA 4C0AC 2FSHA 1KSJA 4XWAA 1XDBA 4P31A 2HT6A 2QA5A 4IEIA 4IDHA 2WPDA 1HEIA 1G8GA 2RGNC 4EAQA 3GJXC 3ND8A 4QC2A 2O8BA 1IJEA 4KFRA 1AQUA 3BS4A 4NTZA 1OFTA 3FOZA 2NIPA 2O0HA 221PA 1Z07A 2JJ2D 2AD1A 1J70A 4K81B 2WSSD 4OQFA 4NYIQ 5FI0B 2A9KA 2W0SA 1KJZA 4H1VA 1Q57A 2NO9A 3BOSA 4TLEA 5J47A 2V4ZA 2OV2A 4UNSA 2IL1A 4CEJB 2QENA 3CUEF 2DYKA 1DO0A 3AVPA 2QP9X 2UVQA 4OKSA 2P0EA 1T9HA 3H4MA 1AK2A 3V9PA 1A82A 1PZNA 5TDHA 3C7KA 3PUXA 3Q7QA 4TYQA 3P1JA 4G3XA 4D80A 4PANA 4JVNA 2F43A 4M1MA 1K5DA 121PA 1XXHE 5LD2C 1ZU4A 4CRWB 1KJYA 1XEWY 3AVUA 2GAAA 2QSYA 2L0XA 4CEIA 4KFTA 3FDIA 2O8EA 2CLDX 4JT4A 2J45A 1T3SA 2Q21A 3AGQA 1E96A 2SHKA 5HCNA 2QMOA 3H1TA 3DL0A 4NYMR 1QVRA 1R0YA 2O8CA 3W5JA 2IYLD 3U7FB 2QTHA 2WJJA 2ONKA 3C41J 4LHXA 3WNDA 4GFDA 1GNQA 1BKDR 3NBZC 3LNCA 2GCNA 2P2LA 3NEYA 5AUNB 2GJ9A 1Z6GA 3H84A 5CK4A 2BOVA 5K8TA 2ZM5A 5JJIA 4PHGA 1OHHA 4A9AA 1GIAA 5L3QA 2CVHA 3I5XA 1MR3F 4PQYA 1E9SA 1G41A 3UMFA 1JR6A 1JR3D 1KI4A 4OQNA 4UJ5A 3TR0A 3WMEA 1KY2A 4PHHA 3MFYA 4FCVA 4AYWA 2BVNA 3PUVA 3B82A 4F93B 3OE7A 5JFGA 1XPRA 3R9WA 2LCFA 3NBYC 1XD2B 1AZSC 3THXB 2CL7X 2O5VA 2OAQ1 5E7MA 3NVAA 3EPLA 4MRRA 3NC0C 1UKZA 5BN3A 5KDOA 2ZRCA 1OB5A 4B34A 4K8OA 4QBIA 1IY2A 1KI6A 2J0SA 3CW2A 4P0TA 4G5GA 3ZIAA 5EE3A 5C2JB 3AP3A 3NXSA 4DDVA 1YZQA 1II0A 1XCPA 5DNYB 1NVWQ 2R9VA 4KODA 3KUCA 3GFPA 1FNMA 3QKSA 4LBVA 3K0EA 5FPSA 2QBYA 1ZNWA 2R65A 5EE0A 1KAGA 2NO1A 1TQ6A 2DFTA 1G3RA 1I4LD 2FU5C 5L3SA 2QG6A 2CHVA 2WTUA 1U2RA 1VCIA 2QE7D 4NBSA 4F91B 3LAWA 3Q9LA 5JHGB 1PLLA 4D4MA 4DEXA 1TQDA 3K70B 1N3BA 4L16A 3GLGE 4IKEA 4IEEA 3TNFA 3T61A 4TYPA 4Q1AA 1Q0UA 5TVKA 4JBXA 3THYA 2V1XA 2X77A 5GVRA 1N6HA 2E9SA 4DEYA 2QP3A 4Q4HA 1XF9A 4B73A 2ORWA 4LJ4A 1PLJA 2CE7A 2VSOA 2NQ2C 1F60A 2C2HA 4JYCA 2J87A 4MUAA 1VYTA 3N2EA 4PZZA 1ZM4A 1ZD1A 4G1UC 4WZ6A 2QMHA 2RGCA 4QJ5A 3T06B 4PQFA 1VG0B 1Z6XA 2Q3MA 1KNQA 2HEIA 2RGAA 3GLFE 3KTAB 4EJSB 3ZH9B 3MG9A 5CM8B 4OK5A 3LA6A 2FNAA 1W2GA 2V55B 2I4IA 1CBUA 3BH0A 4M21A 4Q02A 5EUQB 1EWQA 3Q72A 4MYHA 2ZS8A 2XAUA 2VP6A 3IBYA 2J7KA 3UXMA 1XTQA 8OHMA 2RGNA 2XJ9A 3N70A 1CXZA 2Q9BA 3RDPA 4BFTA 1XTKA 2C95A 3PXGA 1NY6A 3LW7A 4JL8A 2OBMA 2VTKA 4TMZA 3QPVA 1UADA 1XPUA 3R9XA 2PJRA 1W5SA 2O0JA 4DCVA 2C96A 4NKRA 5DI3A 1NL3A 1JR3E 1N2CE 3QVUA 2G0NA 1NN3A 1IY1A 3P26A 3FGNA 3SFVA 4B2IA 4RY2A 4M1WA 4D4KA 1SXJB 1JXOA 3KQUA 1R8SA 3EA5A 4PO8A 3ICQB 2BWJA 2FGKA 1W36B 4OI0A 5HKKA 5EP3A 5FUWA 3AVXA 2RH5A 4ZCIA 3ZVNA 1GNRA 3BAFA 2BJWA 4BLRA 2QMEA 4CF7A 2X8AA 2VRWA 5H70A 1J7KA 3I8SA 5DSZA 3IHLA 4OBEA 3TQFA 4EQ6B 2FGJA 1KJWA 2WWYA 2XXAB 3DOEA 1KK1A 1EX7A 4OHXA 3LV8A 2GRJA 2XB4A 1XCMA 2D3WA 4PR0A 4B76A 3D7MA 1J99A 4I4LA 2IYRA 1NI3A 2WJHA 1JPJA 1BMFA 5AJWA 2JASA 3RC3A 3SBEA 4B3DA 2FFBA 1S8FA 4TMTA 4TTPA 4URUR 5JJLA 3EC2A 1Q1EA 4FCWA 3QPWA 1D6JA 1UDXA 3QG1A 2MMCA 4ZIRB 1EG7A 5G53C 3B1ZA 1CR1A 3BB1A 2GJ8A 2CE2X 4FMDF 4FCTA 1W1WA 5GJWC 4F7WA 1HE1C 1KO7A 2DCUA 3SQWA 2FH5B 4EPRA 3R20A 2ZE5A 4R2IA 2Q9CA 2XSZA 4MYCA 4B71A 2I1VB 4FI3C 1X8KA 1LS6A 3AVWA 1N5IA 4QBGB 1K6MA 2NG1A 1TPZA 1TNDA 2GCOB 3IILA 3SS8A 1ZM3A 2D2FA 3SHWA 2OM2A 3LW8A 4B6EA 2WSSA 3GLFB 2HT1A 4DDWA 2F9MA 3AP2A 1IN7A 1TQ2A 1M8PA 2ZROA 1Z6AA 3EC1A 4NZYA 1ZM7A 4DLVA 3CM0A 3IEUA 4LI0A 2ATXA 3IEVA 2D74A 2ZS9A 4G5RA 2W6JD 1NMYA 4DHEA 5LDDC 4NHOA 3KFXA 4FXPA 4LYFA 4HI0E 1HV8A 1ZC4A 421PA 4TL6A 3AVVA 1Z08A 3R7WA 3LWNA 1KI7A 2IYYA 3FPAA 1EFTA 1YZUA 1RE0A 1G5PA 3X2SA 2CVFA 2JLQA 1UBEA 4L4UA 4S35A 3KDSE 4WOPA 4A4DA 4DXAA 1DARA 4YMVA 3DMNA 4LC1A 3SHFA 3M6AA 4MRSA 4I1UA 4D4JA 1TU4A 4HDOB 1FX0A 2R6GA 4QHYA 1XJQA 2VEDA 3PVSA 2CJWA 2IBMA 1OF1A 4MDFA 4D4LA 1RW4A 4QJ3A 4X8HA 2GXSA 5D3MA 1F2TB 1QZXA 4UKDA 5SZIA 4AG6A 1OB2A 4IJMA 2H16A 5DO9A 4D0LB 3EW9A 2H18A 3W6OA 2OSBA 3VNVA 3THWB 4P3YA 2ZYWX 1DVRA 1KZGB 5AWFC 5FOVA 3DPUA 4BEBA 1G3MA 2EFCB 5BXQC 2YZ2A 3K53A 1ODFA 4RSGA 4B3GA 2QY9A 2YYZA 5E95A 1G4UR 3OESA 1YZKA 1H8HD 4MGIR 5TB5A 1US8B 3K0CC 2PBRA 4R2HA 3B8HA 1KMHB 1W0JD 1AN0A 1JQLB 4I1VA 1A2BA 2KWIA 4TMKA 1GDDA 5G3ZA 4DT1A 3FFBA 2HF8A 1GL9B 3CF2A 3FMIA 3HP1A 3SC3A 2F3TA 2VP2A 2VF7A 4LV8B 2OCYC 4TWZA 5DE3A 4U7DA 1XMJA 4Q1DA 5HPYB 4DB4A 5IDVA 1GKIA 1S4QA 3CX7A 4DLTA 2FEOA 3GJ6A 4Q4AA 5CIWA 1P2TA 4G0NA 5HZHA 4MITA 4RZ3A 1UJ2A 3EPKA 