2GXFA

X-ray crystal structure of protein yybh from bacillus subtilis. northeast structural genomics consortium target sr506.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
128
structure length
119
Chain Sequence
MEQQLKDIISACDLAIQNEDFDTLMNYYSEDAVLVVKPGMIARGKEEIKKAFITIANYFNHHIVPTQGKMILLEAGDTVLVLSQTLLDMERRATYVFKKNAQGEWLCVIDNSYGTDLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Hypothetical Protein YybH from Bacillus subtilis, Northeast Structural Genomics Target SR506
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yybH
total genus 27
structure length 119
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13474 SnoaL_3 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gxfA00
1VZZA 5STDA 2STDA 3MG3A 2HMKB 1E3VA 3OWUA 5IG5A 1ISKA 1GY7A 5CF2A 4RZMA 3CU3A 3GZXB 2B1XB 3T8UA 3BB9A 2YFLB 8CHOA 3F8HA 2I9WA 3FSDA 3G8ZA 4HZ9B 4XB5A 3ROBA 3GZRA 3Q90A 2B24B 4XM4A 3K7CA 4GB5A 6STDA 1GY6A 2HMNB 2RFRA 1A2KA 3MSOA 3FF0A 4LEHA 3EBYA 2GXFA 5DREA 5IG3A 3OXAA 1O7MB 4HM4B 4R1KA 4XBXA 2F98A 3RGAA 4HJLB 2XSHB 3ER7A 3GZBA 5IG0A 1ZX2A 3OX9A 3DUKA 4HM8B 5BVBA 3NV0A 1Q42A 1DMQA 3M8CA 1ULJB 2BNGA 3DM8A 3DMCA 3B4PA 3NBRA 3EQQB 4HM7B 2BMRB 4XBYA 5AIFA 3T8NA 1NWWA 2F99A 1O7WB 1NDOB 2INXA 2CKFB 2Z7AA 3DZLA 3FKAA 4IIAA 4OUQA 1W6YA 5AIHA 2BMOB 2OWPA 1OF5B 3KE7A 3MG1A 4X2HA 4X2OA 5CF1A 4H3UA 1C7HA 1UUWB 3EN8A 3CPOA 3OWSA 1CQSA 1JB2A 1AR0A 4R9KA 4L7KA 2UX0A 3MYTA 2GEXA 3CNMA 4Q53A 2QIYA 3B4OA 3VGNA 5JPPA 5CK6A 1O7GB 4MJDA 3EF8A 4HZBB 3F8XA 3JUMA 4HM3B 4HM6B 3B7CA 3E99A 2Z77A 1TUHA 3ECFA 3G0KA 5AEUB 1QMAA 2W2CA 4HM0B 3JUNA 5IF6A 1OHOA 5KP4A 3DXOA 1E3RA 2RCDA 2HMMB 2F86B 2XSOB 4LMIA 1OPYA 3BLZA 3NUVA 1BUQA 1Q40B 1JKGB 1W02A 5CLKA 3NXJA 5HGRA 1O7PB 4PEJA 2QGUA 3STDA 1IDPA 1EA2A 3EBTA 5D83A 3MKIA 4OVMA 1K41A 1OGXA 3EX9A 3KKGA 1JB5A 5KP3A 7STDA 1W00A 4K1VA 4WWUC 5AEWB 3IPTA 5IENA 3B8LA 2GBXB 1SJWA 1ZO2A 1JB4A 4J9AA 5D81A 3I0YA 1EG9B 4I4KA 3EN1B 1UUVB 1Q40A 3D9RA 3CNXA 3GWRA 1OCVA 5BXQA 3HX8A 3MHEA 4HVNA 4J8TA 5AI1A 4XDVA 3SOAA 1OUNA 3WMDA 2PZVA 5TGNA 1S5AA 1TP6A 3A76A 3EC9A 3F14A 3NV0B 1OH0A 3G16A 1ULIB 4L8PA 1OF5A 1HKXA 5JPUA 4FCJA 1U5OA 2RGQA 2XR8B 4N3VA 5AIIA 1GYBA 2HMLB 5G2GA 1DMMA 3JUQA 5IERA 3S5CA 5KP1A 2YFIB 5EVHA 3UJMA 4WP5A 3FZWA 3LZAA 1W01A 5DRVA 2XRXB 4WYKB 5IG4A 1OHSA 3LYGA 2Z76A 5AIGA 3UNLA 1Z1SA 3FF2A 4XBTA 3OWYA 1OHPA 5CXOA 3NM2A 5IEPA 1GS3A 3GZYB 3FLJA 3F7SA 3H51A 3MG2A 4HM2B 4HM5B 1JN5B 3KZTA 2CHCA 1ASKA 1WQLB 4FCMA 4R9LA 5FW5A 2HMJB 3KSPA 4STDA 3H3HA 5D82A 5IEOA 2IMJA 3VSYA 4L8OA 3K0ZA 2BMQB 3HZPA 4WYKA 2YFJB 1O7HB 4HM1B 4HKVB 2HMOB 2K54A 3EJVA 1STDA 3GRDA 4ORLA 3SEDA 2A15A 1O7NB 3F9SA 4U13A 1QJGA 3SOYA 2JQ5A 3OV4A 4LGQA 1E97A 1OGZA 3FGYA 1JKGA 3HK4A 3NHXA 1JN5A 4K1UA 3FH1A 2GEYA 3JUPA 4KVHA 3F40A 3EHCA 4CDLA 2R4IA 3F7XA 3JUOA 4XDWA 2GBWB 1NU3A 1DMNA 3RGRA 1GY5A
chains in the Genus database with same CATH superfamily
1MOLA 1GD4A 5STDA 1I3IA 4LSOA 3OWUA 4N6UA 3SLUA 3G713 1WMOA 1RGFA 3GZXB 1UW1A 2I9WA 3G8ZA 4R4KA 1RGLA 2ZDJA 2OOVA 3GZRA 1FW7A 1FGQA 1D6UA 1FGMA 3JVCA 3FF0A 4CPKA 2GXFA 5DREA 4R1KA 2KXGA 1TRQA 1B21A 3RGAA 1RGHA 3DUKA 1YVBI 1DMQA 2AADA 1MWUA 1QVG2 3DM8A 3NBRA 4TX4A 3LTCA 1T5YA 2E2UA 2W6JH 4EV5A 2Z7AA 1I2EA 2SBLA 4IIAA 4OUQA 2C10A 3MPHA 4FMCA 5M19A 1RDSA 2CWVA 3KE7A 3CC43 1NO3A 1GOUA 2WGOA 2K3DA 3UL5A 1UUWB 2CFLA 3EN8A 3N9HA 2IYJA 2UX0A 3MYTA 4Q53A 3Q3FA 1EQKA 4RNZA 1N9EA 1O7GB 3SX1A 3F8XA 3HIGA 4HM6B 3B7CA 1K8A4 5AEUB 1LRAA 3PZWA 1X1WA 2XGNA 2W2CA 3DXOA 1E3RA 1YVSA 2F86B 1PY3A 2XSOB 1YJW3 2OTL3 4LZIA 1FGTA 2R41A 1BVIA 1KQS2 3EBTA 4IT7A 3PS8A 5ELJA 1VQ73 4FCZA 4BTWA 1VQK3 2XGLA 3I0YA 1VQN3 3EN1B 1B27A 1RLSA 1BRSA 1Q40A 4FMAA 1VQO3 2F5MA 1ZS7A 1OCVA 2OCTA 4NPBA 3HX8A 3RDEA 3HIIA 3MHEA 2J8XB 5AI1A 4XDVA 1B2ZA 4J5GA 1TP6A 1YI23 1I0XA 4RNTA 1JBSA 2CG0A 4KFDA 5AIIA 2HMLB 5G2GA 3CME3 1MGWA 1MWSA 3PGBA 3DGOA 3RNTA 8RNTA 2YFIB 3PXMA 2BO9B 2CX0A 1N5HA 1YGEA 3EE1A 3N54B 2XRXB 5DRVA 1RCLA 1UUGB 4BU4A 2Z76A 1IVXA 4HAAA 3X3YA 1Z1SA 1BSCA 4K61A 1L5GB 3FF2A 4JF8A 3KFQC 4QWTA 2RBIA 2XF3A 1A90A 1LOYA 3PCRA 5IEPA 2BIRA 1GS3A 1VQ43 3AGNA 3F7SA 3N8BA 3Q2PA 4HM5B 3V99A 3CCV3 2CHCA 1ASKA 1WQLB 1UCIA 2CWTA 2ZL8A 5D82A 2KF6A 2GSPA 4O3VA 4WYKA 2YFJB 1O7HB 4HM1B 4ORLA 1NB5I 3WA2X 4U13A 1JKGA 3HK4A 1LNHA 3FH1A 3CCQ3 1UGHI 1BRIA 3AMOA 3CCM3 4NREA 4RNYA 