2GXFA

X-ray crystal structure of protein yybh from bacillus subtilis. northeast structural genomics consortium target sr506.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
128
structure length
119
Chain Sequence
MEQQLKDIISACDLAIQNEDFDTLMNYYSEDAVLVVKPGMIARGKEEIKKAFITIANYFNHHIVPTQGKMILLEAGDTVLVLSQTLLDMERRATYVFKKNAQGEWLCVIDNSYGTDLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yybH
publication title Crystal Structure of the Hypothetical Protein YybH from Bacillus subtilis, Northeast Structural Genomics Target SR506
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 27
structure length 119
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13474 SnoaL_3 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gxfA00
5CK6A 5D81A 1OGXA 3ECFA 3VSYA 3WMDA 5KP3A 5IG5A 4HM6B 2F99A 3MKIA 2HMJB 2GXFA 2B1XB 3M8CA 5DREA 1NU3A 5IG0A 3NUVA 1W6YA 2INXA 1OHSA 1JB2A 1A2KA 4J8TA 1E97A 1OF5B 2HMKB 2JQ5A 4I4KA 3DM8A 1W00A 1Z1SA 3NBRA 4HM2B 4HZBB 2QGUA 4L7KA 5HGRA 3S5CA 1OHOA 3B8LA 3RGAA 3STDA 3G0KA 3MHEA 1E3RA 1GY7A 1O7HB 5IENA 3F40A 2RFRA 2K54A 2BMQB 5AIHA 3CU3A 3GRDA 3FKAA 5CF1A 5G2GA 1IDPA 1WQLB 4FCMA 3UNLA 1ULIB 4WYKA 4R9KA 4XBXA 3BB9A 4LMIA 1VZZA 4Q53A 3EHCA 1STDA 3OWSA 2XR8B 1OF5A 2HMNB 4HM8B 3EBTA 1GY6A 4XM4A 2F86B 5IERA 3ROBA 2XSOB 2A15A 3B7CA 4PEJA 3LZAA 4KVHA 3FH1A 1OUNA 1Q40B 1JN5B 5JPPA 1EG9B 1ZO2A 1QJGA 1TP6A 4HM0B 3EF8A 2BNGA 1AR0A 3T8UA 3NXJA 3DXOA 3VGNA 1K41A 5IEOA 3GZRA 1O7GB 3EX9A 1OCVA 5STDA 5FW5A 3BLZA 3CPOA 3F8XA 3KKGA 4HM5B 2CHCA 1SJWA 1OGZA 1GYBA 2W2CA 3FF0A 4R1KA 8CHOA 1C7HA 5IF6A 1NDOB 4LGQA 3NV0B 4HZ9B 3G8ZA 3OXAA 5TGNA 3K7CA 5KP4A 3FGYA 3MSOA 5AIFA 2Z77A 5AEWB 3B4PA 3H51A 1Q40A 3H3HA 1HKXA 2IMJA 4L8OA 1TUHA 3Q90A 1O7PB 4H3UA 2Z7AA 2CKFB 2XSHB 3JUMA 3GZXB 3CNXA 1ASKA 4XB5A 4HVNA 3F7XA 2HMMB 3JUOA 4ORLA 7STDA 4RZMA 2GBWB 1EA2A 3OWYA 5DRVA 5JPUA 3JUNA 5AIGA 4X2OA 2YFJB 3UJMA 1DMNA 1O7MB 1U5OA 5BVBA 3EN8A 3EJVA 3OV4A 2RGQA 3SOYA 3HZPA 3F8HA 1OH0A 4XBTA 3KSPA 3E99A 5D82A 3NV0A 2HMOB 3GZBA 3FF2A 2GEXA 3G16A 3GZYB 2I9WA 3CNMA 4XDVA 1S5AA 4HJLB 4CDLA 1OHPA 4J9AA 5KP1A 1OPYA 4WYKB 1BUQA 1JKGB 2HMLB 3MG2A 3NHXA 4L8PA 1O7NB 1NWWA 1Q42A 1ZX2A 4N3VA 2B24B 6STDA 3MG3A 1CQSA 1UUWB 3F7SA 5CLKA 3ER7A 3MYTA 1GS3A 4OUQA 1QMAA 3I0YA 3NM2A 2YFIB 2RCDA 5AIIA 1JN5A 4R9LA 3KZTA 3FSDA 5EVHA 2GBXB 4FCJA 2BMRB 3RGRA 5IG4A 3HK4A 5IG3A 3SOAA 3T8NA 3DUKA 1ULJB 3JUPA 1ISKA 1JKGA 3OWUA 4K1UA 2F98A 3DMCA 3F14A 5AEUB 1JB5A 4HM4B 3IPTA 4K1VA 3EC9A 4STDA 3K0ZA 2BMOB 1W01A 2UX0A 3KE7A 4IIAA 2Z76A 4HKVB 4WWUC 4GB5A 5BXQA 1E3VA 3B4OA 5CF2A 4LEHA 3A76A 4HM1B 4OVMA 5D83A 3EN1B 5CXOA 2R4IA 3HX8A 4HM3B 4XBYA 4HM7B 3SEDA 3D9RA 2PZVA 1UUVB 1DMQA 5AI1A 3FZWA 1DMMA 2QIYA 3JUQA 3OX9A 5IEPA 3LYGA 4MJDA 4WP5A 4X2HA 2STDA 3F9SA 2OWPA 3EQQB 3GWRA 1W02A 2GEYA 3EBYA 4XDWA 1GY5A 4U13A 1JB4A 1O7WB 3FLJA 3MG1A 2XRXB 2YFLB 3DZLA
chains in the Genus database with same CATH superfamily