4IOJA 4TLDA 3KXLA 3LBNA 3CIOA 2IF2A 1CULC 5TARA 4RD2A 3GLIA 1KOFA 1KKLA 1U81A 1ZVQA 1S2MA 4AYXA 2QAGB 3FHTA 4GL2A 3GLHB 3OF5A 2JA1A 3DMDA 4GMXA 4KJZA 4V0NA 4DCSA 2GILA 2OUKA 4UXHA 5JS8A 2H92A 2FG5A 2QE7A 2XX3A 3CZQA 3L8ZA 1NN1A 2V8OA 4PO1A 2JLZA 1T8TA 2QL6A 3IUYA 4RFSA 1H65A 4TQAA 1WQ1R 3TW4A 1QHYA 1F2UB 1KDPA 4DIDA 2VYFA 2RMKA 2UZIR 3L2OB 4FN5A 5BYKA 2W83A 1T6NA 3KL4A 4AWXA 4NDZA 2QN6A 4PTLA 4OQMA 3G82C 4FMCF 5JRZA 5AK0A 2VHCA 5KNBA 4B3BA 3VU9B 3KB1A 2H17A 2Q9AA 2P65A 1YKSA 1AGRA 1LTQA 4EPTA 1CRPA 4L9SA 4PZYA 3U7EB 5BN5A 2P6RA 3IHWA 5FOTA 1R5NA 2YC2C 1XD8A 4DLWA 1AQYA 4HATA 1JI0A 3MJRA 3AM1A 3QG5A 2IYSA 3EZ2A 1CR4A 2C03A 1GZSA 1I2DA 3MWLA 4AIIA 4B3CA 3KZ1E 2ZETA 1Z29A 1E0JA 4A36A 2XB2A 1RJ9B 4I1SA 4HB4A 4ARZA 4RD1A 2ONJA 2A5DA 2ZJAA 4JVLA 1A2KC 1NVVR 2AD5A 4ZDJA 1VMAA 2B7CA 3HR7A 4DLUA 1N6NA 1QHGA 1TQ4A 2QM8A 4V0MA 2ZSBA 5FTMA 5EP1A 4BASA 1E6CA 3RAPR 4O2LA 2FPKA 4Q00A 1FP6A 3OEED 1XWIA 2HLDD 4JT2A 1OKKD 4E09A 4D6PA 1NN5A 1VIYA 4M9SA 1CEEA 5KPDA 4AI6A 3RABA 1P61B 1ZJ6A 4IDPA 3B9QA 2D7CA 2ZU0C 3QKUA 1DELA 1DO2A 1E2KA 1QHNA 3SOPA 4LSGA 5CM9C 1XJCA 5FR1A 1E9BA 1AGPA 3WP1B 2EWWA 1JQJC 2DHRA 3U6BA 2GXAA 2WJVA 3K09C 1T4GA 3VKGA 3GCGA 1Y63A 3JZAA 2ANCA 3D31A 4WXPA 1RFLA 1E2PA 3HU3A 1N0WA 2F7SA 2Q3HA 1Z83A 2JGNA 3WBJA 2PZFA 2HXYA 4N0EA 2HCBA 3TVDA 1MABB 5IHPA 5F3WB 1CJKC 5FBVB 2DWOA 1XBTA 2B6HA 1W0KD 3O8RA 4Q9HA 2IYUA 1RRFA 2QT1A 4MGYR 2FDCA 3SR0A 4B74A 4LCBA 4OQLA 2Y8EA 1VCNA 2BMJA 3VQTA 1IN8A 2OFWA 4KCGA 1HYQA 4O3MA 1T3LA 2IXEA 3AEZA 4B75A 1UEIA 3QKRA 4P33A 4BE7B 4DLZA 4ZV4A 3BFVA 1XEXA 1N6PA 3B1YA 3LO5A 4PC6A 1U0JA 3VKHA 3AF3A 1NJGA 4LV5B 4DUGA 3EARA 5J4KA 2AN9A 2WSMA 1E2JA 1VG8A 1XMVA 4C0QC 2PH1A 3P20A 4GP7A 3K0CA 4O25A 3S1AA 4YXWD 1KHTA 1DAHA 2JIZA 5AJYA 4KAXA 1SVMA 3UWKA 3ZS8A 1SVSA 2FFQA 3ZZUA 1NN0A 2WJGA 4IHQA 1Q20A 1W48A 1TX4B 4ZO4A 1NVVQ 3DO6A 3ZVMA 3QSYA 4DCUA 3HU1A 1LNZA 1V5WA 2REOA 2W6JA 2NO0A 2GXUA 2HDNB 3IPXA 5B2ZA 5UKDA 2XTZA 2EFHB 4JBYA 5DN6A 5GJVC 4HDCA 5SZHB 3K1JA 4GOXA 3O47A 4DZZA 1OIXA 3KQKA 3TGPA 1GRNA 2EW1A 3KKPA 1OXXK 3X1ZA 3GEIA 1P73A 2WKPA 2JJ1D 4NMMA 1KO1A 1XFAA 3QKTA 2ATVA 4XSHA 1ZIPA 2HJGA 3KKQA 5CYOA 2OZEA 4A92A 3IIKA 4TYYA 1N6LA 1T8UA 5A5GA 3AV0B 4QOSA 1SHZA 1UEJA 1CIPA 2IYVA 4G01B 2G6BA 2D2EA 5G41A 4DVGA 4Q1EA 2LWIA 1XX6A 3CPJB 5B58C 1KK0A 1AS2A 1E2EA 3WRXC 2JJ8A 4MGZR 1UAAA 2R6CA 1OIVA 4OHVA 3K70D 3ADDA 3WNCA 4XTRA 1WBBA 2ERXA 4WW0A 4JLDA 1T5IA 2GHIA 1I4DD 4R71A 1UBCA 2WV9A 1JXMA 2AKAB 1P62B 4LY6A 5JI3E 2KI5A 1H8HA 3TSZA 4HZIA 1UF9A 2W2TA 4DLXA 4L15A 5P21A 4LJYA 5AJXA 2OLKA 3K0SA 2E87A 2IS1A 2Q6TA 4LRWA 4QJ4A 2ZRPA 4QHSA 1W4BA 2O8FB 2KBEA 3EZ7A 2GCPA 2EYQA 3V4RA 3RWMB 3AF1A 4B3FX 3MUFA 5JBQA 2FV8A 4LJ6A 1G3IA 3M0EA 1Z6YA 4LOAA 3M4YA 3LDAA 1S1CA 1NRJB 4M1KA 3WMGA 1RYFA 3LXRA 4I99A 4DRZA 4L8GA 3PG5A 2DBYA 4AK9A 4JSTA 2EFEB 3KUDA 3CWZA 3Q3JB 4IW3B 3QQ5A 3FYHA 4HB0A 3K0FA 1R7RA 5EP2A 1XZQA 5FOXA 1LF5A 3HYRA 2ODWA 5CDFA 5FBRB 4K46A 3L43A 5EXSA 3P32A 3BGWA 3CRMA 5JWRA 1UKVY 4LJAA 1KO5A 2C99A 1YRBA 4X8MA 4BWYA 1HQYE 1YR8A 2P5SA 3REFA 3RRZA 3K70C 5KU1A 3OFNA 3EIHA 2F55A 4EPWA 2JAQA 1E2IA 4C7OA 2FPMA 2FZ4A 3TBKA 4BGDA 3TAUA 3BIFA 1NVXQ 4M53A 2I1QA 2JCSA 1AA9A 3BERA 2Z5FA 3B6EA 3LX5A 1N5JA 1A4RA 4LK2A 4Q7MB 3RANA 1PJRA 4M9ZA 2RGGA 3K09A 4V03A 3K8YA 3MWYW 5F98A 2N1BA 1KDTA 1VYUA 1SQ5A 2PT7A 4M1OA 1V43A 1E0KA 1CR0A 1LW7A 3CR8A 2OBLA 4JJKA 2QT0A 4II7A 2JATA 1LVGA 1S3SA 4GI7A 2WIBA 1U90A 4FWIB 4MKGA 4EJSC 4JYBA 3QEOA 1R10A 2VH5R 1G8HA 5ANRB 3EPHA 1UDWA 4BLSA 2ZEJA 4KU4A 1WF3A 2J0QA 5JMTA 4PAQA 4LJ5A 1XPOA 1XP8A 2V3CC 5KHOC 3EASA 3Q8XB 1QF9A 2F43B 4GZLA 4BECA 3D6TB 4A15A 3RHFA 5EE5B 3OEEA 3BE4A 1KI9A 4TL7A 5FTLA 1E79D 2H1LA 1PUJA 2HLDA 4CEIB 1CP2A 3RSOA 4QGFA 1QVAA 3UWOA 2O8EB 1GAJA 4HUQB 4IXNA 4P4TA 2DPXA 3TJZA 3SFZA 2O8CB 5F9HA 2VO1A 4BFVA 3TQCA 4UQOA 4Q9KA 4CGZA 4IXMA 2OXCA 2RCNA 1A7JA 5L3RA 1MRNA 3B13B 3HWSA 3HJNA 2PX0A 2JDID 3VMFA 3L0SA 2BIFA 2WAXA 4LZZA 3WNBA 4F4JA 2QROA 3IQXA 3I72A 2GEVA 3RRYA 1TMKA 2ZVQX 3VTKA 1E1RD 1E2FA 1IXSB 3A37A 5L3QB 3CPHA 1ZAKA 4ERNA 1GRQA 2OBNA 3U3RA 1CJMA 1IAQA 2QRNA 4LJ7A 2PX3A 2RHMA 4G5SA 2MSEB 2DFKB 4DSOA 1W0KA 5FL3A 4GSYA 3ADKA 4IRUB 4LDJA 5DHFA 2XJ4A 3T1VA 3CPEA 