2KRTA 4EBGA 2MC8A 1YNVX 4XDWA 1JBTA 1TIJA 2GBWB 2QA43 2K54A 5IW9A 2LQVA 2STDA 3MG3A 2HMKB 1ROVA 3LTDA 6RNTA 1VQ83 1ISKA 1BANA 1GY7A 4RZMA 5CF2A 3CU3A 3T8UA 1BSBA 3F8HA 5BXQA 1VQM3 1YJ93 1LNIA 4BTXA 2B24B 4GB5A 4MMZB 1GY6A 1Q9EA 2CFWA 2P0MA 3MSOA 1VQL3 3EBYA 2E2VA 3OXAA 4XBXA 3LH4A 4WHAA 3X42A 4HJLB 2GU3A 3TDGA 3LOYA 1BGSA 4HM8B 1EUIC 1I2GA 4OK0A 1Q42A 1FGOA 4KFFA 5AYSC 1ULJB 1BNIA 3GSPA 3WR2A 1C54A 1V74A 4AKYA 1HZ1A 2F99A 2INXA 3DZLA 2FXTA 3WA3A 1B2UA 7GSPA 1IYYA 5CF1A 2Y74A 1YIJ3 1KSIA 1C7HA 7RNTA 3OWSA 1X1XA 2RNTA 1ROAA 1UCJA 4BL2A 3K63A 1K28A 2CG1A 1SQWA 2QIYA 3B4OA 5CK6A 4MJDA 1S723 3EF8A 1BNRA 3NQZA 1FA3A 1BRJA 1GSPA 3E99A 2Z77A 1TUHA 3G0KA 4AKZA 1BSEA 1BNGA 3JUNA 1OHOA 2CIUA 3D5IA 1Y4KA 4O2HA 4LMIA 1MWRA 2BHMA 1WMNA 3BLZA 3NUVA 3CCR3 5CLKA 1FUWA 1X1UA 2CC3A 2QGUA 3AHWA 3STDA 2OOVC 2YX9A 5D83A 1DYUA 1RJOA 4O8SA 3AHSA 3Q1CA 4OVMA 1M904 1QVF2 3KKGA 1N5PA 5KP3A 1A2VA 4WWUC 4BIRA 5AEWB 4H61A 1SJWA 1GMPA 4J9AA 3LTBA 4ILFA 1EG9B 2O3OA 3DGNA 4N6MA 2Z6BA 3LT9A 2KCDA 2MF7A 3D9RA 3QK9A 4EC6A 2W9PA 3CNXA 1NB3I 2W0QA 3SXXA 2O9UX 2W9QA 1JBRA 3K9MC 4J8TA 1B20A 3SOAA 1AQZA 4MEIA 1W2ZA 3S28A 3EC9A 3A76A 4HYZA 2UGIA 3F14A 1W2B2 1ULIB 1OF5A 3CMA3 4N6V0 2IA7A 3J7Yd 3PCSA 1QALA 5KP1A 4BL3A 9RNTA 3NQYA 2F56A 5EVHA 6GSPA 1WNHA 1A67A 1OHSA 1N8R4 1G96A 4EV2A 4XBTA 3OWYA 1RGAA 1BRHA 3DY5A 3O8YA 1DVDA 3NM7A 2W03A 1CYVA 2C4BA 3FLJA 1NNVA 3MG2A 4KZ1A 4FCMA 2CWUA 5FW5A 3H3HA 2IMJA 1I0VA 3T0UA 1STFI 3K0ZA 2BMQB 1GOYA 1B2XA 2D42A 3I553 1STDA 1RSNA 1IQYA 3V98A 2A15A 4EXRA 4FMDA 1QJGA 3S67A 2WGQA 3G6E3 4N6LA 1YJN3 1RRLA 1LVNA 1OGZA 4MMYB 1J2BA 4K1UA 3X3ZA 2GEYA 1RTUA 3JUPA 5G1LA 1US1A 1I2FA 3WDGB 1T2HA 3F7XA 1BU4A 1ZGXA 1W6CA 1I3FA 1GY5A 3URPA 1B3SA 2FGTA 1E3VA 4I5QA 1G0TA 1PU4A 3BNCA 3L0RA 1AVKA 1V58A 2B1XB 2CFGA 3ALAA 8CHOA 3CCS3 3FSDA 4XB5A 3PYJA 3Q90A 3ZFZA 2WO0A 1CH0A 5BIRA 6STDA 3SEDA 4LEHA 4N6NB 3CPW2 1GMRA 5JBSA 1R4YA 4HM4B 1UCKA 2F98A 3QRDA 2CFDA 4DKIA 3GZBA 5IG0A 1ZX2A 3OX9A 2CW9A 5BVBA 3DGYA 3NV0A 3U1WA 1B2MA 1W4NA 3U97A 1Q864 2BNGA 4R80A 3B4PA 4J5KA 1TU5A 1VQQA 5AIFA 1NWWA 1BRNL 1O7WB 2XFSA 2L1SA 2CKFB 5AIHA 1W6YA 2IY2A 1BNFA 3BNBA 5LC7A 3ZG0A 1BUJA 1RRHA 3MG1A 4X2HA 5ELUA 3D4AA 2P05A 4H3UA 5LC6A 1D6ZA 1I8VA 2KF3A 5M1AA 3WODG 3NBJA 4GSPA 3X3XA 1CQSA 1IV9A 1K734 1GOVA 3VGNA 4WFOA 1BSAA 1RN7A 4HZBB 4HM3B 4NHFA 3ECFA 4RBNA 1QMAA 3DGLA 2KAAA 3OW22 3DGMA 1IU7A 1I70A 4GL6A 1OPYA 1HYFA 2Y73A 1N9JA 3FG1A 1BUQA 3NXJA 1O7PB 1IT8A 1EA2A 1FUTA 1RMSA 1FGRA 1RN1A 3D5GA 4JRFA 1K41A 1OGXA 3EX9A 4MMXB 1CYUA 1WTHA 1W00A 1G02A 3IPTA 5IENA 1JB4A 1RGCA 5D81A 1RCKA 2OTJ3 1IQXA 1UUVB 3SYUA 1A2PA 2KF4A 2W56B 4HVNA 1YIT3 1BRGA 1YGWA 3HI7A 1OUNA 1Q7HA 1W6GA 2BU4A 1IVUA 3DH2A 1OH0A 3BNDA 3KIIA 3S29A 5JPUA 2XR8B 5IERA 1AY7A 1DMMA 1R4CA 2RSXA 2JDIH 3JUQA 2OQEA 5GSPA 4FR9A 3S5CA 1IVWA 1SIHA 3WOEB 2QEX3 1KC84 2M7OA 4WP5A 3FZWA 3WHOA 1W01A 4EW5A 1X1YA 2AAEA 5AIGA 1T3BA 3LT8A 1BIRA 3AGOA 5EQLA 3LMLA 1OHPA 5CXOA 1RGEA 3S27A 3V92A 3MWZA 2ZA4A 1BNJA 4KT3B 1Q814 1SPUA 1JN5B 1IK3A 2HMJB 5IEOA 1T2IA 4L8OA 2ZHXB 4FMBA 3ZG5A 3BIRA 1FZUA 1D6YA 2HMOB 1KWIA 3GRDA 1AVLA 3WOFB 1EEJA 3FG3A 3CC23 1NJI4 1LOXA 3HOHA 5I97A 3SOYA 2JQ5A 3X41A 4LGQA 1E97A 3FGYA 3I563 1VQ63 3KCHA 4GHOA 3X40A 2GU1A 3NX0A 1TJDA 4LYLB 3EHCA 4CDLA 2W56A 2R4IA 1V57A 3JUOA 3VF1A 1W7CA 4IPBA 1DMNA 4ZM8A 1VQ93 4CCVA 1VZZA 3BNEA 2P38A 1BOXA 1FYSA 5IG5A 5FGOA 3KSED 1K9M4 1IV7A 3SVAA 2H0HA 3IJEB 3BB9A 2YFLB 4HZ9B 3ROBA 4XM4A 1JZOA 1HU9A 2SARA 3K7CA 1UI8A 2HMNB 2RFRA 1A2KA 3K5TA 5IG3A 1O7MB 3LTAA 4HBRA 5AYRB 1UI7A 2XSHB 3ER7A 2CH9A 3D3LA 1YHQ3 1M1XB 3M8CA 3IMAB 2LYXA 1LQGC 3DMCA 4XBYA 1Q824 3EQQB 1RNTA 2BMRB 3A5EA 4HOHA 3T8NA 2BT3A 3FCSB 1NDOB 1F8NA 3FKAA 1UGIA 3CCU3 2W04A 2KF5A 1CEWI 1Q7Y4 2BMOB 2OWPA 1OF5B 4X2OA 2CX1A 3LXUX 5HOHA 3NBBA 1M9GA 3CPOA 1IT7A 4K90B 1QAKA 1AR0A 1JB2A 2C11A 2L4VA 4R9KA 4L7KA 2GEXA 3CNMA 4N6OB 4CJNA 5JPPA 1TRPA 1BSDA 3JUMA 3GAXA 4BTYA 3CXC2 1M1K4 2HOHA 1RNBA 5IF6A 3UB1A 3FG4A 5KP4A 1N8QA 1FUSA 2IUJA 2CK3H 2HMMB 2RCDA 3BU4A 2ML6A 1Q40B 1JKGB 1W02A 5HGRA 5A0OB 3CD63 1GMQA 4PEJA 4N6TA 1IDPA 1PYLA 3AMOB 3CC73 2XFTA 1IQ8A 2F5WA 3MKIA 2H0GA 3G4S3 5BU4A 4G1MB 1JB5A 1JNQA 1TFOA 7STDA 1VQ53 4K1VA 1BNEA 2H0IA 1RGKA 3B8LA 1BAOA 1ZO2A 2GBXB 3CCE3 3CCJ3 4I4KA 1MWTA 2P09A 3GWRA 2E2TA 1RN4A 2P0XA 1LOVA 2WOFA 1TTOA 