1RGHA 2P38A 5CK6A 1TFOA 5D81A 3FG1A 4GSPA 1OGXA 1ZS7A 2OQEC 3ECFA 7GSPA 3CCV3 1BRSA 3VSYA 3WMDA 2SARA 1LXEA 5KP3A 5IG5A 4HM6B 1I3IA 3DY5A 2F99A 3DGYA 3MKIA 1RLSA 1ZGXA 2HMJB 3PZWA 1BOXA 1GMRA 2B1XB 2GXFA 3CCM3 1AY7A 4MMYB 4I5QA 3M8CA 5DREA 1NU3A 5IG0A 1BRNL 3NUVA 1W6YA 2INXA 2KXGA 1OHSA 1JB2A 1A2KA 1G02A 1E97A 3D3LA 1OF5B 1T2HA 4J8TA 2WOHA 1Q7HA 2HMKB 1NNVA 2JQ5A 2KF6A 4FMCA 4I4KA 3CCJ3 3DM8A 1B20A 1W00A 1IQYA 1Z1SA 2JDIH 2K3DA 5A0OB 3U97A 2W0QA 3CCR3 2XFTA 1N5HA 2CW9A 1ROAA 2Y73A 1VQ53 1RNBA 3NBRA 4HM2B 3CXC2 1I8VA 2F5MA 1I2GA 4AEQA 4R4KA 4HZBB 3Q2PA 1K8A4 3BU4A 1CH0A 2QGUA 1UDII 1YJ93 3K9MC 3KFQC 4L7KA 1NJI4 5HGRA 3S5CA 1JV2B 2KCDA 1OHOA 4KFDA 3B8LA 3RGAA 1YJN3 1GOVA 3STDA 1T5YA 1MOLA 4BL3A 1S723 3G0KA 1J2BA 3MHEA 1BRIA 3J7Yd 5JBSA 3CCU3 1E3RA 1GY7A 1O7HB 3D79A 5IENA 3F40A 2KF4A 2RFRA 1IK3A 1D6YA 2K54A 2WO0A 2BMQB 3CC43 1RJOA 5AIHA 4K61A 7RNTA 2FXTA 2HOHA 3BNDA 3CU3A 1RGCA 2D1WA 3CD63 1RGGA 1RRHA 3GRDA 1Q7Y4 3FKAA 4RBNA 2F56A 5CF1A 5G2GA 3AHSA 1YJW3 1FGTA 1KC84 1IDPA 2C11A 3K5TA 3D5IA 2L4VA 1WQLB 1AQZA 4FCMA 3UNLA 2CWUA 1ULIB 3LOYA 3KIIA 3MWZA 1YI23 1BNFA 4WYKA 3ZG0A 1JBRA 1WMOA 1U8CB 1YHQ3 2ML5A 3S67A 1CEWI 4R9KA 4XBXA 5EEOA 1BSBA 2RBIA 2C10A 3BB9A 1HU9A 4R80A 1KWIA 1IVUA 1EEJA 3DGMA 4LMIA 4EYCA 1FGQA 1VZZA 2P09A 1RTUA 4Q53A 4MEIA 1RMSA 1RN4A 8RNTA 1BNJA 1IQXA 3EHCA 1JZOA 3WA2X 2W56B 1STDA 1X1YA 4K90B 3CC73 3L0RA 3OWSA 4KT3B 3DGOA 2E2UA 2XR8B 3DGNA 3S27A 1DE3A 3KN4A 1LOXA 2GU1A 1DYUA 2ZHXB 1NB3I 1FUTA 1JZDA 1OF5A 2HMNB 1N8R4 1DVCA 1QALA 3LH4A 1QVF2 4HM8B 1I0VA 3EBTA 2R41A 4GL6A 4O3VA 1WTHA 1IV9A 1GY6A 4XM4A 2F86B 2W03A 3NQZA 5IERA 4CPKA 3MPHA 2XSOB 3PGBA 2Y74A 3ROBA 3WDGB 3ZFZA 2A15A 3B7CA 4PEJA 3LZAA 3T0UA 1DVDA 1AVKA 1V57A 1B3SA 4KVHA 4NPBA 3FH1A 3CMA3 4BTXA 3DGLA 2CFGA 1OUNA 1Q40B 2RSXA 1JN5B 3LTBA 1D6ZA 1CYVA 5JPPA 1GMPA 3D5GA 1FGOA 1BNGA 1EG9B 1ZO2A 1QJGA 4N6NB 4FR9A 1TP6A 4HM0B 1BRKA 3EF8A 1TFKA 1AV4A 2BNGA 3CPW2 1T3BA 1AR0A 2CC3A 3SX1A 3T8UA 1R4YA 2L1SA 3NXJA 1BNRA 3DXOA 3I553 1X1XA 1STFI 3KSED 4BU4A 3VGNA 1K41A 3AMOB 1B2SA 2GU3A 5IEOA 3GZRA 1FUSA 2KF5A 1O7GB 1MWUA 1UW1A 2AAEA 3BIRA 3LMLA 3D4AA 1BRGA 1YIT3 1FZUA 6GSPA 1RCLA 1QAFA 5M1AA 1M1XB 4IPBA 1PYLA 3V92A 3WOFB 3EX9A 3CCE3 1W6GA 4LSOA 1OCVA 5STDA 1PY3A 5FW5A 1N8QA 1VQN3 1HYFA 5AYSC 1RDSA 2F4YA 3BLZA 3NBJA 1B27A 3CPOA 1A90A 5GSPA 4OK0A 3HI7A 3FCSB 3UL6A 2W04A 1MGRA 1Y4KA 3F8XA 3AGOA 1FYSA 1UGHI 2LYXA 2P0MA 3KKGA 5BVBA 4FCZA 1TU5A 1LNIA 3JVCA 2YX9A 4HM5B 1VQ73 3RNTA 2CHCA 2W9PA 3NQYA 1WMNA 2CH9A 2XEPA 1SJWA 3RDEA 1MNLA 1OGZA 4O02B 4EV2A 1GYBA 2W2CA 3X40A 1BSEA 1JBTA 3FF0A 4R1KA 1MWTA 8CHOA 4N6MA 5FGOA 3URPA 1C7HA 1D6UA 2SBLA 1VQ63 2UUGC 3GSPA 2CX1A 3SXXA 1BSAA 1NDOB 5IF6A 4LGQA 3NV0B 4HOHA 3GAXA 4HZ9B 2OTJ3 1IYYA 1VQK3 3G8ZA 1YGEA 3OXAA 5TGNA 1VQ83 3PS8A 4OVMA 4AKYA 1VQM3 3K7CA 3HIIA 2ZL8A 1RN7A 5KP4A 3FGYA 3MSOA 3O8YA 5AIFA 1SQWA 2Z77A 1BSDA 5AEWB 3V98A 3B4PA 3LTDA 1NO3A 2WGOA 1BU4A 1JRQA 1Q40A 3H51A 3H3HA 1HKXA 2IMJA 4L8OA 2FNQA 1ROVA 1TUHA 1V74A 3I563 3Q90A 4KFFA 1O7PB 3CCQ3 4H3UA 2Z7AA 1IVVA 1GOUA 1M9GA 2CKFB 2O9UX 2UGIA 4FMBA 3LT9A 2PNCA 2H0GA 2FGTA 1GD4A 2XSHB 3JUMA 1IU7A 3GZXB 5EQLA 1VQP3 4N6UA 1QAKA 3AGNA 3CNXA 1ASKA 4XB5A 3G6E3 1JNQA 4J5GA 1CYUA 4HVNA 5BIRA 1SIIA 4QWTA 1A67A 2O3OA 2RNTA 1Q864 3F7XA 2HMMB 3JUOA 5BU4A 1KD14 1YIJ3 1A2VA 4H61A 1RGLA 1I70A 2BT3A 3WHOA 1X1UA 2KRTA 3OW22 3PCRA 4TX4A 4ORLA 2LQVA 4JF8A 2E2TA 1SIHA 1UCIA 7STDA 4RZMA 2GBWB 3AHWA 1W7CA 1EA2A 1K734 