3A6PC 4XWOA 3AGPA 1JJVA 5CK5A 1ZD8A 4YMTA 2F1RA 4JLKA 3DZDA 4JL6A 4JJZA 3OIVA 1QBKC 4R9UC 3EZFA 4RD0A 3DHWC 4ZCMA 1KI6B 1JAIA 4JKYA 2WWHA 3I4LA 3KX2A 5EXXA 4A8JC 1RC8A 3QXJA 1DAGA 4HDQB 5AUOB 2BHRA 1SXJE 2YWHA 2EQBA 4WZBE 4XWKA 1P9RA 4CEHA 3U3OA 1JEDA 3AVQA 2YHSA 4JL5A 3TLXA 1W49A 1XTRA 2OCBA 2QORA 2AXNA 4BZQA 3AF2A 4YXWA 3VHXA 2QBYB 3IIJA 4JLMA 5C1BA 3U3JA 1E9AA 3KKOA 3K9HA 3MCAA 1DS6A 1P72A 3AUYA 3WMFA 5L3SB 2GXQA 1T0HB 3SJAA 3IO5A 1TUIA 1XD2A 5AJVB 5BQ5A 2PEZA 4IFBA 4QXAA 2C04A 4Q4LA 1OH6A 4FW9A 4RD6A 3UG6A 1LF0A 1NKTA 1ZW6A 4WZAE 3BORA 3FWYA 4FD2A 2QPOA 1E9RA 2R44A 1U8AA 1NF3A 1OIWA 4D0GA 4HAZA 2ZXUA 2BMEA 2ECKA 2PLRA 2QU8A 2G0TA 2DY1A 4XVQA 5GJCA 5J4LA 3THYB 4UNNA 4NCNA 2XZLA 3PITA 5C18A 2QI9C 3R8FA 2IX3A 2JJ1A 1G8YA 2ZR9A 4TMWA 2ZRFA 1MH1A 4BQSA 1KI3A 1T0JB 4WVFA 2AFHE 4JLPA 5B30A 4QHTA 2BC9A 1F48A 1KNXA 4N0DA 4MRVA 4Z1MA 1F5NA 4RVCA 4CIDA 1IQPA 4WXRA 1VECA 2WBLC 3QJYA 5K8UA 1F3OA 5DYGA 3QXHA 3EX7C 2WJIA 1ZP6A 2YNMA 4P4UA 5EJEA 3OIYA 1L7VC 4R98A 4EPYA 2R6DA 2EVWX 4JVMA 1ETUA 1X3SA 4LBZA 2AHOA 1XXHA 2J7PD 2ZAMA 3N5CA 4XVRA 3TUIC 3EWAA 1YR7A 2YOFA 1XJ0A 2ZAOA 3QI2A 5FPTA 3UMSA 1YRAA 1XTSA 2OG2A 5AUPB 2IK8A 5KSZA 4C30A 2YWEA 2R8RA 5FL7D 1AKYA 4ABYA 5JHHB 2RB4A 1SVOA 1MKYA 3QXSA 1E2DA 1M7HA 4QRHA 4Q4JB 2PZGA 5DH9A 3QPUA 1G7SA 1I2MA 1UKEA 5HE9A 1RVDA 3R9IA 3CF0A 5DI3B 1W4CA 4PPFA 2CCJA 1EFHA 5KNDA 1WDTA 1G6HA 2F1JA 4TYWA 1NSFA 2B8TA 4Q48A 1R8QA 3BFKA 3ND9A 4P4SB 3KTAA 3X1WA 3BXZA 3QIAA 4EJSA 2EYUA 1RKBA 2AXPA 3K9NA 3SNHA 4WIAA 3C5HA 2ZRGA 2ZRJA 3T34A 2ZRKA 1PLKA 3PIRA 4QGGA 5M04A 1M74A 1OXUA 1ZRHA 2JLYA 2W2VA 4XJXA 3A1UA 3RS7A 4W5JA 4RZUA 1G7RA 2G1KA 5LD2B 1O87A 2QAJA 4LJ8A 3CNNA 5F2EA 1Z2CA 4KXFB 1G7CA 2ERYA 1G8FA 5DI9A 1G1MA 1W2HA 3PEUA 1TUEA 4HSEA 1N5LA 5F9FA 1Q44A 3EZ9A 1Z0JA 2G1JA 1E0SA 4W9MC 1SGWA 5C4MA 2UKDA 2F1HA 5ELXA 1NLZA 3TAHA 4POAA 2QMUA 4AKGA 2G83A 3X1XA 1GL7A 3PEVA 3T15A 4JMPA 5FTNA 4Q7KA 1XB2A 4EQ6A 4NCKA 4HAYA 2XXAA 3FMPB 1E0AA 1WXQA 3W90A 4PHFA 1KI2A 1VIAA 4JKIA 2VHUA 3HYTA 2WMNB 4HB3A 3OAAD 2BBOA 2JJ2A 1WBDA 5H1YA 2AL7A 2ZE7A 5JCPA 1NY5A 4N3NA 4OHZA 3GLGA 1IN4A 2DR3A 4KVAA 3NEJA 1LB1B 2GK6A 3GLHE 4LYAA 2WHXA 5EXTA 3CB4A 2ORVA 3A8TA 1DTSA 3A4NA 4UJ3A 4MRNA 1KTVA 1X8JA 3SEAA 4ZIRA 1FW6A 2IYXA 4E03A 1CKEA 2WJYA 1DG3A 4X8OA 4I1OA 1HA3A 3RYTC 4A8JA 4PZLA 3AVYA 1G7TA 2B21A 2D4HA 1FFHA 2ZRAA 1TEVA 5KTYA 1YJ5A 5J4HA 3TRFA 4OQXA 3ZYCA 4Z54A 1FX0B 1G291 2GETA 4BEJA 1JBKA 3QOFA 2WM9B 4C0HA 3GLFA 3OZXA 4Q1CA 3RSLA 3VR2A 4A0HA 2A5FA 3D8BA 2V6JA 1CTQA 5FPYA 1UM8A 2OXRA 3K0AB 5DHAA 5DIFA 3PEYA 1JEEA 1IJFA 1NIJA 2REBA 2WICA 3EA0A 3QENA 2A5YB 5HTKA 2YINC 1YQTA 1T5LA 4XD7D 5A4JA 2A5JA 2DFNA 3ADBA 4B47A 1GP2A 2KJQA 4CT4B 1E1RA 1E1QD 1DAMA 1Z06A 1R0WA 2P67A 2QZ4A 1TL7C 1W46A 3ZS9A 2NO7A 2IXFA 4G5QA 1BO6A 2KBFA 1ZD9A 4W5WA 3AF4A 4Y0VA 5CJPA 1JR3A 3T35A 3K9LA 2GEDA 3W3ZB 4V02A 1HT1E 2FFHA 2ODBA 4JLVA 4DT1B 2RKOA 4TTRA 4MKIA 1G6OA 4NONA 4IDOA 1NBME 1D5CA 1Q1ZA 3VHLB 4OL0A 1TU3A 2A5GA 1IY0A 2AFIE 2IHBA 3W8RA 2IYQA 3BRWD 4B2PA 2F3RA 4JLBA 3SYNA 4Q4AB 1X6VA 3CRRA 4IOKA 4XVUA 3THWA 1R0ZA 1WCV1 4KSBA 3FKSD 1F6BA 3AKYA 3AP1A 3GLIB 4N1AA 5BYJA 4MH0R 1MV5A 3ZVLA 2CNWD 3MWJA 2Q3FA 1US8A 5JWOA 1Z22A 4D82A 4A6XA 1SULA 1KMHA 1D9XA 1P5ZB 2GZHA 4BLOA 2VSXA 3PQCA 3BWDD 4HAXA 5JS7A 1TEXA 2IEZA 1FUKA 2ZSFA 3LLUA 2NGRA 3AH8A 5HCIA 1KSGA 2P3SA 2ZVPX 1N6OA 1WRBA 1KMQA 4HLQB 4ITRC 1U8YA 3N2IA 4OK6A 3RLFA 4YMSA 3TVTA 4DLYA 3U7GA 2BMDA 5KPJA 3W3AA 3QF4A 1DG1G 1E9EA 1GG2A 2BJVA 3IKJA 1EX6A 2X2EA 3VAAA 2V1UA 3MD0A 3SYLA 4YC7A 1FOEB 1WB9A 2BMFA 4FWTA 4ZKDA 3GLHA 3B85A 2ZS7A 5FOWA 4Q18A 3FMOB 4B2LA 1KK3A 4MA4A 1OH7A 1UBFA 5GVSA 1ZNYA 3GJ5A 1Z3IX 2XITA 3G0HA 2ZQ5A 2ZUBA 3BD9A 4LYJA 5GADl 2WWXA 3LBHA 4Q7LA 2J41A 1YR9A 4OI2A 2ZRBA 1NVUQ 2ZTSA 3MAAC 4DWJA 3RRMA 1PV4A 2HJVA 1E94E 4BFZA 2A30A 4ARZB 5JI2E 2J7PA 1KY3A 4QGHA 2XNDD 3ZLJA 2EU8A 2OAP1 4NCJA 4BRUA 1A5TA 1G17A 1OV4A 3VU9A 1R4AA 3L82B 1OSNA 3ECCA 3WYAA 1VCOA 2NPIA 4PSAA 4PFSA 3GJ3A 2Z83A 1GTVA 1OPXA 1X1SA 3J81k 4BRWA 3VNUA 5AJZA 3SYKA 4E07A 3KFVA 3LD9A 2ZYUX 1OH8A 1ZUIA 2CK3D 2VLIA 2ZE8A 4KI0A 4US2R 3U61B 2IYTA 2ODEA 4M8NE 1NMXA 3B1XA 3MLEA 1GSIA 2GJKA 4NCIA 5KSOA 4A0RA 3TMKA 1CJTC 