2CFKA 2PZVA 1UDII 5TGNA 1S5AA 1EKMA 1TFKA 5M18A 3NV0B 3G16A 4L8PA 1HKXA 1BNSA 1JV2B 4FCJA 1U5OA 2RGQA 1LOWA 2ML5A 4N3VA 4O02B 1GYBA 1DETA 2IUKA 5RNTA 3EB8A 2OQEC 2F4YA 2XEPA 3UJMA 1LQMB 3LZAA 5IG4A 4WYKB 1JZDA 3LYGA 4KFEA 1RHLA 1RGGA 1U8CB 1DVCA 3UNLA 1QAFA 2PNCA 3UL6A 2V1LA 1SARA 2XH9A 3NM2A 2FNQA 3GZYB 1IVVA 3D79A 3H51A 4HM0B 4HM2B 4EYCA 3KZTA 5EEOA 4R9LA 3KSPA 4STDA 2Q07A 1JJ22 3VSYA 1PFPA 1OACA 3HZPA 3KN4A 2WOHA 1W5ZA 2UUGC 1LXEA 4HKVB 3WMDA 3EJVA 1DE3A 3F9SA 1O7NB 4AEQA 1VQP3 1RKYA 3OV4A 1MNLA 2D1WA 3NHXA 1JN5A 5G1KA 1B2SA 3CCL3 1MGRA 1KD14 1AV4A 1BRKA 1JRQA 1SIIA 3F40A 4KVHA 1WMPA 1GD3A 1UCLA 2K0MA 1NU3A 4HM7B 3RGRA
chains in the Genus database with same CATH topology
1MOLA 1GD4A 5STDA 4LSOA 3OWUA 4N6UA 3SLUA 3G713 1WMOA 3GZXB 1UW1A 2I9WA 3G8ZA 4R4KA 2ZDJA 2OOVA 3GZRA 1FGQA 1D6UA 1FGMA 3JVCA 3FF0A 2GXFA 5DREA 4R1KA 2KXGA 3RGAA 3DUKA 1YVBI 1DMQA 1QVG2 3DM8A 3NBRA 4TX4A 3LTCA 1T5YA 2E2UA 2W6JH 4EV5A 2Z7AA 2SBLA 4IIAA 4OUQA 2C10A 3MPHA 4FMCA 2CWVA 3KE7A 3CC43 1NO3A 2WGOA 3UL5A 1UUWB 2CFLA 3EN8A 3N9HA 2UX0A 3MYTA 4Q53A 1EQKA 4RNZA 1N9EA 1O7GB 3SX1A 3F8XA 3HIGA 4HM6B 3B7CA 1K8A4 5AEUB 3PZWA 2XGNA 2W2CA 3DXOA 1E3RA 2F86B 2XSOB 1YJW3 2OTL3 4LZIA 1FGTA 1KQS2 3EBTA 4IT7A 3PS8A 5ELJA 1VQ73 4FCZA 4BTWA 1VQK3 2XGLA 3I0YA 1VQN3 3EN1B 1Q40A 1NU3A 4FMAA 1VQO3 1OCVA 2OCTA 3RDEA 3HX8A 3HIIA 3MHEA 5AI1A 4XDVA 1TP6A 1YI23 2CG0A 4KFDA 5AIIA 2HMLB 5G2GA 3CME3 3PGBA 3DGOA 2YFIB 3PXMA 2BO9B 1N5HA 1YGEA 3EE1A 3N54B 2XRXB 5DRVA 2Z76A 1IVXA 3X3YA 1Z1SA 4K61A 1L5GB 3FF2A 4JF8A 3KFQC 4QWTA 2XF3A 1A90A 3PCRA 5IEPA 1GS3A 1VQ43 3Q2PA 3F7SA 3N8BA 4HM5B 3V99A 3CCV3 2CHCA 1ASKA 1WQLB 2CWTA 2ZL8A 5D82A 4O3VA 4WYKA 2YFJB 1O7HB 4HM1B 4ORLA 1NB5I 3WA2X 4U13A 1JKGA 3HK4A 1LNHA 3FH1A 3CCQ3 3AMOA 3CCM3 4NREA 4RNYA 2KRTA 4EBGA 2MC8A 4XDWA 1TIJA 2GBWB 2QA43 2K54A 5IW9A 2LQVA 2STDA 3MG3A 2HMKB 1ROVA 3LTDA 1VQ83 1ISKA 1GY7A 5CF2A 4RZMA 3CU3A 3T8UA 3F8HA 5BXQA 1VQM3 1YJ93 4BTXA 2B24B 4GB5A 4MMZB 1GY6A 2CFWA 2P0MA 3MSOA 1VQL3 3EBYA 2E2VA 3OXAA 4XBXA 3LH4A 4WHAA 3X42A 4HJLB 2GU3A 3TDGA 3LOYA 4HM8B 4OK0A 1Q42A 1FGOA 4KFFA 5AYSC 1ULJB 1V74A 4AKYA 2F99A 3DZLA 2INXA 2FXTA 3WA3A 5CF1A 2Y74A 1YIJ3 1KSIA 1C7HA 3OWSA 1ROAA 3K63A 1K28A 2CG1A 1SQWA 2QIYA 3B4OA 5CK6A 4MJDA 1S723 3EF8A 3NQZA 1FA3A 3E99A 2Z77A 1TUHA 3G0KA 4AKZA 3JUNA 1OHOA 2CIUA 1Y4KA 4O2HA 4LMIA 2BHMA 1WMNA 3BLZA 3NUVA 3CCR3 5CLKA 1FUWA 2QGUA 2CC3A 3STDA 2OOVC 2YX9A 5D83A 1DYUA 1RJOA 4O8SA 1M904 3Q1CA 4OVMA 1QVF2 3KKGA 1N5PA 5KP3A 1A2VA 4WWUC 5AEWB 4H61A 1SJWA 4J9AA 3LTBA 1EG9B 2O3OA 3DGNA 4N6MA 2Z6BA 3LT9A 2KCDA 2MF7A 3D9RA 3QK9A 4EC6A 2W9PA 3CNXA 1NB3I 2W0QA 3SXXA 2O9UX 2W9QA 3K9MC 4J8TA 3SOAA 4MEIA 1W2ZA 3S28A 3EC9A 3A76A 4HYZA 3F14A 1W2B2 1ULIB 1OF5A 4N6V0 2IA7A 3J7Yd 3PCSA 1QALA 5KP1A 3NQYA 5EVHA 1WNHA 1A67A 1OHSA 1N8R4 1G96A 4EV2A 4XBTA 3OWYA 3DY5A 3O8YA 1DVDA 3NM7A 2W03A 1CYVA 4KZ1A 3FLJA 3MG2A 4FCMA 2CWUA 5FW5A 3H3HA 2IMJA 3T0UA 1STFI 3K0ZA 2BMQB 2D42A 3I553 1STDA 3V98A 1IQYA 2A15A 4EXRA 4FMDA 1QJGA 3S67A 2WGQA 3G6E3 4N6LA 1YJN3 1RRLA 1LVNA 1OGZA 4MMYB 1J2BA 4K1UA 3X3ZA 2GEYA 3JUPA 1US1A 3WDGB 3F7XA 1W6CA 1GY5A 2FGTA 1E3VA 1PU4A 3BNCA 3L0RA 1AVKA 2CFGA 2B1XB 3ALAA 8CHOA 3CCS3 3FSDA 4XB5A 3PYJA 3Q90A 2WO0A 6STDA 3SEDA 4LEHA 4N6NB 3CPW2 5JBSA 4HM4B 2F98A 3QRDA 2CFDA 3GZBA 5IG0A 1ZX2A 3OX9A 2CW9A 5BVBA 3U1WA 3NV0A 1W4NA 3U97A 1Q864 2BNGA 4R80A 3B4PA 1TU5A 5AIFA 1NWWA 1O7WB 2XFSA 5AIHA 2CKFB 1W6YA 3BNBA 5LC7A 1RRHA 3MG1A 4X2HA 5ELUA 2P05A 4H3UA 5LC6A 1D6ZA 3WODG 3NBJA 3X3XA 1K734 1CQSA 1IV9A 3VGNA 4WFOA 1RN7A 4HZBB 4HM3B 4NHFA 3ECFA 4RBNA 1QMAA 3DGLA 3OW22 3DGMA 1IU7A 4GL6A 1OPYA 1BUQA 2Y73A 1N9JA 3FG1A 3NXJA 1O7PB 1IT8A 1EA2A 1FGRA 4JRFA 1K41A 1OGXA 3EX9A 4MMXB 1CYUA 1WTHA 1W00A 3IPTA 5IENA 1JB4A 5D81A 2OTJ3 1IQXA 1UUVB 2W56B 4HVNA 1YIT3 3HI7A 1OUNA 1W6GA 1IVUA 1OH0A 3BNDA 3KIIA 3S29A 5JPUA 2XR8B 5IERA 1DMMA 1R4CA 2RSXA 2JDIH 3JUQA 2OQEA 3S5CA 4FR9A 3WOEB 1IVWA 1SIHA 2QEX3 1KC84 2M7OA 4WP5A 3FZWA 1W01A 5AIGA 3LT8A 5EQLA 3LMLA 1OHPA 5CXOA 3S27A 3V92A 3MWZA 1Q814 1SPUA 1JN5B 1IK3A 2HMJB 5IEOA 4L8OA 4FMBA 1D6YA 2HMOB 1KWIA 3GRDA 1AVLA 3WOFB 3FG3A 3CC23 1NJI4 1LOXA 5I97A 3SOYA 2JQ5A 3X41A 4LGQA 1E97A 3FGYA 3I563 1VQ63 3X40A 2GU1A 3NX0A 4CDLA 3EHCA 2W56A 2R4IA 3JUOA 3VF1A 1W7CA 4IPBA 1DMNA 4ZM8A 1VQ93 4CCVA 1VZZA 3BNEA 