4RNZA 3OWYA 1F8NA 5I97A 1TTOA 5DRVA 3CME3 2OQEA 3DH2A 5JPUA 1RGAA 1VQ43 3FG3A 3JUNA 5AIGA 1N5PA 4X2OA 1RGEA 1UUGB 2YFJB 1US1A 4BTWA 1OACA 3UJMA 1DMNA 1FUWA 1JJ22 4KFEA 1O7MB 3X3XA 1TIJA 1N9EA 1U5OA 2C4BA 2CK3H 2KAAA 3EE1A 3EN8A 3EJVA 3PXMA 1BNIA 3X41A 3OV4A 2RGQA 3SOYA 3HZPA 3F8HA 2GSPA 2V1LA 1OH0A 4XBTA 1QVG2 3KSPA 2QA43 4G1MB 1W6CA 4RNYA 1KQS2 3X3YA 3E99A 5D82A 3NV0A 1HZ1A 2HMOB 2Q07A 2XF3A 1W4NA 4WHAA 2KF3A 3UB1A 1VQ93 4EBGA 4FMAA 5M19A 2OCTA 3S28A 3GZBA 1YVBI 3FF2A 2GEXA 3G16A 3GZYB 3N8BA 1DETA 3UL5A 1FW7A 5IW9A 2I9WA 3QRDA 1UGIA 1W5ZA 3CNMA 2MF7A 3LT8A 3Q1CA 3TDGA 4IT7A 1RHLA 4XDVA 3V99A 1GMQA 1S5AA 1BSCA 1X1WA 3EB8A 1LOYA 1BGSA 1G96A 1GD3A 1TRQA 1Q824 3X42A 4EXRA 4N6OB 1RN1A 1IT8A 3U1WA 5G1KA 1RGFA 4HJLB 1BNSA 4CDLA 3LTCA 1OHPA 4J9AA 1YGWA 2WGQA 5G1LA 2IUJA 5KP1A 1OPYA 1RGKA 2W9QA 4WYKB 1BUQA 1JKGB 2J8XB 3Q3FA 4BL2A 2H0HA 4BTYA 3HIGA 3CC23 1R4CA 4N6V0 1L5GB 1B2UA 1IVXA 3A5EA 1MWRA 4HBRA 1G0TA 2HMLB 1WNHA 3MG2A 3ZG5A 3NHXA 1BRJA 4L8PA 3BNCA 4HAAA 1RKYA 1O7NB 1NWWA 1K9M4 2W56A 1VQL3 1Q42A 2P0XA 1ZX2A 4N3VA 2B24B 6STDA 1FGRA 2ZDJA 1M1K4 1PFPA 1CQSA 2AADA 3MG3A 4MMZB 1UCLA 1UUWB 1SPUA 1AVLA 3F7SA 5CLKA 5AYRB 3ER7A 3MYTA 4CJNA 2F5WA 1GS3A 1GOYA 1K28A 1LVNA 3NBBA 1LOVA 4J5KA 1B2ZA 1UI8A 2P05A 4CCVA 4OUQA 4EV5A 1QMAA 2CIUA 3I0YA 2OOVA 6RNTA 3NM2A 1T2IA 1M904 1I2FA 1LQMB 2BHMA 1VQO3 2YFIB 3N54B 1Q9EA 1RSNA 4LYLB 1RNTA 1BNEA 1B2MA 1IV7A 2MC8A 3S29A 2W6JH 3IJEB 1YNVX 4AKZA 2RCDA 5AIIA 2IUKA 1JN5A 4EW5A 1I2EA 4R9LA 1W2B2 1UCJA 1I0XA 1B2XA 4WFOA 3BNBA 2CG0A 3IMAB 2IYJA 1IQ8A 3KZTA 1RRLA 1A2PA 1TJDA 3VF1A 1RCKA 5RNTA 4ILFA 2OTL3 3FSDA 1KSIA 3CCL3 5EVHA 3G713 2CFWA 1EQKA 2GBXB 4FCJA 2BMRB 2CG1A 1Q814 3AMOA 3LXUX 3RGRA 4FMDA 4GHOA 5LC7A 5IG4A 5M18A 5ELJA 4JRFA 3HK4A 5IG3A 3SOAA 2H0IA 2Z6BA 4O8SA 4DKIA 1PU4A 1IT7A 3T8NA 3DUKA 2CWTA 4NHFA 1ULJB 2CX0A 3SVAA 3JUPA 1C54A 1ISKA 2IA7A 1JKGA 3WODG 5HOHA 2CFKA 2ZA4A 3SLUA 1BVIA 1JBSA 1GSPA 1YVSA 3OWUA 4K1UA 2IY2A 1TRPA 1W2ZA 1V58A 2F98A 3DMCA 3F14A 1JB5A 5AEUB 4HM4B 3IPTA 4K1VA 2XGNA 3EC9A 3SYUA 4STDA 3K0ZA 3LTAA 2BMOB 1W01A 2UX0A 3KE7A 4IIAA 2Z76A 4HKVB 3PYJA 4BIRA 1BANA 3G4S3 4ZM8A 2BU4A 3K63A 2CWVA 1LOWA 4LZIA 4N6TA 2OOVC 4WWUC 2XH9A 4GB5A 5ELUA 5BXQA 1MWSA 1VQQA 4HYZA 4NREA 4RNTA 1E3VA 1FGMA 3B4OA 1LRAA 5CF2A 4LEHA 3A76A 2BIRA 3N9HA 2E2VA 4HM1B 3EN1B 4KZ1A 1BIRA 2R4IA 5CXOA 3HX8A 5D83A 9RNTA 2QEX3 4HM3B 1LNHA 3PCSA 3NM7A 4XBYA 4HM7B 2D42A 1BRHA 3SEDA 3D9RA 4EC6A 2M7OA 1IVWA 2PZVA 1UUVB 1UI7A 1UCKA 1B21A 1DMQA 1SARA 5AI1A 4O2HA 1BUJA 3WA3A 2CFDA 3FZWA 2XFSA 1DMMA 2QIYA 3WOEB 1FA3A 2ML6A 2XGLA 3FG4A 3JUQA 3X3ZA 1WMPA 3OX9A 3HOHA 5IEPA 2BO9B 3LYGA 4MJDA 1LQGC 1EKMA 3ALAA 3KCHA 3NX0A 4WP5A 4X2HA 3WR2A 2STDA 3F9SA 4N6LA 3QK9A 3CCS3 2OWPA 1BAOA 2K0MA 1NB5I 3EQQB 3GWRA 1W02A 2GEYA 2WOFA 3EBYA 1N9JA 4XDWA 1GY5A 4U13A 4MMXB 1I3FA 1JB4A 1O7WB 3BNEA 1EUIC 3FLJA 5LC6A 3MG1A 1MGWA 2XRXB 2YFLB 2CFLA 3DZLA
chains in the Genus database with same CATH topology