4GMDA 2FF7A 1Z28A 4E22A 4D2IA 1KGDA 2W6ID 2ZJ5A 2RGEA 1IXZA 4DDTA 5E7JA 1G4AE 3R8CA 5KNCA 2O8DB 1ZUNB 3CRVA 3CBQA 3QBVA 4B43A 5KOYA 2KB0A 5J4YA 4BLQA 3BBPA 3SJCA 2FMXA 2NTYC 2ZI7A 1CR2A 1P75A 3OIWA 2ZSDA 2AKYA 3JVUA 4M9XA 3U6KA 3LLMA 2DWPA 1PUIA 3KXIA 4G5OA 2VQSA 4UXIA 3VR1A 3KJEA 1SVIA 2AWOA 3PENA 2A78A 4HLUC 2H8KA 5G40A 3QKRB 4JSYA 2ZRMA 4BFYA 3CWQA 3PEWA 4TZ6A 1XEXB 3A36A 4PSKA 3QNUA 2J59A 4J0QA 3NDBB 2HYIC 1LFDB 1FL9A 5CB6A 4A6PA 4KSCA 4U5XA 1U8ZA 3H86A 1XNJA 3V00A 4B32A 1MABA 1ZCAA 4B6FA 4AG5A 3OAAA 5SZJA 1YHNA 4D81A 3TW8B 1J8YF 1GKYA 3O8CA 4XSGA 3GFTA 2FN4A 2ASEA 4YONB 2QTVB 1MRSA 1OJLA 2IUTA 4FIDA 1FQKA 2GZAA 4XIGS 3DDCA 1X1RA 1T91A 4GP6A 2W2XA 2ZJOA 4TQ9A 3KXKA 1GFIA 1ZINA 3PUWA 1D2NA 2EWVA 1Z47A 3Q7PA 3FE2A 1FTSA 5BWMA 1TTTA 3NH6A 4NCHA 4BPBA 2IA5A 5FBWB 4DCTA 3CH5A 2VP0A 3HU2A 5G3YA 1GNPA 4PQRA 2PEYA 3C5CA 5FBLB 4AD8A 4LHZA 4DB2A 4KBGA 2QGNA 5FUXA 2CHQA 3T1TA 1XEWX 1Z0AA 1E9CA 2QRZA 5A0FA 4RKFA 1E2GA 1II8A 1E2HA 3IIMA 4RD4A 2DB3A 4KV9A 3CONA 4ILEA 4PPQA 2GF0A 4PO9A 2JLWA 3U60B 3TKLA 5EP4A 1GUAA 4PAMA 1W47A 2F1IA 1BYUA 1ZYUA 4EFNA 3HPQA 3Q5EA 5FR2A 4DDUA 3WXMA 5L8VA 2D06A 2HCJB 2J1LA 4LWZA 1U99A 3A1WA 4XD7A 3NHBA 4JIMA 5KDLA 1Y3AA 4LHYA 2YVUA 3TSWA 2NO6A 3UKDA 4BLTA 4DLSA 1OH5A 3Q85A 4HZUB 4P32A 1E1QA 2G77B 1XTIA 3NDPA 1OFUX 2IUSA 3CZPA 5E7IA 4DJTA 3I73A 1YZNA 2K5UA 2QPTA 1XMIA 2V9PA 3TE6A 3HDTA 4PC2A 1SKQA 1W0JA 2YKGA 3LVRE 4YMUA 1DAKA 3T12A 3I92A 2AWNA 2J0UA 3CX8A 4ZDIA 1A1VA 3CKLA 3LX8A 3GP8A 2RGXA 2IEYA 3KJGA 821PA 2XEXA 1P2SA 4D0NA 1OFHA 3U4QB 3PFIA 1NIPA 2OILA 4ACAA 3I62A 2ZJ8A 3W6NA 1ZCBA 3U44A 5H8WA 1E4YA 4C3ZA 2GJSA 1WA5A 4FINA 3BJIC 2FEMA 2VBCA 2ZIAA 4QBFA 2CL0X 4Q47A 2PCJA 3G5UA 4M1SA 2CNWA 3SBDA 2QTFA 4V0KA 1NKSA 2ZUCA 3GJ8A 1QG2A 2KE5A 1EFRD 2BEKA 2IC5A 3K0FB 3RS0A 5CJ2A 2IYZA 2EFDB 4CVNA 5JZVA 2AK3A 1IN6A 2IW3A 4QKQA 2O8FA 4WAUA 4ZDKA 3THOA 4DC9A 5JSZA 3U3MA 1KO4A 1QHHB 3BB3A 2VL7A 4XOIA 2XNSA 1ELOA 2DWQA 3UIEA 1L4UA 2N46A 3LVQE 2RGDA 4RCZA 4C7OB 5IK2D 1SXJD 1DBSA 2HV8A 3WY9A 2G9NA 1W36D 1BIFA 3F5FA 4GT1A 2ZRDA 4EFMA 2AK2A 4A2PA 1N25A 2EFGA 2WZQA 2IT1A 2O8BB 1FMLA 3I3SR 4D26A 1U0HC 4GBMA 2YWGA 1WP9A 1J90A 4JBWA 3RRNA 2IXGA 1XU4A 2JLRA 1YR6A 4ZDWA 1IONA 2B8WA 4C9BA 2OFOA 3QY0A 1G20E 2G88A 4BLPA 3IO3A 1Z0IA 1KDOA 2IF0A 3U5ZB 4BZXA 4A2QA 1P7CA 1TF7A 2GESA 4JLAA 2PMKA 4Q19A 4M1YA 2WOJA 1MO4A 2VHTA 2NMVA 1C4OA 4RCYA 3B7GA 4RJLA 4QL3A 2A7QA 2XNDA 2FWRA 5KYKA 2GKSA 4ASUD 4UNQA 2Q0HA 3CR7A 1N6KA 1RIFA 2BCGY 4HLUA 4DBLC 2CBZA 1T3HA 2H57A 1Q21A 2XSZD 4GZMA 1Z6TA 2FSFA 1HY3A 2ZRNA 1K8RA 1J8MF 2CLCX 2AX4A 2VF8A 3NTUA 2BCJQ 2ZJZA 1P9NA 4KFSA 1P2UA 2ZSAA 5LB4A 3X1DA 3ICEA 3AVOA 1P3JA 2P5TB 1Z0KA 4TMVA 2CK3A 3SE0A 1U9IC 3ZD6A 1OKKA 3VX3A 2OE2A 2GK7A 3RS3A 1ESMA 4BZPA 1SXJC 1R5OA 2CEAA 4U00A 5K8IA 3Q5DA 1COWD 1VKJA 1W36C 3LXXA 2GBLC 2CCGA 4UXJA 1U0LA 2J3EA 3SN6A 1CS4C 3B5JA 1FZQA 1KIMA 1U98A 4BFUA 1XZPA 1XCGB 4CEJA 2Z43A 3LQRA 4TQUS 3ZQ6A 1UBGA 2W6IA 4Q1FA 2QUZA 1CJUC 1FMJA 1KO8A 3IQWA 1M34E 3BB4A 4AYTA 1QHIA 2QQ0A 4NE2A 1NJFA 4MUBA 2ZI9A 4Q9JA 4B44A 4WA7A 2FSGA 3QEJA 3B1WA
chains in the Genus database with same CATH superfamily
4KI7A 5AOBA 4HUQA 1MFZA 1Z5ZA 3RVDA 4XB2A 2VIIA 4CM1A 4XLFA 2XRNA 3OCZA 1J0XO 4PV7A 4CW7A 1PVOA 2P40A 3H17A 1H8ED 3KQHA 3RM3A 3BQYA 1EPUA 3E1GA 2FJ1A 4Q82A 1GCGA 1D5VA 2PZKA 3V7RA 1FDVA 4RNCA 3U2QA 2ZRLA 3NGLA 3LFUA 4EKDA 2W5UA 2C29D 4M7PA 2VA8A 3S3TA 3VR4A 2XGOA 4ZYAA 4Z0TA 1QLWA 1BW6A 1E1YA 2VPPA 3BXXA 1BW9A 4ZRMA 1IJWC 1I1QB 2E7ZA 2QX7A 3CLUD 2GZ3A 3PD7A 3K9GA 1VGQA 3U48A 4L28A 4H77A 3MSXA 2HBYA 3HCPA 4JUBA 3C24A 4J3JA 2FWAA 1VQNI 3PVZA 4LB5A 1WB6A 1OLTA 1ZVJA 4NV3A 1SVWA 2A6TA 4LHWA 4BMNA 1V7PC 2H0RA 1NVAA 2HOAA 3ABOB 3S7ZA 4DW8A 4OU4A 3GGGA 2AQ8A 3VYSB 2AG1A 2DOKA 3JRXA 3L7DA 5ILGA 4HF2A 1ZL2A 3GN1A 1SMYF 1SXJA 5F5LA 1DC3A 4AJEA 4B3XA 1OZGA 1UP6A 1NPDA 2FZCA 3CKYA 1E8DA 4ER7A 3FWNA 4RK4A 5LZ9A 4FNMA 2QUBA 3BHNA 721PA 1E17A 1L0OC 1OWOA 4MR9A 1ZUHA 2VH1A 1NDQA 4R54A 3KAPA 3QF7A 4RFLA 3I4FA 4S2EA 1VZ3A 5B66C 1N5DA 5JS2A 2F3SA 1ORVA 1LK0A 2VE8A 2GEUA 2XA9A 5GJBA 2FX3A 4XWWA 5JVGF 3NT4A 3ZCQA 3UAYA 1RYHA 1WJBA 1T0FA 1Y6IA 4EKYA 4TOIA 2HPHA 3PTAA 1J1UA 1F8YA 1C2YA 2GXBA 5U4QA 