2P38A 5IG5A 5FGOA 3KSED 1K9M4 1IV7A 3SVAA 3IJEB 3BB9A 4HZ9B 3ROBA 4XM4A 3K5TA 1HU9A 3K7CA 1UI8A 2HMNB 2RFRA 1A2KA 5IG3A 1O7MB 3LTAA 4HBRA 5AYRB 1UI7A 2XSHB 3ER7A 2CH9A 3D3LA 1YHQ3 1M1XB 3M8CA 3IMAB 2LYXA 3DMCA 4XBYA 1Q824 3EQQB 2BMRB 3T8NA 2BT3A 3FCSB 1NDOB 1F8NA 3FKAA 3CCU3 2W04A 1CEWI 1Q7Y4 2BMOB 2OWPA 1OF5B 4X2OA 3LXUX 3NBBA 1M9GA 3CPOA 1IT7A 4K90B 1QAKA 1AR0A 1JB2A 2C11A 2L4VA 4R9KA 4L7KA 2GEXA 3CNMA 4N6OB 5JPPA 3JUMA 3GAXA 4BTYA 3CXC2 1M1K4 5IF6A 3UB1A 3FG4A 5KP4A 1N8QA 2IUJA 2RCDA 2CK3H 2HMMB 2ML6A 1Q40B 1JKGB 1W02A 5HGRA 5A0OB 3CD63 4PEJA 4N6TA 1IDPA 3CC73 3AMOB 2XFTA 1IQ8A 3MKIA 3G4S3 7STDA 4G1MB 1JB5A 1JNQA 1TFOA 1VQ53 4K1VA 3B8LA 2GBXB 1ZO2A 3CCE3 3CCJ3 4I4KA 2P09A 3GWRA 2E2TA 2P0XA 2WOFA 2CFKA 2PZVA 5TGNA 1S5AA 1EKMA 1TFKA 3NV0B 3G16A 4L8PA 1HKXA 3CMA3 1JV2B 4FCJA 1U5OA 2RGQA 2ML5A 4O02B 4N3VA 1GYBA 2IUKA 3EB8A 2OQEC 2XEPA 3UJMA 5IG4A 3LZAA 4WYKB 4KFEA 3LYGA 1U8CB 3UNLA 1DVCA 1QAFA 2PNCA 3UL6A 2V1LA 2XH9A 3NM2A 2FNQA 3GZYB 1IVVA 3H51A 4HM0B 4HM2B 4EYCA 3KZTA 5EEOA 4R9LA 3KSPA 4STDA 2Q07A 1JJ22 3VSYA 1PFPA 1OACA 3HZPA 3KN4A 2WOHA 1W5ZA 1LXEA 4HKVB 3WMDA 3EJVA 3F9SA 1O7NB 4AEQA 1VQP3 1RKYA 3OV4A 1MNLA 2D1WA 3NHXA 1JN5A 3CCL3 1KD14 1AV4A 3F40A 1JRQA 1SIIA 4KVHA 1WMPA 1GD3A 2K0MA 2YFLB 4HM7B 3RGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZZ A;  5STD A;  2STD A;  3MG3 A;  2HMK B;  1E3V A;  3OWU A;  5IG5 A;  1ISK A;  1GY7 A;  5CF2 A;  4RZM A;  3CU3 A;  3GZX B;  2B1X B;  3T8U A;  3BB9 A;  2YFL B;  8CHO A;  3F8H A;  2I9W A;  3FSD A;  3G8Z A;  4HZ9 B;  4XB5 A;  3ROB A;  3GZR A;  3Q90 A;  2B24 B;  4XM4 A;  3K7C A;  4GB5 A;  6STD A;  1GY6 A;  2HMN B;  2RFR A;  1A2K A;  3MSO A;  3FF0 A;  4LEH A;  3EBY A;  2GXF A;  5DRE A;  5IG3 A;  3OXA A;  1O7M B;  4HM4 B;  4R1K A;  4XBX A;  2F98 A;  3RGA A;  4HJL B;  2XSH B;  3ER7 A;  3GZB A;  5IG0 A;  1ZX2 A;  3OX9 A;  3DUK A;  4HM8 B;  5BVB A;  3NV0 A;  1Q42 A;  1DMQ A;  3M8C A;  1ULJ B;  2BNG A;  3DM8 A;  3DMC A;  3B4P A;  3NBR A;  3EQQ B;  4HM7 B;  2BMR B;  4XBY A;  5AIF A;  3T8N A;  1NWW A;  2F99 A;  1O7W B;  1NDO B;  2INX A;  2CKF B;  2Z7A A;  3DZL A;  3FKA A;  4IIA A;  4OUQ A;  1W6Y A;  5AIH A;  2BMO B;  2OWP A;  1OF5 B;  3KE7 A;  3MG1 A;  4X2H A;  4X2O A;  5CF1 A;  4H3U A;  1C7H A;  1UUW B;  3EN8 A;  3CPO A;  3OWS A;  1CQS A;  1JB2 A;  1AR0 A;  4R9K A;  4L7K A;  2UX0 A;  3MYT A;  2GEX A;  3CNM A;  4Q53 A;  2QIY A;  3B4O A;  3VGN A;  5JPP A;  5CK6 A;  1O7G B;  4MJD A;  3EF8 A;  4HZB B;  3F8X A;  3JUM A;  4HM3 B;  4HM6 B;  3B7C A;  3E99 A;  2Z77 A;  1TUH A;  3ECF A;  3G0K A;  5AEU B;  1QMA A;  2W2C A;  4HM0 B;  3JUN A;  5IF6 A;  1OHO A;  5KP4 A;  3DXO A;  1E3R A;  2RCD A;  2HMM B;  2F86 B;  2XSO B;  4LMI A;  1OPY A;  3BLZ A;  3NUV A;  1BUQ A;  1Q40 B;  1JKG B;  1W02 A;  5CLK A;  3NXJ A;  5HGR A;  1O7P B;  4PEJ A;  2QGU A;  3STD A;  1IDP A;  1EA2 A;  3EBT A;  5D83 A;  3MKI A;  4OVM A;  1K41 A;  1OGX A;  3EX9 A;  3KKG A;  1JB5 A;  5KP3 A;  7STD A;  1W00 A;  4K1V A;  4WWU C;  5AEW B;  3IPT A;  5IEN A;  3B8L A;  2GBX B;  1SJW A;  1ZO2 A;  1JB4 A;  4J9A A;  5D81 A;  3I0Y A;  1EG9 B;  4I4K A;  3EN1 B;  1UUV B;  1Q40 A;  3D9R A;  3CNX A;  3GWR A;  1OCV A;  5BXQ A;  3HX8 A;  3MHE A;  4HVN A;  4J8T A;  5AI1 A;  4XDV A;  3SOA A;  1OUN A;  3WMD A;  2PZV A;  5TGN A;  1S5A A;  1TP6 A;  3A76 A;  3EC9 A;  3F14 A;  3NV0 B;  1OH0 A;  3G16 A;  1ULI B;  4L8P A;  1OF5 A;  1HKX A;  5JPU A;  4FCJ A;  1U5O A;  2RGQ A;  2XR8 B;  4N3V A;  5AII A;  1GYB A;  2HML B;  5G2G A;  1DMM A;  3JUQ A;  5IER A;  3S5C A;  5KP1 A;  2YFI B;  5EVH A;  3UJM A;  4WP5 A;  3FZW A;  3LZA A;  1W01 A;  5DRV A;  2XRX B;  4WYK B;  5IG4 A;  1OHS A;  3LYG A;  2Z76 A;  5AIG A;  3UNL A;  1Z1S A;  3FF2 A;  4XBT A;  3OWY A;  1OHP A;  5CXO A;  3NM2 A;  5IEP A;  1GS3 A;  3GZY B;  3FLJ A;  3F7S A;  3H51 A;  3MG2 A;  4HM2 B;  4HM5 B;  1JN5 B;  3KZT A;  2CHC A;  1ASK A;  1WQL B;  4FCM A;  4R9L A;  5FW5 A;  2HMJ B;  3KSP A;  4STD A;  3H3H A;  5D82 A;  5IEO A;  2IMJ A;  3VSY A;  4L8O A;  3K0Z A;  2BMQ B;  3HZP A;  4WYK A;  2YFJ B;  1O7H B;  4HM1 B;  4HKV B;  2HMO B;  2K54 A;  3EJV A;  1STD A;  3GRD A;  4ORL A;  3SED A;  2A15 A;  1O7N B;  3F9S A;  4U13 A;  1QJG A;  3SOY A;  2JQ5 A;  3OV4 A;  4LGQ A;  1E97 A;  1OGZ A;  3FGY A;  1JKG A;  3HK4 A;  3NHX A;  1JN5 A;  4K1U A;  3FH1 A;  2GEY A;  3JUP A;  4KVH A;  3F40 A;  3EHC A;  4CDL A;  2R4I A;  3F7X A;  3JUO A;  4XDW A;  2GBW B;  1NU3 A;  1DMN A;  3RGR A;  1GY5 A; 