2P38A 5CK6A 1TFOA 5D81A 3FG1A 1OGXA 3ECFA 2OQEC 3CCV3 3VSYA 3WMDA 1LXEA 5KP3A 5IG5A 4HM6B 3DY5A 2F99A 3MKIA 3PZWA 2HMJB 2GXFA 2B1XB 3CCM3 4MMYB 3M8CA 5DREA 1NU3A 5IG0A 3NUVA 1W6YA 2INXA 2KXGA 1OHSA 1JB2A 1A2KA 4J8TA 1E97A 3D3LA 1OF5B 2WOHA 3CCJ3 2HMKB 2JQ5A 4FMCA 4I4KA 3DM8A 1W00A 1Z1SA 1IQYA 2JDIH 5A0OB 2W0QA 3CCR3 2XFTA 1N5HA 2CW9A 1ROAA 2Y73A 1VQ53 3NBRA 4HM2B 3CXC2 4AEQA 4R4KA 4HZBB 3Q2PA 1K8A4 2QGUA 1YJ93 3K9MC 3KFQC 4L7KA 1NJI4 5HGRA 3S5CA 1JV2B 2KCDA 1OHOA 4KFDA 3B8LA 3RGAA 1YJN3 3STDA 1T5YA 1MOLA 1S723 3G0KA 1J2BA 3MHEA 3J7Yd 5JBSA 3CCU3 1E3RA 1GY7A 1O7HB 5IENA 3F40A 2RFRA 1IK3A 1D6YA 2K54A 2WO0A 2BMQB 3CC43 1RJOA 5AIHA 4K61A 2FXTA 3BNDA 3CU3A 2D1WA 3CD63 1RRHA 3GRDA 1Q7Y4 3FKAA 4RBNA 5CF1A 5G2GA 1YJW3 1FGTA 1KC84 1IDPA 2C11A 3K5TA 2L4VA 1WQLB 4FCMA 3UNLA 2CWUA 1ULIB 3LOYA 3KIIA 3MWZA 1YI23 4WYKA 1WMOA 1U8CB 1YHQ3 2ML5A 3S67A 1CEWI 4R9KA 4XBXA 5EEOA 2C10A 3BB9A 1HU9A 4R80A 1KWIA 1IVUA 3DGMA 4EYCA 4LMIA 1FGQA 1VZZA 2P09A 4Q53A 4MEIA 1IQXA 3EHCA 3WA2X 2W56B 1STDA 4K90B 3CC73 3L0RA 3OWSA 3DGOA 2E2UA 2XR8B 3DGNA 3S27A 3KN4A 1LOXA 2GU1A 1DYUA 1NB3I 1OF5A 2HMNB 1N8R4 1DVCA 1QALA 3LH4A 1QVF2 4HM8B 3EBTA 4GL6A 4O3VA 1WTHA 1IV9A 1GY6A 4XM4A 2F86B 2W03A 3NQZA 5IERA 3MPHA 2XSOB 3PGBA 2Y74A 3ROBA 3WDGB 2A15A 3B7CA 4PEJA 3LZAA 3T0UA 1DVDA 1AVKA 4KVHA 3CMA3 3FH1A 4BTXA 3DGLA 2CFGA 1OUNA 1Q40B 2RSXA 1JN5B 3LTBA 1D6ZA 1CYVA 5JPPA 1FGOA 1EG9B 1ZO2A 1QJGA 4N6NB 4FR9A 1TP6A 4HM0B 3EF8A 1TFKA 1AV4A 2BNGA 3CPW2 1AR0A 2CC3A 3SX1A 3T8UA 3NXJA 3DXOA 3I553 1STFI 3KSED 3VGNA 1K41A 3AMOB 2GU3A 5IEOA 3GZRA 3LMLA 1O7GB 1UW1A 1YIT3 1QAFA 3V92A 1M1XB 4IPBA 3WOFB 3CCE3 3EX9A 1W6GA 4LSOA 1OCVA 5STDA 5FW5A 1N8QA 1VQN3 5AYSC 3BLZA 3NBJA 3CPOA 1A90A 4OK0A 3HI7A 3FCSB 3UL6A 2W04A 1Y4KA 3F8XA 2LYXA 2P0MA 3KKGA 4FCZA 1TU5A 3JVCA 2YX9A 4HM5B 1VQ73 2CHCA 2W9PA 3NQYA 1WMNA 2CH9A 2XEPA 1SJWA 3RDEA 1MNLA 1OGZA 4O02B 4EV2A 1GYBA 2W2CA 3X40A 3FF0A 4R1KA 8CHOA 4N6MA 5FGOA 1C7HA 1D6UA 2SBLA 1VQ63 3SXXA 5IF6A 1NDOB 4LGQA 3NV0B 2OTJ3 3GAXA 4HZ9B 1VQK3 3G8ZA 1YGEA 3OXAA 5TGNA 1VQ83 3PS8A 4AKYA 1VQM3 3K7CA 3HIIA 2ZL8A 1RN7A 5KP4A 3FGYA 3MSOA 3O8YA 5AIFA 1SQWA 2Z77A 5AEWB 3V98A 3B4PA 3LTDA 1NO3A 2WGOA 1JRQA 1Q40A 3H51A 3H3HA 1HKXA 2IMJA 4L8OA 2FNQA 1ROVA 1TUHA 1V74A 3I563 3Q90A 4KFFA 1O7PB 3CCQ3 4H3UA 2Z7AA 1IVVA 2CKFB 1M9GA 4FMBA 2O9UX 3LT9A 2PNCA 2FGTA 1GD4A 2XSHB 3JUMA 1IU7A 3GZXB 5EQLA 1VQP3 4N6UA 1QAKA 3CNXA 1ASKA 4XB5A 3G6E3 1JNQA 1CYUA 4HVNA 1SIIA 4QWTA 1A67A 2O3OA 1Q864 3F7XA 2HMMB 3JUOA 1KD14 1YIJ3 1A2VA 4H61A 2BT3A 2KRTA 3OW22 3PCRA 4TX4A 4ORLA 2LQVA 4JF8A 2E2TA 1SIHA 7STDA 4RZMA 2GBWB 1W7CA 1EA2A 1K734 4RNZA 3OWYA 1F8NA 5I97A 5DRVA 3CME3 2OQEA 5JPUA 1VQ43 3FG3A 3JUNA 5AIGA 1N5PA 4X2OA 2YFJB 1US1A 4BTWA 1OACA 3UJMA 1DMNA 1FUWA 1JJ22 4KFEA 1O7MB 3X3XA 1TIJA 1N9EA 1U5OA 2CK3H 3EE1A 3EN8A 3U97A 5BVBA 3EJVA 3PXMA 3X41A 3OV4A 2RGQA 3SOYA 3HZPA 3F8HA 2V1LA 1OH0A 4XBTA 1QVG2 3KSPA 2QA43 4G1MB 1W6CA 4RNYA 1KQS2 3X3YA 3E99A 5D82A 3NV0A 2HMOB 2Q07A 2XF3A 1W4NA 4WHAA 3UB1A 1VQ93 4EBGA 4FMAA 2OCTA 3S28A 3GZBA 1YVBI 3FF2A 2GEXA 3G16A 3GZYB 3N8BA 3UL5A 5IW9A 2I9WA 3QRDA 1W5ZA 3LT8A 3CNMA 2MF7A 3Q1CA 3TDGA 4IT7A 4XDVA 3V99A 1S5AA 3EB8A 1G96A 1GD3A 1Q824 3X42A 4EXRA 4N6OB 1IT8A 3U1WA 4HJLB 4CDLA 3LTCA 1OHPA 4J9AA 2WGQA 2IUJA 5KP1A 1OPYA 2W9QA 4WYKB 1BUQA 1JKGB 4BTYA 3HIGA 3CC23 1R4CA 4N6V0 1L5GB 1IVXA 4HBRA 2HMLB 1WNHA 3MG2A 3NHXA 4L8PA 3BNCA 1RKYA 