4DKXA 5KYXB 1QF6A 5BSKA 2O57A 3TDMA 2PXHA 1KMNA 2W00A 2QRUA 4R2KA 1U8TA 3KPHA 2G4CA 2WUGA 1R2QA 1XZJA 2C4HA 3CEHA 1ETYA 4J0KA 3QF4B 3RC2A 1XLWA 2OG1A 1GAXA 4X0GA 3CXRA 1W8IA 1QPZA 1A98A 4N7MA 2B5WA 2GVZC 2VSYA 2R6AA 1ZM2A 2ISYA 1SCUA 1DOAA 4P34A 4NVRA 1Q1BA 4PN3A 4TX1A 3AUXA 5GIPE 4FGSA 5EWMB 3H2IA 3I5MA 3HJGA 4O29A 3RTEA 1FIAA 2ZIXB 2BLNA 3VNBA 3ST7A 2IHNA 4CQLB 4GXOA 1KEPA 3E9QA 3HPGA 1SBNE 3FMQA 3ODPA 1O95D 3ZBUA 3ZWDA 2EFYA 4J90A 1SC7A 2HXSA 2K6GA 1QDEA 1XCLA 1E6MA 4BXOA 4A2WA 2X1MA 3DA8A 4BO2A 2MYUA 2HSJA 1Y42X 4F38A 2A35A 3IRQA 3B6IA 3IQFA 4DJ5X 3NO4A 1BJKA 1TKAA 1JPUA 3P9PA 3TIFA 1YBAA 4Y6RA 2K3FA 1X92A 2E49A 4DMKA 7MHTA 3CNOA 5E6UA 2LOOA 1YZLA 4Q93A 2OLEA 1JHMA 3DMHA 4ZVNA 4L78A 4OK3A 2COMA 1MO5A 4KHZA 3ABZA 4XK4A 1SK9A 2GPBA 5CDFE 1THGA 3HN7A 4YPFA 2QTNA 1V3QE 1VB3A 1L4NA 2G7UA 1BJTA 621PA 3V5NA 1U6KA 1PR0A 1VE5A 3NIWA 2ISSD 3CC7I 2ST1A 3C15C 2HNKA 2PRZA 2FOLA 3CNLA 4DIMA 2GAOA 3G1OA 5L7WA 1HRDA 2W2KA 3DE0X 2QQGA 4ECEA 4P7JA 3HVHA 3IUBA 1UMCA 5F1RA 2G9QA 3B53X 3WB0A 2CLOB 3QKWA 2QTAA 1I0IA 3K5WA 1ESNA 3RYHB 3I56I 4M0DA 4BNLA 3EMVA 4PFJA 2A61A 4Q1BA 2D62A 3NHYA 4HZUA 4NYIR 3K6SA 3IXMA 5JBIA 3ZK8A 2EHJA 2OCAA 5FX2A 4WBSA 5HZKA 5JSZB 4W8OA 2MLKA 1VCHA 3H0DA 3CPSA 2OYSA 3LCMA 1L7XA 1TAQA 3BHJA 4BAYA 4YH1A 5EZ5A 1G18A 1YUBA 3PIDA 2ADFA 3LA7A 3HL4A 1SZJG 4UUTA 2H48A 6Q21A 4KE6A 4CN8A 2ZJ1A 4XSXF 3B38A 3GEDA 4RELA 2W6OA 1JPNA 4GLOA 1HBJA 2HSDA 3OZCA 4LNAA 3C3BA 4KWCA 1QSGA 4RZ2A 2HT6A 2RGNC 2ZFUA 2B82A 2UZ0A 4KFRA 4LMRA 1QRRA 3TNYA 4BNDB 2NZ2A 1KEKA 221PA 2W43A 1Z07A 1J70A 1C8KA 2ZXEA 3ELDA 3F5SA 1EKXA 1JT6A 5ICCA 2ESRA 4IZOA 4RA6A 2E1CA 2VF5X 3TRKA 5ALMA 1P4GA 5EVCA 1M6VA 4YCLA 4UB8C 4M1MA 1ZU4A 4IQ0A 3F0CA 1ILWA 1GZ6A 4KFTA 1E96A 1QIMA 2QGFA 3VZQA 3HXTA 1IB6A 1YIAA 4BL5A 5IDXA 4A2UA 1LPAB 3G2MA 3OO0A 1FTGA 3D0QA 3KR9A 9MHTA 2OCCH 4BNYA 3I5XA 5C8YF 2VWQA 1W8DA 1UFMA 2RAFA 3FJ1A 4E7OA 1QQAA 2W6NA 4X66B 3SFTA 5LP6F 1PT7A 2PJDA 2W4MA 3EPLA 3QLEA 5KDOA 1OB5A 5K5EA 2EERA 2R4TA 1Y1VJ 5EE3A 4MVJE 3ILVA 4II3A 1DQNA 3HO6A 4LBVA 1OPCA 2NVQJ 4HD8A 3O6BB 2AW5A 3MTEA 5CYFA 3L1PA 4ZYDA 3KWFA 3COSA 4YIIA 3FNGA 3QH4A 1KDVA 2D54A 3L07A 3UC5A 4UQLA 4MTDA 2FWPA 2C2WA 4N4NB 5K4HA 4RB0A 3U56A 2ORWA 5LLTA 1ZM4A 2CHUA 5JU6A 3FW1A 3H1BA 5J63A 5BUSA 3L7IA 3SHTA 4OK5A 3E7PA 4J0IA 6YASA 1FVFA 2XD4A 2VP6A 1U2EA 3N70A 4E5DA 5CLIA 3RDPA 1XTKA 1L3BA 2AYYA 4NX2A 3FGNA 2OENG 2BWJA 2FGKA 5FUWA 1RC1A 6REQA 3UV7A 3HJBA 3BAFA 4E1VA 5H70A 1J7KA 1PHPA 4EJ2A 2HLPA 4OBEA 4WRRA 2RI6A 2VHVA 4Q39A 4UZSA 2QD5A 3P9XA 3CTPA 4NZMA 4I3HA 4URHA 5C7YA 1JPJA 3OYFA 1XIVA 5CFNA 5LGNA 4E6KG 1EG7A 1ZSNA 1SD2A 1LS6A 5FRDA 1SC3A 2PMHA 1O3RA 1MB3A 2HT1A 3T6KA 1UOEA 1M8PA 3MVEA 1CB7A 3PIPF 1B9NA 4F6CA 4XGIA 1P4XA 5ALEA 2WVGA 2Q62A 5JSFA 4WN9A 3TLMA 1HV8A 4G1EB 5JQGB 4YG2F 4W63A 1PZMA 3W2IA 1FX0A 2I6XA 2WAMA 1TZ2A 3OYHA 3K2AA 4CM7A 4IHVA 1Z5PA 4HQEA 2VJMA 5ULLA 2X13A 5DW0A 4K6OA 1N33B 4L07A 2C2BA 3OESA 3Q3SA 3K0CC 3V2IA 2R6ZA 1E8NA 1ML3A 3V2UA 2HF8A 2F3TA 1X7YB 4WWCA 1SFEA 2Q4EA 4Q4AA 5HZHA 3KV1A 5LP1A 3OWTA 3MOIA 3EEBA 3VZCA 2VYNA 2OUKA 3AYXB 2BZ0A 2QL6A 3ZHQA 3DQQA 3WFJA 3CDHA 2DUJA 2UZIR 1U4NA 4RB2C 4LB6B 4PTLA 2G72A 5E8IA 5MHTA 2VZ0A 4Y8VA 4EY6A 1N2EA 3GDWA 2I6UA 3QG5A 2FFJA 3WVNA 2H6BA 3CS3A 4M54A 2ONJA 1A9SA 1NVVR 4BNHA 2VNAA 5TJHA 3OYDA 5FOQA 4D6PA 2B9VA 2DVMA 1E20A 5ALFA 2JANA 3VR6H 4COKA 5FR1A 3TTVA 3OWHA 1NG6A 4JGGA 5I7SA 1WX1A 2Q3HA 1RKUA 4RK5A 1JGGA 3LDFA 4C7VA 3JQRA 5IN4A 2B6HA 5HUHA 3TINA 3RJZA 5L6MB 4QDUA 3HSFA 3VQTA 5FKKA 5KREA 2ZT6A 5E0OA 1RQ7A 3G23A 1N6PA 2HSEA 4C0QC 2VI6A 3L6RA 2D8MA 2JIZA 3VC2A 2NS0A 1IY9A 4ZYVA 1V5WA 2YIDA 4O3FA 4PJLA 2ZBEA 3ZV4A 1P73A 3DOCA 1KO1A 3L4JA 4DMMA 1TMOA 2FEZA 4GECA 5B58C 2NVXJ 5GPCA 3GZ4A 4YJ2A 2RQQA 3C2QA 3KEQA 3ESAA 3JV7A 3PFFA 1XDSA 5IFLA 4YP1A 4R71A 2P2GA 4S0HB 3J7AY 2HBQA 3COAC 4MCJA 5P21A 4XCVA 1ZARA 4GW3A 4UZFA 5L51A 5TPWB 3DEYX 1J33A 2I80A 2VDVE 4LOAA 1ZYRF 2ECOA 2FR1A 5EMKA 3K1MA 3GNQA 4ZREA 3QQ5A 3TLBA 2C4VA 3ZDXB 3O21A 1RR6A 4DMUB 1YQGA 2JH3A 4R7GA 3ADOA 4C3VA 5DM6F 4XDGA 3OFNA 3WTUC 1E2IA 2KFDA 4G2TA 3FISA 1SFOJ 2I1QA 3BERA 1K7AA 3QOEA 1SQ5A 4BX0A 2NUBA 2VKHA 3L05A 3QVJA 2OBLA 4RORA 4S04A 3E22B 1FTQA 2KZVA 