#chains in the Genus database with same CATH topology
 1MOL A;  1GD4 A;  5STD A;  1I3I A;  4LSO A;  3OWU A;  4N6U A;  3SLU A;  3G71 3;  1WMO A;  1RGF A;  3GZX B;  1UW1 A;  2I9W A;  3G8Z A;  4R4K A;  1RGL A;  2ZDJ A;  2OOV A;  3GZR A;  1FW7 A;  1FGQ A;  1D6U A;  1FGM A;  3JVC A;  3FF0 A;  4CPK A;  2GXF A;  5DRE A;  4R1K A;  2KXG A;  1TRQ A;  1B21 A;  3RGA A;  1RGH A;  3DUK A;  1YVB I;  1DMQ A;  2AAD A;  1MWU A;  1QVG 2;  3DM8 A;  3NBR A;  4TX4 A;  3LTC A;  1T5Y A;  2E2U A;  2W6J H;  4EV5 A;  2Z7A A;  1I2E A;  2SBL A;  4IIA A;  4OUQ A;  2C10 A;  3MPH A;  4FMC A;  5M19 A;  1RDS A;  2CWV A;  3KE7 A;  3CC4 3;  1NO3 A;  1GOU A;  2WGO A;  2K3D A;  3UL5 A;  1UUW B;  2CFL A;  3EN8 A;  3N9H A;  2IYJ A;  2UX0 A;  3MYT A;  4Q53 A;  3Q3F A;  1EQK A;  4RNZ A;  1N9E A;  1O7G B;  3SX1 A;  3F8X A;  3HIG A;  4HM6 B;  3B7C A;  1K8A 4;  5AEU B;  1LRA A;  3PZW A;  1X1W A;  2XGN A;  2W2C A;  3DXO A;  1E3R A;  1YVS A;  2F86 B;  1PY3 A;  2XSO B;  1YJW 3;  2OTL 3;  4LZI A;  1FGT A;  2R41 A;  1BVI A;  1KQS 2;  3EBT A;  4IT7 A;  3PS8 A;  5ELJ A;  1VQ7 3;  4FCZ A;  4BTW A;  1VQK 3;  2XGL A;  3I0Y A;  1VQN 3;  3EN1 B;  1B27 A;  1RLS A;  1BRS A;  1Q40 A;  4FMA A;  1VQO 3;  2F5M A;  1ZS7 A;  1OCV A;  2OCT A;  4NPB A;  3HX8 A;  3RDE A;  3HII A;  3MHE A;  2J8X B;  5AI1 A;  4XDV A;  1B2Z A;  4J5G A;  1TP6 A;  1YI2 3;  1I0X A;  4RNT A;  1JBS A;  2CG0 A;  4KFD A;  5AII A;  2HML B;  5G2G A;  3CME 3;  1MGW A;  1MWS A;  3PGB A;  3DGO A;  3RNT A;  8RNT A;  2YFI B;  3PXM A;  2BO9 B;  2CX0 A;  1N5H A;  1YGE A;  3EE1 A;  3N54 B;  2XRX B;  5DRV A;  1RCL A;  1UUG B;  4BU4 A;  2Z76 A;  1IVX A;  4HAA A;  3X3Y A;  1Z1S A;  1BSC A;  4K61 A;  1L5G B;  3FF2 A;  4JF8 A;  3KFQ C;  4QWT A;  2RBI A;  2XF3 A;  1A90 A;  1LOY A;  3PCR A;  5IEP A;  2BIR A;  1GS3 A;  1VQ4 3;  3AGN A;  3F7S A;  3N8B A;  3Q2P A;  4HM5 B;  3V99 A;  3CCV 3;  2CHC A;  1ASK A;  1WQL B;  1UCI A;  2CWT A;  2ZL8 A;  5D82 A;  2KF6 A;  2GSP A;  4O3V A;  4WYK A;  2YFJ B;  1O7H B;  4HM1 B;  4ORL A;  1NB5 I;  3WA2 X;  4U13 A;  1JKG A;  3HK4 A;  1LNH A;  3FH1 A;  3CCQ 3;  1UGH I;  1BRI A;  3AMO A;  3CCM 3;  4NRE A;  4RNY A;  2KRT A;  4EBG A;  2MC8 A;  1YNV X;  4XDW A;  1JBT A;  1TIJ A;  2GBW B;  2QA4 3;  2K54 A;  5IW9 A;  2LQV A;  2STD A;  3MG3 A;  2HMK B;  1ROV A;  3LTD A;  6RNT A;  1VQ8 3;  1ISK A;  1BAN A;  1GY7 A;  4RZM A;  5CF2 A;  3CU3 A;  3T8U A;  1BSB A;  3F8H A;  5BXQ A;  1VQM 3;  1YJ9 3;  1LNI A;  4BTX A;  2B24 B;  4GB5 A;  4MMZ B;  1GY6 A;  1Q9E A;  2CFW A;  2P0M A;  3MSO A;  1VQL 3;  3EBY A;  2E2V A;  3OXA A;  4XBX A;  3LH4 A;  4WHA A;  3X42 A;  4HJL B;  2GU3 A;  3TDG A;  3LOY A;  1BGS A;  4HM8 B;  1EUI C;  1I2G A;  4OK0 A;  1Q42 A;  1FGO A;  4KFF A;  5AYS C;  1ULJ B;  1BNI A;  3GSP A;  3WR2 A;  1C54 A;  1V74 A;  4AKY A;  1HZ1 A;  2F99 A;  2INX A;  3DZL A;  2FXT A;  3WA3 A;  1B2U A;  7GSP A;  1IYY A;  5CF1 A;  2Y74 A;  1YIJ 3;  1KSI A;  1C7H A;  7RNT A;  3OWS A;  1X1X A;  2RNT A;  1ROA A;  1UCJ A;  4BL2 A;  3K63 A;  1K28 A;  2CG1 A;  1SQW A;  2QIY A;  3B4O A;  5CK6 A;  4MJD A;  1S72 3;  3EF8 A;  1BNR A;  3NQZ A;  1FA3 A;  1BRJ A;  1GSP A;  3E99 A;  2Z77 A;  1TUH A;  3G0K A;  4AKZ A;  1BSE A;  1BNG A;  3JUN A;  1OHO A;  2CIU A;  3D5I A;  1Y4K A;  4O2H A;  4LMI A;  1MWR A;  2BHM A;  1WMN A;  3BLZ A;  3NUV A;  3CCR 3;  5CLK A;  1FUW A;  1X1U A;  2CC3 A;  2QGU A;  3AHW A;  3STD A;  2OOV C;  2YX9 A;  5D83 A;  1DYU A;  1RJO A;  4O8S A;  3AHS A;  3Q1C A;  4OVM A;  1M90 4;  1QVF 2;  3KKG A;  1N5P A;  5KP3 A;  1A2V A;  4WWU C;  4BIR A;  5AEW B;  4H61 A;  1SJW A;  1GMP A;  4J9A A;  3LTB A;  4ILF A;  1EG9 B;  2O3O A;  3DGN A;  4N6M A;  2Z6B A;  3LT9 A;  2KCD A;  2MF7 A;  3D9R A;  3QK9 A;  4EC6 A;  2W9P A;  3CNX A;  1NB3 I;  2W0Q A;  3SXX A;  2O9U X;  2W9Q A;  1JBR A;  3K9M C;  4J8T A;  1B20 A;  3SOA A;  1AQZ A;  4MEI A;  1W2Z A;  3S28 A;  3EC9 A;  3A76 A;  4HYZ A;  2UGI A;  3F14 A;  1W2B 2;  1ULI B;  1OF5 A;  3CMA 3;  4N6V 0;  2IA7 A;  3J7Y d;  3PCS A;  1QAL A;  5KP1 A;  4BL3 A;  9RNT A;  3NQY A;  2F56 A;  5EVH A;  6GSP A;  1WNH A;  1A67 A;  1OHS A;  