1K9M4 1O7NB 1NWWA 1VQL3 2W56A 1Q42A 2P0XA 1ZX2A 4N3VA 2B24B 6STDA 1FGRA 2ZDJA 1M1K4 1PFPA 1CQSA 3MG3A 4MMZB 1UUWB 1SPUA 1AVLA 3F7SA 5CLKA 5AYRB 3ER7A 3MYTA 1GS3A 1LVNA 1K28A 3NBBA 1UI8A 2P05A 4CCVA 4OUQA 4EV5A 1QMAA 2CIUA 3I0YA 2OOVA 1M904 3NM2A 2BHMA 1VQO3 2YFIB 3N54B 1IV7A 2MC8A 3S29A 2W6JH 3IJEB 4AKZA 2RCDA 5AIIA 2IUKA 1JN5A 4R9LA 1W2B2 4WFOA 3BNBA 2CG0A 3IMAB 1IQ8A 3KZTA 1RRLA 3VF1A 2OTL3 3FSDA 1KSIA 3CCL3 5EVHA 3G713 2CFWA 1EQKA 2GBXB 4FCJA 2BMRB 1Q814 3AMOA 3LXUX 3RGRA 4FMDA 5IG4A 5LC7A 5ELJA 4JRFA 3HK4A 5IG3A 3SOAA 2Z6BA 4O8SA 1PU4A 1IT7A 3T8NA 3DUKA 2CWTA 4NHFA 1ULJB 3SVAA 3JUPA 1ISKA 2IA7A 1JKGA 3WODG 2CFKA 3SLUA 3OWUA 4K1UA 1W2ZA 2F98A 3DMCA 3F14A 5AEUB 1JB5A 4HM4B 3IPTA 4K1VA 2XGNA 3EC9A 4STDA 3K0ZA 3LTAA 2BMOB 1W01A 2UX0A 3KE7A 4IIAA 2Z76A 4HKVB 3PYJA 3G4S3 4ZM8A 3K63A 4N6TA 2CWVA 4LZIA 4WWUC 2OOVC 2XH9A 4GB5A 5ELUA 5BXQA 4HYZA 4NREA 1E3VA 1FGMA 3B4OA 5CF2A 4LEHA 3A76A 4HM1B 3N9HA 2E2VA 4KZ1A 3EN1B 4OVMA 5CXOA 2R4IA 5D83A 3HX8A 2CG1A 2QEX3 4HM3B 1LNHA 3PCSA 3NM7A 4XBYA 4HM7B 2D42A 3SEDA 3D9RA 4EC6A 2M7OA 1IVWA 2PZVA 1UUVB 1UI7A 1DMQA 5AI1A 4O2HA 3WA3A 2CFDA 3FZWA 2XFSA 1DMMA 2QIYA 3WOEB 1FA3A 2ML6A 2XGLA 3FG4A 3JUQA 3X3ZA 1WMPA 3OX9A 5IEPA 2BO9B 3LYGA 4MJDA 1EKMA 3ALAA 3NX0A 4WP5A 4X2HA 2STDA 3F9SA 4N6LA 3QK9A 3CCS3 2OWPA 2K0MA 1NB5I 3EQQB 3GWRA 1W02A 2WOFA 2GEYA 3EBYA 1N9JA 4XDWA 1GY5A 4U13A 4MMXB 1JB4A 1O7WB 3BNEA 3FLJA 5LC6A 3MG1A 2XRXB 2YFLB 2CFLA 3DZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CK6 A;  5D81 A;  1OGX A;  3ECF A;  3VSY A;  3WMD A;  5KP3 A;  5IG5 A;  4HM6 B;  2F99 A;  3MKI A;  2HMJ B;  2GXF A;  2B1X B;  3M8C A;  5DRE A;  1NU3 A;  5IG0 A;  3NUV A;  1W6Y A;  2INX A;  1OHS A;  1JB2 A;  1A2K A;  4J8T A;  1E97 A;  1OF5 B;  2HMK B;  2JQ5 A;  4I4K A;  3DM8 A;  1W00 A;  1Z1S A;  3NBR A;  4HM2 B;  4HZB B;  2QGU A;  4L7K A;  5HGR A;  3S5C A;  1OHO A;  3B8L A;  3RGA A;  3STD A;  3G0K A;  3MHE A;  1E3R A;  1GY7 A;  1O7H B;  5IEN A;  3F40 A;  2RFR A;  2K54 A;  2BMQ B;  5AIH A;  3CU3 A;  3GRD A;  3FKA A;  5CF1 A;  5G2G A;  1IDP A;  1WQL B;  4FCM A;  3UNL A;  1ULI B;  4WYK A;  4R9K A;  4XBX A;  3BB9 A;  4LMI A;  1VZZ A;  4Q53 A;  3EHC A;  1STD A;  3OWS A;  2XR8 B;  1OF5 A;  2HMN B;  4HM8 B;  3EBT A;  1GY6 A;  4XM4 A;  2F86 B;  5IER A;  3ROB A;  2XSO B;  2A15 A;  3B7C A;  4PEJ A;  3LZA A;  4KVH A;  3FH1 A;  1OUN A;  1Q40 B;  1JN5 B;  5JPP A;  1EG9 B;  1ZO2 A;  1QJG A;  1TP6 A;  4HM0 B;  3EF8 A;  2BNG A;  1AR0 A;  3T8U A;  3NXJ A;  3DXO A;  3VGN A;  1K41 A;  5IEO A;  3GZR A;  1O7G B;  3EX9 A;  1OCV A;  5STD A;  5FW5 A;  3BLZ A;  3CPO A;  3F8X A;  3KKG A;  4HM5 B;  2CHC A;  1SJW A;  1OGZ A;  1GYB A;  2W2C A;  3FF0 A;  4R1K A;  8CHO A;  1C7H A;  5IF6 A;  1NDO B;  4LGQ A;  3NV0 B;  4HZ9 B;  3G8Z A;  3OXA A;  5TGN A;  3K7C A;  5KP4 A;  3FGY A;  3MSO A;  5AIF A;  2Z77 A;  5AEW B;  3B4P A;  3H51 A;  1Q40 A;  3H3H A;  1HKX A;  2IMJ A;  4L8O A;  1TUH A;  3Q90 A;  1O7P B;  4H3U A;  2Z7A A;  2CKF B;  2XSH B;  3JUM A;  3GZX B;  3CNX A;  1ASK A;  4XB5 A;  4HVN A;  3F7X A;  2HMM B;  3JUO A;  4ORL A;  7STD A;  4RZM A;  2GBW B;  1EA2 A;  3OWY A;  5DRV A;  5JPU A;  3JUN A;  5AIG A;  4X2O