3WL8A 4QEDA 3DXYA 2EV9A 2GQQA 2IYNA 1OBFO 4EW6A 4OUDA 5I8ZA 1P5JA 1QGYA 3J80A 1L5VA 3TJZA 2XVCA 5L3RA 3AESB 1AMUA 1GQ2A 4FFSA 4MVCA 1POXA 2BIFA 1CUCA 3RRYA 1BQEA 5K5OA 1T1SA 5L3QB 3GGJA 5AI5A 3HP7A 3U3RA 2YX4A 5AOAA 3FJOA 4EJVA 3TFOA 4DR7B 4NC8A 3I9MA 2PVCA 1B6RA 1JJVA 3DMRA 3RYIA 4JJZA 1LTHR 4DYHA 1ACIA 3UAWA 2FPIA 2BM8A 2M3AA 4QDKA 2G28A 1JT0A 1JEDA 2QKYA 3U3OA 2YHSA 2PNJA 3W5DA 5IJWA 4UBMA 3WMFA 3QFRA 4U2DA 3EDCA 2XGMA 1YCFA 4H6XA 3D5QA 1M1UA 4RH3A 5J4LA 5CUQA 3GT0A 4UNNA 3NDIA 3MLAA 2AEEA 1GZ3A 2MA3A 2AFHE 1T4CA 3HABA 1TIPA 3OO1A 2WYUA 3I2IA 4RVCA 2WBLC 5DYGA 2TSYB 3DEUA 4M7OA 1Z82A 3GRFA 5BPIA 1JLHA 3O75A 1L3IA 3ZX4A 2PRJA 3E4DA 1YHYA 3DE5X 3M8JA 1JE1A 5BOSA 1W30A 1FYEA 2PJRB 1CD5A 4YFXF 5CEFA 5IJ9B 2CCJA 1NSFA 4J03A 2YV2A 3SNHA 1QO0A 3C5HA 1HDOA 2ZRGA 2VRCA 3IDZA 2PO5A 4PQEA 1XDUA 3EEFA 3FZYA 3KZKA 4RAOA 5KNLA 2QAJA 1Q44A 3EZ9A 3PXBA 2AG0A 2C7PA 3Q98A 2J6BA 1BXZA 4POAA 4MW4A 1Z7UA 4FGWA 5JR3A 3ZE7A 1E0AA 1WXQA 3W90A 2PL5A 2A86A 1GU0A 4J94A 2WC2A 1Y48E 2ZJPF 1C1DB 1IN4A 5ALRA 4Q6BA 3CB4A 2A7XA 1FW6A 1CQWA 2WJYA 2I8CA 2IDJA 4EI2A 5J4HA 1D1CA 3CCUI 4PGGA 4PZUA 5IZCC 3F1KA 5DHAA 3G7UA 4Z49A 2YVKA 3VVBA 2P9GA 2B4KA 2A5JA 5EKDA 4HWOA 4I6ZA 4B47A 1XG5A 3VDQA 4OXXA 1QJCA 2EKBA 2QZ4A 1AUXA 4RDCA 4G5QA 4C87A 2KBFA 1LK7A 3AF4A 3T35A 1U7WA 3UJHA 4OF4A 4KKVA 2DOEA 5LMZA 2Z3VA 3LI2A 4IDOA 2FWJA 2VT6A 4JC0A 2O8XA 2IHBA 1WCV1 1HLFA 4MMZB 4KDPA 2CNWD 1FTZA 2HZ7A 3PQCA 3ZXSA 1KJNA 1SOMA 1AQIA 2JGFA 4O2BA 3CB2A 3KKEA 1U7TA 1MENA 1YTYA 4AM8A 2HTJA 4UHDA 2UYHA 4MUIA 1RHJA 4EMUA 2V1UA 1IDYA 1I7DA 2P6OA 1U2ZA 3GJ5A 2E4XA 2ZUBA 1ZK2A 3LBHA 1YU6A 4OQYA 1KY3A 1FUIA 1DZ3A 1HWYA 1U2DA 4MR7A 3CJTB 3TO7A 3GA5A 2B4TO 1GNLA 1R4AA 3ECCA 1QANA 1OPXA 2XPVA 3K0LA 1A8HA 3E3OA 2C0CA 2JD0A 2ZE8A 4ZTJA 5SV2A 2NZWA 3KPJA 5IJAA 3TGNA 2OB2A 2G9RA 1TQPA 4NMHA 1LI7A 3RVJA 4TRRA 1BG6A 4DZPA 2KLHA 4TV9A 2HHCA 5B4VA 3HWWA 4KV7A 1A8PA 2ZI7A 7ABPA 2IIPA 4RF3A 1QVUA 3AJ8A 4HX7A 5C0OE 2WY2D 3VR1A 5IVKA 2Q5HA 3PENA 2BTQA 3A36A 2ECCA 1WXHA 3MB8A 3ZE6A 3NM6B 1MA0A 4GKAA 5CCBA 4D81A 3Q1LA 2XDVA 1QUEA 3SMQA 5AXCA 5CXSA 2R7UA 2FYTA 4KWHA 2W8BB 3T4PA 3FE2A 5BWMA 4ZP1A 5FUXA 5E4JA 3U9GA 3VKFA 2ON6A 4G7HF 1SBQA 3FDZA 3MYYA 2PUCA 2GN2A 2GF0A 4E4RA 3U60B 5CBPA 2WEKA 3VUEA 5DIZA 2ZT7A 1U99A 4E21A 5ALJA 3DBVO 3IH5A 2Z33A 3GLSA 1ZRMA 4EM1A 3UT0A 4JFAA 4QLAA 3DMYA 1KS2A 3HDTA 2YKGA 4I3GA 2J0UA 1EKEA 3BIWA 1USSA 3PFIA 1E3LA 5ARDA 4O2AF 1E4YA 4RKRA 4YV7A 2QYHA 2JH9A 4FOSA 3AFOA 2PCJA 2G5PA 4MROA 1E1CB 1OX5A 1YBFA 3T5CA 2EFDB 2QTWB 4GPEA 1O97C 4DC9A 4G8JA 4JXJA 3G73A 1MOPA 2VL7A 3NHFA 3WLQA 1C9JA 4EB0A 3KP7A 1C0EA 3WOHA 1AKUA 1E1NA 2UUOA 2W2NA 1YL7A 1R5JA 1WP9A 3IUPA 3RRNA 3DEZA 2L01A 1B16A 2OFOA 4HS4A 1OCOH 2Z6UA 3IO3A 3MIZA 2PMKA 1XZ8A 3G79A 5ICFA 2X0FA 2O03A 2VZEA 4J0CA 2ZIGA 4HLUA 1N6KA 1QKKA 4J0FA 5BYAA 4WGGA 1M1ZA 3K2IA 1AKTA 2K3PA 3BT9A 2JG3A 1GPYA 2AQIA 3RUAA 2EP8A 3WLHA 2IXSA 3EF1A 2CCGA 4YWHA 1U0RA 5GMOA 4JASB 4J2TA 3AU9A 2W6IA 4BY7J 3EDQA 3VPBA 1B43A 1U5BA 4MUBA 4I4IA 4JVOA 3ZGNA 3QEJA 1JBQA 3STHA 5EKTA 3QUSA 4DIQA 2L42A 2HSWA 4Y6OA 1JFVA 4U1RA 2H4ZA 2DK5A 2ZMEA 2D1SA 4AICA 4B82A 1VG1A 3PDIA 1NW5A 1NUUA 5LRRA 3BMNA 4KMFA 3PQ7A 4ZCTA 3CINA 3T1YB 2GDJA 4MSUA 4AMBA 1D9ZA 2WG0A 5FOUA 1Y4SA 2ZWMA 1YJXA 2E1OA 4F72A 2O2IA 4N12A 2JLSA 1E9DA 1YE3A 2IWRA 1NI5A 5LNK1 2ENWA 4H0CA 1L5WA 2VXBA 3VWBA 5AVZA 3SIRA 3E5NA 1CUYA 2L3DA 1FP1D 2R7LA 2C5LA 5CFLA 4PGHA 1DDGA 3OEHD 1OI4A 4YJFA 4TL9A 3NHKA 4IGEA 4FJ2A 4UUBA 3FPSA 5KNBD 4G6TB 3B2EA 4ZQIA 3MK31 2F5DA 3R9XB 1ENHA 5EJFA 1ZOOA 5AHOA 3CLOA 2C2MA 1QP8A 4URXR 5AUQA 1OU4A 1EQ2A 4M72A 3HG9A 2WW8A 2VS1A 4IX9A 4EW2A 1VHTA 2R8YA 3QUQA 1DKMA 4Y7DA 2PL9A 1YCHA 3DWFA 3WJ2A 2JFFA 2FG7C 5CAEB 1LV7A 2MABA 2NOJB 5FLXZ 1RS0A 1W9MA 3GZ6A 2HA5A 5BQXA 2PT5A 4RWEA 1F9AA 2YRXA 2X85A 3PIIA 3KR0A 1WWKA 5HR5A 1BIAA 1RZ3A 1P1CA 2DCEA 4F96A 1QM5A 5IVPA 4PGMA 1U2GC 2VHJA 4HQ6A 3FAZA 3GLGB 4EGQA 4BO4A 3U4MA 4EA6A 4PLTA 4BU1A 4C78A 1NK3P 1ANKA 3ICCA 4N5DA 2HKIA 4V0RA 3KLMX 1M8JA 4CBVA 4IZZA 3S1NJ 3DJFA 4E2ZA 2Z8ZA 1B1AA 5HKBA 4QQFA 1TF5A 1RZUA 3F6OA 5L4LA 4PN7A 3C3EA 1NXTA 5GIOE 2JDIA 5AKEA 1RRCA 1W4ZA 5H9VA 4X1IB 4C4XA 2PAAA 4EJOA 4QDOA 2BPOA 3ZDZB 