1N8R 4;  1G96 A;  4EV2 A;  4XBT A;  3OWY A;  1RGA A;  1BRH A;  3DY5 A;  3O8Y A;  1DVD A;  3NM7 A;  2W03 A;  1CYV A;  2C4B A;  3FLJ A;  1NNV A;  3MG2 A;  4KZ1 A;  4FCM A;  2CWU A;  5FW5 A;  3H3H A;  2IMJ A;  1I0V A;  3T0U A;  1STF I;  3K0Z A;  2BMQ B;  1GOY A;  1B2X A;  2D42 A;  3I55 3;  1STD A;  1RSN A;  1IQY A;  3V98 A;  2A15 A;  4EXR A;  4FMD A;  1QJG A;  3S67 A;  2WGQ A;  3G6E 3;  4N6L A;  1YJN 3;  1RRL A;  1LVN A;  1OGZ A;  4MMY B;  1J2B A;  4K1U A;  3X3Z A;  2GEY A;  1RTU A;  3JUP A;  5G1L A;  1US1 A;  1I2F A;  3WDG B;  1T2H A;  3F7X A;  1BU4 A;  1ZGX A;  1W6C A;  1I3F A;  1GY5 A;  3URP A;  1B3S A;  2FGT A;  1E3V A;  4I5Q A;  1G0T A;  1PU4 A;  3BNC A;  3L0R A;  1AVK A;  1V58 A;  2B1X B;  2CFG A;  3ALA A;  8CHO A;  3CCS 3;  3FSD A;  4XB5 A;  3PYJ A;  3Q90 A;  3ZFZ A;  2WO0 A;  1CH0 A;  5BIR A;  6STD A;  3SED A;  4LEH A;  4N6N B;  3CPW 2;  1GMR A;  5JBS A;  1R4Y A;  4HM4 B;  1UCK A;  2F98 A;  3QRD A;  2CFD A;  4DKI A;  3GZB A;  5IG0 A;  1ZX2 A;  3OX9 A;  2CW9 A;  5BVB A;  3DGY A;  3NV0 A;  3U1W A;  1B2M A;  1W4N A;  3U97 A;  1Q86 4;  2BNG A;  4R80 A;  3B4P A;  4J5K A;  1TU5 A;  1VQQ A;  5AIF A;  1NWW A;  1BRN L;  1O7W B;  2XFS A;  2L1S A;  2CKF B;  5AIH A;  1W6Y A;  2IY2 A;  1BNF A;  3BNB A;  5LC7 A;  3ZG0 A;  1BUJ A;  1RRH A;  3MG1 A;  4X2H A;  5ELU A;  3D4A A;  2P05 A;  4H3U A;  5LC6 A;  1D6Z A;  1I8V A;  2KF3 A;  5M1A A;  3WOD G;  3NBJ A;  4GSP A;  3X3X A;  1CQS A;  1IV9 A;  1K73 4;  1GOV A;  3VGN A;  4WFO A;  1BSA A;  1RN7 A;  4HZB B;  4HM3 B;  4NHF A;  3ECF A;  4RBN A;  1QMA A;  3DGL A;  2KAA A;  3OW2 2;  3DGM A;  1IU7 A;  1I70 A;  4GL6 A;  1OPY A;  1HYF A;  2Y73 A;  1N9J A;  3FG1 A;  1BUQ A;  3NXJ A;  1O7P B;  1IT8 A;  1EA2 A;  1FUT A;  1RMS A;  1FGR A;  1RN1 A;  3D5G A;  4JRF A;  1K41 A;  1OGX A;  3EX9 A;  4MMX B;  1CYU A;  1WTH A;  1W00 A;  1G02 A;  3IPT A;  5IEN A;  1JB4 A;  1RGC A;  5D81 A;  1RCK A;  2OTJ 3;  1IQX A;  1UUV B;  3SYU A;  1A2P A;  2KF4 A;  2W56 B;  4HVN A;  1YIT 3;  1BRG A;  1YGW A;  3HI7 A;  1OUN A;  1Q7H A;  1W6G A;  2BU4 A;  1IVU A;  3DH2 A;  1OH0 A;  3BND A;  3KII A;  3S29 A;  5JPU A;  2XR8 B;  5IER A;  1AY7 A;  1DMM A;  1R4C A;  2RSX A;  2JDI H;  3JUQ A;  2OQE A;  5GSP A;  4FR9 A;  3S5C A;  1IVW A;  1SIH A;  3WOE B;  2QEX 3;  1KC8 4;  2M7O A;  4WP5 A;  3FZW A;  3WHO A;  1W01 A;  4EW5 A;  1X1Y A;  2AAE A;  5AIG A;  1T3B A;  3LT8 A;  1BIR A;  3AGO A;  5EQL A;  3LML A;  1OHP A;  5CXO A;  1RGE A;  3S27 A;  3V92 A;  3MWZ A;  2ZA4 A;  1BNJ A;  4KT3 B;  1Q81 4;  1SPU A;  1JN5 B;  1IK3 A;  2HMJ B;  5IEO A;  1T2I A;  4L8O A;  2ZHX B;  4FMB A;  3ZG5 A;  3BIR A;  1FZU A;  1D6Y A;  2HMO B;  1KWI A;  3GRD A;  1AVL A;  3WOF B;  1EEJ A;  3FG3 A;  3CC2 3;  1NJI 4;  1LOX A;  3HOH A;  5I97 A;  3SOY A;  2JQ5 A;  3X41 A;  4LGQ A;  1E97 A;  3FGY A;  3I56 3;  1VQ6 3;  3KCH A;  4GHO A;  3X40 A;  2GU1 A;  3NX0 A;  1TJD A;  4LYL B;  3EHC A;  4CDL A;  2W56 A;  2R4I A;  1V57 A;  3JUO A;  3VF1 A;  1W7C A;  4IPB A;  1DMN A;  4ZM8 A;  1VQ9 3;  4CCV A;  1VZZ A;  3BNE A;  2P38 A;  1BOX A;  1FYS A;  5IG5 A;  5FGO A;  3KSE D;  1K9M 4;  1IV7 A;  3SVA A;  2H0H A;  3IJE B;  3BB9 A;  2YFL B;  4HZ9 B;  3ROB A;  4XM4 A;  1JZO A;  1HU9 A;  2SAR A;  3K7C A;  1UI8 A;  2HMN B;  2RFR A;  1A2K A;  3K5T A;  5IG3 A;  1O7M B;  3LTA A;  4HBR A;  5AYR B;  1UI7 A;  2XSH B;  3ER7 A;  2CH9 A;  3D3L A;  1YHQ 3;  1M1X B;  3M8C A;  3IMA B;  2LYX A;  1LQG C;  3DMC A;  4XBY A;  1Q82 4;  3EQQ B;  1RNT A;  2BMR B;  3A5E A;  4HOH A;  3T8N A;  2BT3 A;  3FCS B;  1NDO B;  1F8N A;  3FKA A;  1UGI A;  3CCU 3;  2W04 A;  2KF5 A;  1CEW I;  1Q7Y 4;  2BMO B;  2OWP A;  1OF5 B;  4X2O A;  2CX1 A;  3LXU X;  5HOH A;  3NBB A;  1M9G A;  3CPO A;  1IT7 A;  4K90 B;  1QAK A;  1AR0 A;  1JB2 A;  2C11 A;  2L4V A;  4R9K A;  4L7K A;  2GEX A;  3CNM A;  4N6O B;  4CJN A;  5JPP A;  1TRP A;  1BSD A;  3JUM A;  3GAX A;  4BTY A;  3CXC 2;  1M1K 4;  2HOH A;  1RNB A;  5IF6 A;  3UB1 A;  3FG4 A;  5KP4 A;  1N8Q A;  1FUS A;  2IUJ A;  2CK3 H;  2HMM B;  2RCD A;  3BU4 A;  2ML6 A;  1Q40 B;  1JKG B;  1W02 A;  5HGR A;  5A0O B;  3CD6 3;  1GMQ A;  4PEJ A;  4N6T A;  1IDP A;  1PYL A;  3AMO B;  3CC7 3;  2XFT A;  1IQ8 A;  2F5W A;  3MKI A;  2H0G A;  3G4S 3;  5BU4 A;  4G1M B;  1JB5 A;  1JNQ A;  1TFO A;  7STD A;  