A;  2YFJ B;  3UJM A;  1DMN A;  1O7M B;  1U5O A;  5BVB A;  3EN8 A;  3EJV A;  3OV4 A;  2RGQ A;  3SOY A;  3HZP A;  3F8H A;  1OH0 A;  4XBT A;  3KSP A;  3E99 A;  5D82 A;  3NV0 A;  2HMO B;  3GZB A;  3FF2 A;  2GEX A;  3G16 A;  3GZY B;  2I9W A;  3CNM A;  4XDV A;  1S5A A;  4HJL B;  4CDL A;  1OHP A;  4J9A A;  5KP1 A;  1OPY A;  4WYK B;  1BUQ A;  1JKG B;  2HML B;  3MG2 A;  3NHX A;  4L8P A;  1O7N B;  1NWW A;  1Q42 A;  1ZX2 A;  4N3V A;  2B24 B;  6STD A;  3MG3 A;  1CQS A;  1UUW B;  3F7S A;  5CLK A;  3ER7 A;  3MYT A;  1GS3 A;  4OUQ A;  1QMA A;  3I0Y A;  3NM2 A;  2YFI B;  2RCD A;  5AII A;  1JN5 A;  4R9L A;  3KZT A;  3FSD A;  5EVH A;  2GBX B;  4FCJ A;  2BMR B;  3RGR A;  5IG4 A;  3HK4 A;  5IG3 A;  3SOA A;  3T8N A;  3DUK A;  1ULJ B;  3JUP A;  1ISK A;  1JKG A;  3OWU A;  4K1U A;  2F98 A;  3DMC A;  3F14 A;  5AEU B;  1JB5 A;  4HM4 B;  3IPT A;  4K1V A;  3EC9 A;  4STD A;  3K0Z A;  2BMO B;  1W01 A;  2UX0 A;  3KE7 A;  4IIA A;  2Z76 A;  4HKV B;  4WWU C;  4GB5 A;  5BXQ A;  1E3V A;  3B4O A;  5CF2 A;  4LEH A;  3A76 A;  4HM1 B;  4OVM A;  5D83 A;  3EN1 B;  5CXO A;  2R4I A;  3HX8 A;  4HM3 B;  4XBY A;  4HM7 B;  3SED A;  3D9R A;  2PZV A;  1UUV B;  1DMQ A;  5AI1 A;  3FZW A;  1DMM A;  2QIY A;  3JUQ A;  3OX9 A;  5IEP A;  3LYG A;  4MJD A;  4WP5 A;  4X2H A;  2STD A;  3F9S A;  2OWP A;  3EQQ B;  3GWR A;  1W02 A;  2GEY A;  3EBY A;  4XDW A;  1GY5 A;  4U13 A;  1JB4 A;  1O7W B;  3FLJ A;  3MG1 A;  2XRX B;  2YFL B;  3DZL A; 
#chains in the Genus database with same CATH topology
 1RGH A;  2P38 A;  5CK6 A;  1TFO A;  5D81 A;  3FG1 A;  4GSP A;  1OGX A;  1ZS7 A;  2OQE C;  3ECF A;  7GSP A;  3CCV 3;  1BRS A;  3VSY A;  3WMD A;  2SAR A;  1LXE A;  5KP3 A;  5IG5 A;  4HM6 B;  1I3I A;  3DY5 A;  2F99 A;  3DGY A;  3MKI A;  1RLS A;  1ZGX A;  2HMJ B;  3PZW A;  1BOX A;  1GMR A;  2B1X B;  2GXF A;  3CCM 3;  1AY7 A;  4MMY B;  4I5Q A;  3M8C A;  5DRE A;  1NU3 A;  5IG0 A;  1BRN L;  3NUV A;  1W6Y A;  2INX A;  2KXG A;  1OHS A;  1JB2 A;  1A2K A;  1G02 A;  1E97 A;  3D3L A;  1OF5 B;  1T2H A;  4J8T A;  2WOH A;  1Q7H A;  2HMK B;  1NNV A;  2JQ5 A;  2KF6 A;  4FMC A;  4I4K A;  3CCJ 3;  3DM8 A;  1B20 A;  1W00 A;  1IQY A;  1Z1S A;  2JDI H;  2K3D A;  5A0O B;  3U97 A;  2W0Q A;  3CCR 3;  2XFT A;  1N5H A;  2CW9 A;  1ROA A;  2Y73 A;  1VQ5 3;  1RNB A;  3NBR A;  4HM2 B;  3CXC 2;  1I8V A;  2F5M A;  1I2G A;  4AEQ A;  4R4K A;  4HZB B;  3Q2P A;  1K8A 4;  3BU4 A;  1CH0 A;  2QGU A;  1UDI I;  1YJ9 3;  3K9M C;  3KFQ C;  4L7K A;  1NJI 4;  5HGR A;  3S5C A;  1JV2 B;  2KCD A;  1OHO A;  4KFD A;  3B8L A;  3RGA A;  1YJN 3;  1GOV A;  3STD A;  1T5Y A;  1MOL A;  4BL3 A;  1S72 3;  3G0K A;  1J2B A;  3MHE A;  1BRI A;  3J7Y d;  5JBS A;  3CCU 3;  1E3R A;  1GY7 A;  1O7H B;  3D79 A;  5IEN A;  3F40 A;  2KF4 A;  2RFR A;  1IK3 A;  1D6Y A;  2K54 A;  2WO0 A;  2BMQ B;  3CC4 3;  1RJO A;  5AIH A;  4K61 A;  7RNT A;  2FXT A;  2HOH A;  3BND A;  3CU3 A;  1RGC A;  2D1W A;  3CD6 3;  1RGG A;  1RRH A;  3GRD A;  1Q7Y 4;  3FKA A;  4RBN A;  2F56 A;  5CF1 A;  5G2G A;  3AHS A;  1YJW 3;  1FGT A;  1KC8 4;  1IDP A;  2C11 A;  3K5T A;  3D5I A;  2L4V A;  1WQL B;  1AQZ A;  4FCM A;  3UNL A;  2CWU A;  1ULI B;  3LOY A;  3KII A;  3MWZ A;  