2YZNA 5G0TA 2LMDA 1WXDA 4KN4X 4JP8A 3K15A 2BBSA 4AY2A 1L2TA 4S24A 3D5TA 2JWTA 3BGVA 2VWGA 1B7GO 3GVXA 4KIWA 3Q3IA 4RZSA 3OIOA 2P9EA 2GBIA 1U0BB 2C0PA 3B9PA 3LQ4A 4ZQHA 3VJRA 2ZI6A 3DU6A 2X40A 3ZEIA 1Q19A 3N7AA 3I8OA 3PDJA 4NH0A 4BC1A 3INNA 2BGCA 5BVGB 3INRA 5AKKA 2CQKA 1WPGA 1QHHD 2MWMA 2XYVA 2R62A 5A4IS 3C6BA 4OA8A 2WFLA 1XO1A 2BFOA 4R81A 5A0VA 3UK0A 4ZD6A 3JVEA 3D81A 5TMPA 2W57A 1HSOA 3PKIA 2JIRA 5E3HA 2G3YA 3V42A 5M3MJ 2P4SA 2BZGA 3NM4A 2GBPA 4OIPF 3UK6A 1VKHA 5BN4A 3IA7A 1OFUA 5CFMA 3ZCUA 4JYAB 3ZDFA 1T2UA 2SCUA 5SZKB 3G13A 3P5BA 4WX2B 3GFOA 1P9QC 4BXUA 2H4JA 2Z5GA 3SQNA 4G4IA 1URPA 5KYWA 4GGPA 1R4MA 4QGAA 4YAJA 2E4WA 2GAJA 3JZMA 3VI3B 3HWRA 4X61A 2HEOA 2Z6AA 3WLOA 1T26A 1GNTA 4BHBA 1MC4A 2Q29A 1YS7A 2C2KA 4QE3A 3F1LA 4CCKA 2KP6A 3VX4A 4R1MA 3M1IA 4NHJA 2ADMA 1VL6A 1KC1A 4WBXC 2HJ9A 1EFPB 2UZ3A 1ZGCA 4EKIA 3ZV3A 1CYDA 2Z2JA 1KYZA 4A3EJ 2RGWA 2YPRA 4A91A 4IDDA 3CA8A 1E2NA 2JD1A 4REQB 4ZDLA 4PC3A 3X44A 1C3VA 3D8NA 3JPYA 5TGZA 2G6TA 2D5BA 1P5HA 2MR5A 1SM4A 4R8KA 3EAQA 1FVXA 2BDTA 2Q50A 1PFWA 3QYFA 1NW8A 1ON1A 3C3JA 4H0NA 4WK6A 3VR0A 2BD0A 3SC2A 2OCGA 3QWHA 2QTTA 3PGMA 1HE8B 1EFUA 3W9UA 3DVRX 1HG1A 3CN7A 3OU2A 4IIJA 2PYDA 1Z8HA 5FCDA 3WSVA 2YJTD 2YHBA 4ETNA 1TAGA 2EINH 2XCQA 4EHIA 1SOWA 3QP6A 2BEWA 3T9EA 2QHXA 2F67A 3RUEA 4LHSA 3RNLA 4TT3A 2VRBA 1UXIA 1LLDA 4UOEA 4R0MA 1REQB 5AESA 3TSOA 3OA2A 1MBKA 1SCDA 1KAOA 2FSHA 3WLMA 2YXDA 1JSXA 2OV8A 4XE5A 4JGIA 2Y1LA 2FN8A 1I5ZA 2EJWA 4L73A 1Y7HA 1MAUA 4Y6GB 3LX6A 4G8BA 2AD1A 4HZFA 4PFQA 4NYIQ 2VYVA 5JDCA 1AV7A 4BBRJ 3GA0A 4F5EA 1NV9A 1W35A 2I9PA 4XR4A 2QSJA 1PZNA 3FOCA 3RPUD 3TZCA 4WLNA 4HDRB 3OQIB 2GRUA 3H1TA 2O8CA 2IYLD 3WNDA 4AP9A 1S7AA 2DTRA 2Z56A 4ZI7F 2WU0A 3LNCA 1IHXA 4XBFA 5K8TA 3UHAA 4DHWA 4NBVA 4IJQA 2SKCA 5ALUA 3TR0A 3GLLA 1PUFB 3VFZA 3B82A 3OE7A 4Y1RA 3WL4A 3HUGB 5KNCH 2GHTA 5HLHA 1UKZA 2IU4A 3QODA 1YB6A 3OIFA 4P0TA 1WDLA 4CG2A 5KOHA 3UB3A 4G5FA 1YFLA 3W6KB 1C7ZA 4F4FA 4HF7A 3W5AA 2DFTA 4L7QA 4FZRA 2JVHA 1ISMA 4RVFA 3VMMA 3PHBE 5CT9A 1U2RA 5KVCA 1BX1A 2QE7D 4NBSA 3G02A 1ZNQO 3WYBA 3FDYA 4LJ4A 2FRXA 2M87A 1CGPA 4DLNA 3L6BA 5K7FA 3OD1A 4LVCA 2RGAA 2K85A 4RVOA 2JEYA 3M6LA 1EWQA 4MYHA 3URKA 2DMQA 3FUUA 3PXGA 1I7NA 1PJAA 4F84A 1CQJB 4R1HA 2EA2A 4WL0A 2RHJA 1U04A 4HNAB 5IABA 1R8SA 4CYDA 4YR7A 4KUGA 2B0CA 4RQUA 2KRHA 3MC1A 1B15A 2BJWA 3I8SA 1Y80A 5FWAA 3D7KA 2Q1TA 1KRWA 5ELLA 1O7LA 4LF8B 3OKAA 4X92A 2Q2VA 4WKNA 4TMTA 4C3HJ 1PP8F 4NULA 1WJCA 3VHRA 4FCWA 3QPWA 2C6YA 1W7PA 2CE2X 5CFPA 1QGDA 3MUEA 3NNDA 3TQTA 3PHCA 5JNRA 4UTVA 2DHDA 2GCOB 2VNHA 1S5PA 2AYZA 2IE8A 1QP4A 3AP2A 3HA3A 1TQ2A 5LM3A 5T8KC 1I39A 1VSVA 4H7KA 5CR9A 421PA 4JD5A 3HLYA 2CY0A 1EQAA 2N8GA 1OMIA 4IEJA 1DL5A 2CVFA 1M5UA 4S35A 3KDSE 4MRSA 3INYA 3IOYA 5KYYB 3GW2A 2A94A 4FNOA 4U2EA 3FGOA 1D0YA 2XCLA 3K53A 2VOOA 5AHKA 4R1UA 4ADSG 3QEMA 2JBWA 4AROA 2R7VA 4F6RA 5ICGA 2J3MA 1JEYB 5HWSA 1AT1A 2HMAA 1JMKC 2OCYC 5I7VA 3U21A 4KBYA 4YFKF 1U4SA 4ZO6A 4GR5A 1N2XA 3LKZA 1USTA 2KDZA 2D00A 1Y9EA 1D6MA 5TARA 2L7FP 2P8TA 1IATA 4DCSA 4GS5A 5FO0A 5BQFA 2LYCA 3V8QA 1K0FA 2Y0CA 2X6TA 3IUYA 3QBJA 5I4KA 1J56A 5BNIA 4ZOBA 3HB9A 1UQUA 4GPD1 3OX4A 2WIGA 3C70A 3S2GA 3AR4A 3RBVA 3IWFA 3LYUA 3ROXA 3S28A 4XDYA 4L9SA 5TR9A 3C1DA 3IHWA 3N76A 3JXEA 4YTEA 3QMWA 4MQVA 2XV1A 3A6ZA 3FDJA 4IAOA 2GZSA 1JEAA 2ZETA 3WLJA 2ZJAA 3HTXA 2J4DA 4ENNA 4G81A 2ZOSA 3MSCA 1BHSA 3E8XA 5CXQA 1FP6A 5AKIA 5D7NA 1NULA 1ZQ9A 1TLLA 3FXLA 4HRXA 1U9OA 3B1KA 4C4OA 4PSXA 3T7JA 3UWPA 3WP1B 3LECA 4BCCA 2O54A 4FIZA 4ZVTA 3G3ZA 4FISA 2WU8A 3E7WA 1PNOA 3EBOA 4MGYR 2FDCA 4QWMA 1U3UA 4LCBA 1XN7A 2IXEA 4JAVC 3HHEA 1JV2B 4HGYA 2J4FA 5EZYA 4MB2A 2JNWA 2VHWA 1TXGA 1XMVA 2FZVA 3P20A 3FOFC 2KRFA 2XQFA 3TZHA 2JAHA 3CESA 5AHRA 4ZOCA 3K4HA 4XMYA 1NVVQ 1NM5A 2IVZA 3DR5A 3JQAB 5HLIA 4JJ8A 4C7KA 2XTZA 3LHKA 2IBSA 4BPRA 3KQKA 2V1NA 1GRNA 1LU9A 3NRVA 1IRXA 4KWTA 4XSHA 4ANFA 4XOUA 2VBXA 2G6BA 3HKCA 1ZCFA 4Q1EA 2LWIA 3JQ7B 1LFUP 1XZAA 3K3PA 3VC7A 2NSDA 2NV2B 4INOA 4I4TF 2IS1A 3LOPA 4CTMA 3L7OA 2F1KA 1O7JA 4BRZA 2GF2A 3V4RA 2QQFA 2ELKA 3AF1A 4KIJA 2IYEA 2YMMA 2XUFA 3LQ2A 4WJZA 4GYJA 1Y3FE 1Z6ZA 1PHRA 1N1GA 3DAYA 3KUDA 3KPWA 4IW3B 5AIPA 3T7CA 2ODWA 5C8YA 3K4PA 2GK3A 5LRSA 1UKVY 2NU6A 