1VQ5 3;  4K1V A;  1BNE A;  2H0I A;  1RGK A;  3B8L A;  1BAO A;  1ZO2 A;  2GBX B;  3CCE 3;  3CCJ 3;  4I4K A;  1MWT A;  2P09 A;  3GWR A;  2E2T A;  1RN4 A;  2P0X A;  1LOV A;  2WOF A;  1TTO A;  2CFK A;  2PZV A;  1UDI I;  5TGN A;  1S5A A;  1EKM A;  1TFK A;  5M18 A;  3NV0 B;  3G16 A;  4L8P A;  1HKX A;  1BNS A;  1JV2 B;  4FCJ A;  1U5O A;  2RGQ A;  1LOW A;  2ML5 A;  4N3V A;  4O02 B;  1GYB A;  1DET A;  2IUK A;  5RNT A;  3EB8 A;  2OQE C;  2F4Y A;  2XEP A;  3UJM A;  1LQM B;  3LZA A;  5IG4 A;  4WYK B;  1JZD A;  3LYG A;  4KFE A;  1RHL A;  1RGG A;  1U8C B;  1DVC A;  3UNL A;  1QAF A;  2PNC A;  3UL6 A;  2V1L A;  1SAR A;  2XH9 A;  3NM2 A;  2FNQ A;  3GZY B;  1IVV A;  3D79 A;  3H51 A;  4HM0 B;  4HM2 B;  4EYC A;  3KZT A;  5EEO A;  4R9L A;  3KSP A;  4STD A;  2Q07 A;  1JJ2 2;  3VSY A;  1PFP A;  1OAC A;  3HZP A;  3KN4 A;  2WOH A;  1W5Z A;  2UUG C;  1LXE A;  4HKV B;  3WMD A;  3EJV A;  1DE3 A;  3F9S A;  1O7N B;  4AEQ A;  1VQP 3;  1RKY A;  3OV4 A;  1MNL A;  2D1W A;  3NHX A;  1JN5 A;  5G1K A;  1B2S A;  3CCL 3;  1MGR A;  1KD1 4;  1AV4 A;  1BRK A;  1JRQ A;  1SII A;  3F40 A;  4KVH A;  1WMP A;  1GD3 A;  1UCL A;  2K0M A;  1NU3 A;  4HM7 B;  3RGR A; 
#chains in the Genus database with same CATH homology
 1MOL A;  1GD4 A;  5STD A;  4LSO A;  3OWU A;  4N6U A;  3SLU A;  3G71 3;  1WMO A;  3GZX B;  1UW1 A;  2I9W A;  3G8Z A;  4R4K A;  2ZDJ A;  2OOV A;  3GZR A;  1FGQ A;  1D6U A;  1FGM A;  3JVC A;  3FF0 A;  2GXF A;  5DRE A;  4R1K A;  2KXG A;  3RGA A;  3DUK A;  1YVB I;  1DMQ A;  1QVG 2;  3DM8 A;  3NBR A;  4TX4 A;  3LTC A;  1T5Y A;  2E2U A;  2W6J H;  4EV5 A;  2Z7A A;  2SBL A;  4IIA A;  4OUQ A;  2C10 A;  3MPH A;  4FMC A;  2CWV A;  3KE7 A;  3CC4 3;  1NO3 A;  2WGO A;  3UL5 A;  1UUW B;  2CFL A;  3EN8 A;  3N9H A;  2UX0 A;  3MYT A;  4Q53 A;  1EQK A;  4RNZ A;  1N9E A;  1O7G B;  3SX1 A;  3F8X A;  3HIG A;  4HM6 B;  3B7C A;  1K8A 4;  5AEU B;  3PZW A;  2XGN A;  2W2C A;  3DXO A;  1E3R A;  2F86 B;  2XSO B;  1YJW 3;  2OTL 3;  4LZI A;  1FGT A;  1KQS 2;  3EBT A;  4IT7 A;  3PS8 A;  5ELJ A;  1VQ7 3;  4FCZ A;  4BTW A;  1VQK 3;  2XGL A;  3I0Y A;  1VQN 3;  3EN1 B;  1Q40 A;  1NU3 A;  4FMA A;  1VQO 3;  1OCV A;  2OCT A;  3RDE A;  3HX8 A;  3HII A;  3MHE A;  5AI1 A;  4XDV A;  1TP6 A;  1YI2 3;  2CG0 A;  4KFD A;  5AII A;  2HML B;  5G2G A;  3CME 3;  3PGB A;  3DGO A;  2YFI B;  3PXM A;  2BO9 B;  1N5H A;  1YGE A;  3EE1 A;  3N54 B;  2XRX B;  5DRV A;  2Z76 A;  1IVX A;  3X3Y A;  1Z1S A;  4K61 A;  1L5G B;  3FF2 A;  4JF8 A;  3KFQ C;  4QWT A;  2XF3 A;  1A90 A;  3PCR A;  5IEP A;  1GS3 A;  1VQ4 3;  3Q2P A;  3F7S A;  3N8B A;  4HM5 B;  3V99 A;  3CCV 3;  2CHC A;  1ASK A;  1WQL B;  2CWT A;  2ZL8 A;  5D82 A;  4O3V A;  4WYK A;  2YFJ B;  1O7H B;  4HM1 B;  4ORL A;  1NB5 I;  3WA2 X;  4U13 A;  1JKG A;  3HK4 A;  1LNH A;  3FH1 A;  3CCQ 3;  3AMO A;  3CCM 3;  4NRE A;  4RNY A;  2KRT A;  4EBG A;  2MC8 A;  4XDW A;  1TIJ A;  2GBW B;  2QA4 3;  2K54 A;  5IW9 A;  2LQV A;  2STD A;  3MG3 A;  2HMK B;  1ROV A;  3LTD A;  1VQ8 3;  1ISK A;  1GY7 A;  5CF2 A;  4RZM A;  3CU3 A;  3T8U A;  3F8H A;  5BXQ A;  1VQM 3;  1YJ9 3;  4BTX A;  2B24 B;  4GB5 A;  4MMZ B;  1GY6 A;  2CFW A;  2P0M A;  3MSO A;  1VQL 3;  3EBY A;  2E2V A;  3OXA A;  4XBX A;  3LH4 A;  4WHA A;  3X42 A;  4HJL B;  2GU3 A;  3TDG A;  3LOY A;  4HM8 B;  4OK0 A;  1Q42 A;  1FGO A;  4KFF A;  5AYS C;  1ULJ B;  1V74 A;  4AKY A;  2F99 A;  3DZL A;  2INX A;  2FXT A;  3WA3 A;  5CF1 A;  2Y74 A;  1YIJ 3;  1KSI A;  1C7H A;  3OWS A;  1ROA A;  3K63 A;  1K28 A;  2CG1 A;  1SQW A;  2QIY A;  3B4O A;  5CK6 A;  4MJD A;  1S72 3;  3EF8 A;  3NQZ A;  1FA3 A;  3E99 A;  2Z77 A;  1TUH A;  3G0K A;  4AKZ A;  3JUN A;  1OHO A;  2CIU A;  1Y4K A;  4O2H A;  4LMI A;  2BHM A;  1WMN A;  3BLZ A;  3NUV A;  3CCR 3;  5CLK A;  1FUW A;  2QGU A;  2CC3 A;  3STD A;  2OOV C;  2YX9 A;  5D83 A;  1DYU A;  1RJO A;  4O8S A;  1M90 4;  3Q1C A;  4OVM A;  1QVF 2;  3KKG A;  1N5P A;  5KP3 A;  1A2V A;  4WWU C;  5AEW B;  4H61 A;  1SJW A;  4J9A A;  3LTB A;  1EG9 B;  2O3O A;  3DGN A;  4N6M A;  2Z6B A;  3LT9 A;  2KCD A;  2MF7 A;  3D9R A;  3QK9 A;  4EC6 A;  2W9P A;  3CNX A;  1NB3 I;  2W0Q A;  3SXX A;  2O9U X;  2W9Q A;  3K9M C;  4J8T A;  3SOA A;  4MEI A;  1W2Z A;  3S28 A;  3EC9 A;  3A76 A;  4HYZ A;  3F14 A;  1W2B 2;  1ULI B;  1OF5 A;  4N6V 0;  2IA7 A;  3J7Y