1YI2 3;  1BNF A;  4WYK A;  3ZG0 A;  1JBR A;  1WMO A;  1U8C B;  1YHQ 3;  2ML5 A;  3S67 A;  1CEW I;  4R9K A;  4XBX A;  5EEO A;  1BSB A;  2RBI A;  2C10 A;  3BB9 A;  1HU9 A;  4R80 A;  1KWI A;  1IVU A;  1EEJ A;  3DGM A;  4LMI A;  4EYC A;  1FGQ A;  1VZZ A;  2P09 A;  1RTU A;  4Q53 A;  4MEI A;  1RMS A;  1RN4 A;  8RNT A;  1BNJ A;  1IQX A;  3EHC A;  1JZO A;  3WA2 X;  2W56 B;  1STD A;  1X1Y A;  4K90 B;  3CC7 3;  3L0R A;  3OWS A;  4KT3 B;  3DGO A;  2E2U A;  2XR8 B;  3DGN A;  3S27 A;  1DE3 A;  3KN4 A;  1LOX A;  2GU1 A;  1DYU A;  2ZHX B;  1NB3 I;  1FUT A;  1JZD A;  1OF5 A;  2HMN B;  1N8R 4;  1DVC A;  1QAL A;  3LH4 A;  1QVF 2;  4HM8 B;  1I0V A;  3EBT A;  2R41 A;  4GL6 A;  4O3V A;  1WTH A;  1IV9 A;  1GY6 A;  4XM4 A;  2F86 B;  2W03 A;  3NQZ A;  5IER A;  4CPK A;  3MPH A;  2XSO B;  3PGB A;  2Y74 A;  3ROB A;  3WDG B;  3ZFZ A;  2A15 A;  3B7C A;  4PEJ A;  3LZA A;  3T0U A;  1DVD A;  1AVK A;  1V57 A;  1B3S A;  4KVH A;  4NPB A;  3FH1 A;  3CMA 3;  4BTX A;  3DGL A;  2CFG A;  1OUN A;  1Q40 B;  2RSX A;  1JN5 B;  3LTB A;  1D6Z A;  1CYV A;  5JPP A;  1GMP A;  3D5G A;  1FGO A;  1BNG A;  1EG9 B;  1ZO2 A;  1QJG A;  4N6N B;  4FR9 A;  1TP6 A;  4HM0 B;  1BRK A;  3EF8 A;  1TFK A;  1AV4 A;  2BNG A;  3CPW 2;  1T3B A;  1AR0 A;  2CC3 A;  3SX1 A;  3T8U A;  1R4Y A;  2L1S A;  3NXJ A;  1BNR A;  3DXO A;  3I55 3;  1X1X A;  1STF I;  3KSE D;  4BU4 A;  3VGN A;  1K41 A;  3AMO B;  1B2S A;  2GU3 A;  5IEO A;  3GZR A;  1FUS A;  2KF5 A;  1O7G B;  1MWU A;  1UW1 A;  2AAE A;  3BIR A;  3LML A;  3D4A A;  1BRG A;  1YIT 3;  1FZU A;  6GSP A;  1RCL A;  1QAF A;  5M1A A;  1M1X B;  4IPB A;  1PYL A;  3V92 A;  3WOF B;  3EX9 A;  3CCE 3;  1W6G A;  4LSO A;  1OCV A;  5STD A;  1PY3 A;  5FW5 A;  1N8Q A;  1VQN 3;  1HYF A;  5AYS C;  1RDS A;  2F4Y A;  3BLZ A;  3NBJ A;  1B27 A;  3CPO A;  1A90 A;  5GSP A;  4OK0 A;  3HI7 A;  3FCS B;  3UL6 A;  2W04 A;  1MGR A;  1Y4K A;  3F8X A;  3AGO A;  1FYS A;  1UGH I;  2LYX A;  2P0M A;  3KKG A;  5BVB A;  4FCZ A;  1TU5 A;  1LNI A;  3JVC A;  2YX9 A;  4HM5 B;  1VQ7 3;  3RNT A;  2CHC A;  2W9P A;  3NQY A;  1WMN A;  2CH9 A;  2XEP A;  1SJW A;  3RDE A;  1MNL A;  1OGZ A;  4O02 B;  4EV2 A;  1GYB A;  2W2C A;  3X40 A;  1BSE A;  1JBT A;  3FF0 A;  4R1K A;  1MWT A;  8CHO A;  4N6M A;  5FGO A;  3URP A;  1C7H A;  1D6U A;  2SBL A;  1VQ6 3;  2UUG C;  3GSP A;  2CX1 A;  3SXX A;  1BSA A;  1NDO B;  5IF6 A;  4LGQ A;  3NV0 B;  4HOH A;  3GAX A;  4HZ9 B;  2OTJ 3;  1IYY A;  1VQK 3;  3G8Z A;  1YGE A;  3OXA A;  5TGN A;  1VQ8 3;  3PS8 A;  4OVM A;  4AKY A;  1VQM 3;  3K7C A;  3HII A;  2ZL8 A;  1RN7 A;  5KP4 A;  3FGY A;  3MSO A;  3O8Y A;  5AIF A;  1SQW A;  2Z77 A;  1BSD A;  5AEW B;  3V98 A;  3B4P A;  3LTD A;  1NO3 A;  2WGO A;  1BU4 A;  1JRQ A;  1Q40 A;  3H51 A;  3H3H A;  1HKX A;  2IMJ A;  4L8O A;  2FNQ A;  1ROV A;  1TUH A;  1V74 A;  3I56 3;  3Q90 A;  4KFF A;  1O7P B;  3CCQ 3;  4H3U A;  2Z7A A;  1IVV A;  1GOU A;  1M9G A;  2CKF B;  2O9U X;  2UGI A;  4FMB A;  3LT9 A;  2PNC A;  2H0G A;  2FGT A;  1GD4 A;  2XSH B;  3JUM A;  1IU7 A;  3GZX B;  5EQL A;  1VQP 3;  4N6U A;  1QAK A;  3AGN A;  3CNX A;  1ASK A;  4XB5 A;  3G6E 3;  1JNQ A;  4J5G A;  1CYU A;  4HVN A;  5BIR A;  1SII A;  4QWT