5DSXA 2C99A 3K70C 3EIHA 2F55A 2JAQA 3NJ8A 2R7AA 1W88A 4QASA 1RYEA 1TMGE 2OC4A 3RO7A 1YULA 1FP2A 3FFXA 1VYUA 5AKYA 2XUKA 2F1OA 4U9UA 4PNHA 2PX5A 3HVUA 2WLTA 2FPRA 1ATIA 2ZB7A 3AXTA 5K2MA 4A3SA 1J21A 1XROA 5KS2A 2G4VA 4ND8B 5ABPA 2J0QA 4R1OA 4BMCA 1BVUA 5FQNA 1ZSVA 3L6CA 4Z9XA 5KYVA 1NBOA 3OEEA 3MJCA 4IXNA 5EIAA 5JFRA 3IXQA 3QIVA 4IVNA 2PGDA 2RE8A 4WXCA 2ZSJA 1CY6A 4FC6A 1G2IA 3BGSA 4BB5A 5IT4A 2GEVA 3BUSA 5D87A 1CF9A 2ENUA 1BGXT 2K86A 2B1RA 2PX3A 5K3OA 4DBLE 4RLFA 2QN2A 3UENA 1M0WA 3JY6A 1FS6A 5DNCA 3WRXA 1GU7A 1PYGA 2VJLA 2J3KA 4A8JC 4HH0A 4CMEC 4NXMB 4RSHA 4B5KA 4JL5A 1HYBA 1XTRA 4KLAA 2ZB3A 5KX5A 4JOSA 4ZICA 4KLCA 3AUYA 4LK1F 1ZRSA 2NADA 4NBKA 1OH6A 1E7QA 1VE6A 1X39A 4NQRA 1NKTA 3PPWA 2QPOA 2R44A 3H1GA 1U8AA 3UOWA 2G0TA 3JWJA 4IH4A 1R0BA 4NCNA 1GTG1 4FR5A 3VV2A 3WKCA 4BQSA 4L3OA 5CFZA 3O6VA 4XUDA 3SZUA 1JKJA 3WU0A 1JFFA 4XN0A 4LVNA 2X48A 1JJ6C 4EY5A 2AKEA 5EIBC 4R98A 2FX2A 4EPYA 1XT6A 3EXIA 4Q3NA 3F7OA 3N5CA 3F22A 1YR7A 5ICEA 3T1HB 3USES 2ZP1A 1PIWA 4KLRA 5FL7D 1E2DA 1UKEA 3R9IA 2ZZMA 4Q48A 3ND9A 1KH1A 3BXZA 1XNHA 2OOKA 1TK2A 3Q9NA 4FBGA 3SQLA 3G49A 2NP6A 3HTUA 3H0CA 1F3LA 3A1UA 1WTAA 2K02A 4BJ5C 4EVSA 3CNNA 4EARA 1JILA 3DZHA 3OC6A 1G1MA 1PQUA 1IQ0A 3M83A 2D0PB 2BV6A 2HCFA 2UKDA 3ABIA 4XWYA 1NLZA 1B2RA 5FLKA 1ZH5A 1U3VA 1V7ZA 1QH0A 2R4UA 1CZLA 3RU7A 2WDPA 3F74A 1KVUA 4NQWA 4DRXB 4X1EA 3NKFA 5A1JA 3IRRA 2NUPB 1JEQB 3K6RA 3QVTA 5EXTA 3AEYA 1N9GB 3IVAA 2PUTA 4MEAA 4MWTA 2B9SA 5I7AA 1MB9A 4IRMA 2EV0A 5CB4B 2EBIA 4MW1A 5I4IA 1H8AC 1JEEA 1ADCA 5JATA 2NYXA 2KMLA 1E1QD 4XQGA 4EBFA 3UGKA 3R60A 1JR3A 2CJFA 1I51A 3DE1X 3KDAA 3EJ6A 3K8OE 3CXUA 1GCUA 1BA5A 5FNVB 2AFIE 1L7RA 2ZVJA 4NCAA 1IH8A 1VTNC 3JAKA 1DTWB 3PWKA 4CDRA 4P9FA 3AP1A 4D3YA 5JG7A 1WZCA 1EP1B 1P6QA 4I4NA 3KP4A 4U2KA 2VSXA 3BWDD 3BPSA 3ERED 1H9GA 4LY0A 1QGPA 1PNQA 3IUQA 3OE4A 1H3NA 2C9DA 1BI3A 2NO4A 1EVIA 1UBKS 3W3AA 2XKPA 4AZ0A 1CUDA 2XTAA 1LDEA 4E6PA 2RNJA 5FOWA 1KK3A 3KQQA 4F8EA 1OH7A 3BWVA 4EVIA 2H9YA 4RTLA 4YMIA 2N9UA 2V9KA 2FXIA 4KPUA 1MQ9A 3ZV5A 1QFXA 3F71A 4L8FA 4KIUA 3AV3A 1ESDA 2WB1N 2EU8A 3JQ8B 3M6MD 1RQGA 3VU9A 3ETDA 3FPLA 2RI0A 1P7VA 2CB9A 3KFVA 4X44A 1LLUA 3G59A 5BWCA 1CY8A 2ZJRF 2DAPA 1MJNA 4E22A 4HJXA 1SUWA 1VQPI 3PL8A 3ESWB 3QBVA 4BLQA 3SJCA 3K5HA 4BB9A 2AKYA 1YVPA 5I48A 1J8DA 2DWPA 5KQLA 1EE1A 1TMYA 2AWOA 3CCEI 4GVLA 3RTAA 4MIOA 1RVV1 3EOAI 4PSKA 3ESZA 4QFBA 2EIMH 1LFAA 5LZ2A 5LQRA 3YASA 4OH1A 4PCAA 1B14A 2XXBA 3TW8B 3GFTA 3W4KA 4ZYYA 3K1TA 2GZRA 1SHTX 3DDCA 4JDPA 4JFRA 2CW7A 1Z47A 4MQUA 1P6RA 4LRXA 2ZJFA 4MLOA 4IG9A 5G3YA 2E89A 4RPJA 5IKPA 4EP1A 3CONA 1YBVA 1SCNE 2FP4B 1GTZA 1YNOA 4W6ZA 2DBVO 2D06A 4OOIA 4XD7A 3UJ7A 1P7ZA 2WQZA 4GKBA 1G2HA 1T2EA 1SKQA 4M8KA 1EDEA 1GN8A 1YRWA 4Z4CA 4PFKA 1ZI9A 3HYCA 1NRIA 4BVFA 3KJGA 1BXGB 3AWIA 1FZPB 3U4QB 2IGNA 2ZJ8A 1ML4A 3S40A 5HQ3B 2XIGA 3DL7A 5B3JA 2B9EA 1HE4A 1VI5A 4CVNA 4U8HA 2GZ2A 5DEOA 4ZVSA 2YYYA 3A3PA 1YDWA 2GTHA 1IUPA 4A0YA 4PONA 3VZRA 3UIEA 4XUEA 5C52B 1Z62A 5C44J 1L4EA 4KPYA 4EFMA 2IT1A 4IPTA 2OZ6A 1GDHA 3UTDA 3E84A 3QY0A 3WLAA 2WWVD 3D6JA 1IU9A 2YQ4A 5I3CA 5G1PA 3ZDBA 2FWRA 1PGNA 1L5ZA 4N0MA 3HB4X 1OWPA 4LXHA 4BVBA 4DLKA 1KYTA 4MKZA 2BCJQ 1TT5B 3Q5FA 2COUA 3QZUA 3RH0A 3J7TA 2FMIA 1QV9A 2X3UA 4B84A 1SFUA 3UJ6A 3LXXA 1X7WB 4HVTA 4LNHA 4K9NA 2VG8A 2Z43A 3EHEA 1TBXA 4CM6A 1M34E 1FFYA 3OR1C 2CDBA 2ZI9A 5FP0A 2OSVA 1PT9A 3H2KA 2WOOA 1QG6A 3IDQA 1GL3A 3SCZA 2C2GA 2ZREA 2JKZA 3AQ4A 4BKQA 4HLYA 5E9QA 3SQXA 3MJTA 4EJMA 1P17A 4MWGA 3FNHA 2QLMA 3NUZA 1SZPA 3F3YA 4AO8A 3FHCB 2ZDQA 2EF0A 5DM60 2O3FA 1RWBA 3QKSB 4PX2A 4BNJA 4ZGGA 1GHCA 1BR1A 2QYTA 2QGUA 1YDFA 1P1KA 4JC4A 3KLBA 1QYWA 4CLRB 4HWSA 4LXXA 1ZM9A 5KWSA 5KWJA 1ZWKA 3KQLA 3PA6A 4RVGA 2CMPA 4FUTA 4KO8A 2NYRA 4L18B 4UE2A 3OOJA 1EXVA 3DMTA 4O5VA 3DOFA 4MYTA 1XXHB 1D0ZA 5ITZB 1MOQA 2ZBGA 3VEPA 4D6XA 1A5ZA 5LLQA 1YRHA 1IQRA 3ISTA 2HVQA 5H0IA 2ZDGA 2L5QA 2XOKD 1LJ9A 3ZDYB 4RJTA 3A7DA 4N39A 4OP3A 4CU5A 1QTIA 3AW9A 1BS1A 4OHWA 4QDTA 3RPQA 4QYTA 3V34A 3I8XA 2WQ7A 4IQ4A 3PNYA 4JJEA 4XYEA 4MPTA 2HA7A 3LFHA 3FXOA 3G0CA 4OU5A 3L93A 4WESA 4EMSA 4DADA 2DOFA 2ZWVA 2Z5VA 3CRNA 4KRYA 2EGUA 1TJYA 1R5GA 2FK8A 3LT4A 5DLDA 3WIVA 3GLIE 4DR1B 4CLEA 4OGKA 1L9KA 4DY4A 5EQJB