d;  3PCS A;  1QAL A;  5KP1 A;  3NQY A;  5EVH A;  1WNH A;  1A67 A;  1OHS A;  1N8R 4;  1G96 A;  4EV2 A;  4XBT A;  3OWY A;  3DY5 A;  3O8Y A;  1DVD A;  3NM7 A;  2W03 A;  1CYV A;  4KZ1 A;  3FLJ A;  3MG2 A;  4FCM A;  2CWU A;  5FW5 A;  3H3H A;  2IMJ A;  3T0U A;  1STF I;  3K0Z A;  2BMQ B;  2D42 A;  3I55 3;  1STD A;  3V98 A;  1IQY A;  2A15 A;  4EXR A;  4FMD A;  1QJG A;  3S67 A;  2WGQ A;  3G6E 3;  4N6L A;  1YJN 3;  1RRL A;  1LVN A;  1OGZ A;  4MMY B;  1J2B A;  4K1U A;  3X3Z A;  2GEY A;  3JUP A;  1US1 A;  3WDG B;  3F7X A;  1W6C A;  1GY5 A;  2FGT A;  1E3V A;  1PU4 A;  3BNC A;  3L0R A;  1AVK A;  2CFG A;  2B1X B;  3ALA A;  8CHO A;  3CCS 3;  3FSD A;  4XB5 A;  3PYJ A;  3Q90 A;  2WO0 A;  6STD A;  3SED A;  4LEH A;  4N6N B;  3CPW 2;  5JBS A;  4HM4 B;  2F98 A;  3QRD A;  2CFD A;  3GZB A;  5IG0 A;  1ZX2 A;  3OX9 A;  2CW9 A;  5BVB A;  3U1W A;  3NV0 A;  1W4N A;  3U97 A;  1Q86 4;  2BNG A;  4R80 A;  3B4P A;  1TU5 A;  5AIF A;  1NWW A;  1O7W B;  2XFS A;  5AIH A;  2CKF B;  1W6Y A;  3BNB A;  5LC7 A;  1RRH A;  3MG1 A;  4X2H A;  5ELU A;  2P05 A;  4H3U A;  5LC6 A;  1D6Z A;  3WOD G;  3NBJ A;  3X3X A;  1K73 4;  1CQS A;  1IV9 A;  3VGN A;  4WFO A;  1RN7 A;  4HZB B;  4HM3 B;  4NHF A;  3ECF A;  4RBN A;  1QMA A;  3DGL A;  3OW2 2;  3DGM A;  1IU7 A;  4GL6 A;  1OPY A;  1BUQ A;  2Y73 A;  1N9J A;  3FG1 A;  3NXJ A;  1O7P B;  1IT8 A;  1EA2 A;  1FGR A;  4JRF A;  1K41 A;  1OGX A;  3EX9 A;  4MMX B;  1CYU A;  1WTH A;  1W00 A;  3IPT A;  5IEN A;  1JB4 A;  5D81 A;  2OTJ 3;  1IQX A;  1UUV B;  2W56 B;  4HVN A;  1YIT 3;  3HI7 A;  1OUN A;  1W6G A;  1IVU A;  1OH0 A;  3BND A;  3KII A;  3S29 A;  5JPU A;  2XR8 B;  5IER A;  1DMM A;  1R4C A;  2RSX A;  2JDI H;  3JUQ A;  2OQE A;  3S5C A;  4FR9 A;  3WOE B;  1IVW A;  1SIH A;  2QEX 3;  1KC8 4;  2M7O A;  4WP5 A;  3FZW A;  1W01 A;  5AIG A;  3LT8 A;  5EQL A;  3LML A;  1OHP A;  5CXO A;  3S27 A;  3V92 A;  3MWZ A;  1Q81 4;  1SPU A;  1JN5 B;  1IK3 A;  2HMJ B;  5IEO A;  4L8O A;  4FMB A;  1D6Y A;  2HMO B;  1KWI A;  3GRD A;  1AVL A;  3WOF B;  3FG3 A;  3CC2 3;  1NJI 4;  1LOX A;  5I97 A;  3SOY A;  2JQ5 A;  3X41 A;  4LGQ A;  1E97 A;  3FGY A;  3I56 3;  1VQ6 3;  3X40 A;  2GU1 A;  3NX0 A;  4CDL A;  3EHC A;  2W56 A;  2R4I A;  3JUO A;  3VF1 A;  1W7C A;  4IPB A;  1DMN A;  4ZM8 A;  1VQ9 3;  4CCV A;  1VZZ A;  3BNE A;  2P38 A;  5IG5 A;  5FGO A;  3KSE D;  1K9M 4;  1IV7 A;  3SVA A;  3IJE B;  3BB9 A;  4HZ9 B;  3ROB A;  4XM4 A;  3K5T A;  1HU9 A;  3K7C A;  1UI8 A;  2HMN B;  2RFR A;  1A2K A;  5IG3 A;  1O7M B;  3LTA A;  4HBR A;  5AYR B;  1UI7 A;  2XSH B;  3ER7 A;  2CH9 A;  3D3L A;  1YHQ 3;  1M1X B;  3M8C A;  3IMA B;  2LYX A;  3DMC A;  4XBY A;  1Q82 4;  3EQQ B;  2BMR B;  3T8N A;  2BT3 A;  3FCS B;  1NDO B;  1F8N A;  3FKA A;  3CCU 3;  2W04 A;  1CEW I;  1Q7Y 4;  2BMO B;  2OWP A;  1OF5 B;  4X2O A;  3LXU X;  3NBB A;  1M9G A;  3CPO A;  1IT7 A;  4K90 B;  1QAK A;  1AR0 A;  1JB2 A;  2C11 A;  2L4V A;  4R9K A;  4L7K A;  2GEX A;  3CNM A;  4N6O B;  5JPP A;  3JUM A;  3GAX A;  4BTY A;  3CXC 2;  1M1K 4;  5IF6 A;  3UB1 A;  3FG4 A;  5KP4 A;  1N8Q A;  2IUJ A;  2RCD A;  2CK3 H;  2HMM B;  2ML6 A;  1Q40 B;  1JKG B;  1W02 A;  5HGR A;  5A0O B;  3CD6 3;  4PEJ A;  4N6T A;  1IDP A;  3CC7 3;  3AMO B;  2XFT A;  1IQ8 A;  3MKI A;  3G4S 3;  7STD A;  4G1M B;  1JB5 A;  1JNQ A;  1TFO A;  1VQ5 3;  4K1V A;  3B8L A;  2GBX B;  1ZO2 A;  3CCE 3;  3CCJ 3;  4I4K A;  2P09 A;  3GWR A;  2E2T A;  2P0X A;  2WOF A;  2CFK A;  2PZV A;  5TGN A;  1S5A A;  1EKM A;  1TFK A;  3NV0 B;  3G16 A;  4L8P A;  1HKX A;  3CMA 3;  1JV2 B;  4FCJ A;  1U5O A;  2RGQ A;  2ML5 A;  4O02 B;  4N3V A;  1GYB A;  2IUK A;  3EB8 A;  2OQE C;  2XEP A;  3UJM A;  5IG4 A;  3LZA A;  4WYK B;  4KFE A;  3LYG A;  1U8C B;  3UNL A;  1DVC A;  1QAF A;  2PNC A;  3UL6 A;  2V1L A;  2XH9 A;  3NM2 A;  2FNQ A;  3GZY B;  1IVV A;  3H51 A;  4HM0 B;  4HM2 B;  4EYC A;  3KZT A;  5EEO A;  4R9L A;  3KSP A;  4STD A;  2Q07 A;  1JJ2 2;  3VSY A;  1PFP A;  1OAC A;  3HZP A;  3KN4 A;  2WOH A;  1W5Z A;  1LXE A;  4HKV B;  3WMD A;  3EJV A;  3F9S A;  1O7N B;  4AEQ A;  1VQP 3;  1RKY A;  3OV4 A;  1MNL A;  2D1W A;  3NHX A;  1JN5 A;  3CCL 3;  1KD1 4;  1AV4 A;  3F40 A;  1JRQ A;  1SII A;  4KVH A;  1WMP A;  1GD3 A;  2K0M A;  2YFL B;  4HM7 B;  3RGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...