A;  1A67 A;  2O3O A;  2RNT A;  1Q86 4;  3F7X A;  2HMM B;  3JUO A;  5BU4 A;  1KD1 4;  1YIJ 3;  1A2V A;  4H61 A;  1RGL A;  1I70 A;  2BT3 A;  3WHO A;  1X1U A;  2KRT A;  3OW2 2;  3PCR A;  4TX4 A;  4ORL A;  2LQV A;  4JF8 A;  2E2T A;  1SIH A;  1UCI A;  7STD A;  4RZM A;  2GBW B;  3AHW A;  1W7C A;  1EA2 A;  1K73 4;  4RNZ A;  3OWY A;  1F8N A;  5I97 A;  1TTO A;  5DRV A;  3CME 3;  2OQE A;  3DH2 A;  5JPU A;  1RGA A;  1VQ4 3;  3FG3 A;  3JUN A;  5AIG A;  1N5P A;  4X2O A;  1RGE A;  1UUG B;  2YFJ B;  1US1 A;  4BTW A;  1OAC A;  3UJM A;  1DMN A;  1FUW A;  1JJ2 2;  4KFE A;  1O7M B;  3X3X A;  1TIJ A;  1N9E A;  1U5O A;  2C4B A;  2CK3 H;  2KAA A;  3EE1 A;  3EN8 A;  3EJV A;  3PXM A;  1BNI A;  3X41 A;  3OV4 A;  2RGQ A;  3SOY A;  3HZP A;  3F8H A;  2GSP A;  2V1L A;  1OH0 A;  4XBT A;  1QVG 2;  3KSP A;  2QA4 3;  4G1M B;  1W6C A;  4RNY A;  1KQS 2;  3X3Y A;  3E99 A;  5D82 A;  3NV0 A;  1HZ1 A;  2HMO B;  2Q07 A;  2XF3 A;  1W4N A;  4WHA A;  2KF3 A;  3UB1 A;  1VQ9 3;  4EBG A;  4FMA A;  5M19 A;  2OCT A;  3S28 A;  3GZB A;  1YVB I;  3FF2 A;  2GEX A;  3G16 A;  3GZY B;  3N8B A;  1DET A;  3UL5 A;  1FW7 A;  5IW9 A;  2I9W A;  3QRD A;  1UGI A;  1W5Z A;  3CNM A;  2MF7 A;  3LT8 A;  3Q1C A;  3TDG A;  4IT7 A;  1RHL A;  4XDV A;  3V99 A;  1GMQ A;  1S5A A;  1BSC A;  1X1W A;  3EB8 A;  1LOY A;  1BGS A;  1G96 A;  1GD3 A;  1TRQ A;  1Q82 4;  3X42 A;  4EXR A;  4N6O B;  1RN1 A;  1IT8 A;  3U1W A;  5G1K A;  1RGF A;  4HJL B;  1BNS A;  4CDL A;  3LTC A;  1OHP A;  4J9A A;  1YGW A;  2WGQ A;  5G1L A;  2IUJ A;  5KP1 A;  1OPY A;  1RGK A;  2W9Q A;  4WYK B;  1BUQ A;  1JKG B;  2J8X B;  3Q3F A;  4BL2 A;  2H0H A;  4BTY A;  3HIG A;  3CC2 3;  1R4C A;  4N6V 0;  1L5G B;  1B2U A;  1IVX A;  3A5E A;  1MWR A;  4HBR A;  1G0T A;  2HML B;  1WNH A;  3MG2 A;  3ZG5 A;  3NHX A;  1BRJ A;  4L8P A;  3BNC A;  4HAA A;  1RKY A;  1O7N B;  1NWW A;  1K9M 4;  2W56 A;  1VQL 3;  1Q42 A;  2P0X A;  1ZX2 A;  4N3V A;  2B24 B;  6STD A;  1FGR A;  2ZDJ A;  1M1K 4;  1PFP A;  1CQS A;  2AAD A;  3MG3 A;  4MMZ B;  1UCL A;  1UUW B;  1SPU A;  1AVL A;  3F7S A;  5CLK A;  5AYR B;  3ER7 A;  3MYT A;  4CJN A;  2F5W A;  1GS3 A;  1GOY A;  1K28 A;  1LVN A;  3NBB A;  1LOV A;  4J5K A;  1B2Z A;  1UI8 A;  2P05 A;  4CCV A;  4OUQ A;  4EV5 A;  1QMA A;  2CIU A;  3I0Y A;  2OOV A;  6RNT A;  3NM2 A;  1T2I A;  1M90 4;  1I2F A;  1LQM B;  2BHM A;  1VQO 3;  2YFI B;  3N54 B;  1Q9E A;  1RSN A;  4LYL B;  1RNT A;  1BNE A;  1B2M A;  1IV7 A;  2MC8 A;  3S29 A;  2W6J H;  3IJE B;  1YNV X;  4AKZ A;  2RCD A;  5AII A;  2IUK A;  1JN5 A;  4EW5 A;  1I2E A;  4R9L A;  1W2B 2;  1UCJ A;  1I0X A;  1B2X A;  4WFO A;  3BNB A;  2CG0 A;  3IMA B;  2IYJ A;  1IQ8 A;  3KZT A;  1RRL A;  1A2P A;  1TJD A;  3VF1 A;  1RCK A;  5RNT A;  4ILF A;  2OTL 3;  3FSD A;  1KSI A;  3CCL 3;  5EVH A;  3G71 3;  2CFW A;  1EQK A;  2GBX B;  4FCJ A;  2BMR B;  2CG1 A;  1Q81 4;  3AMO A;  3LXU X;  3RGR A;  4FMD A;  4GHO A;  5LC7 A;  5IG4 A;  5M18 A;  5ELJ A;  4JRF A;  3HK4 A;  5IG3 A;  3SOA A;  2H0I A;  2Z6B A;  4O8S A;  4DKI A;  1PU4 A;  1IT7 A;  3T8N A;  3DUK A;  2CWT A;  4NHF A;  1ULJ B;  2CX0 A;  3SVA A;  3JUP A;  1C54 A;  1ISK A;  2IA7 A;  1JKG A;  3WOD G;  5HOH A;  2CFK A;  2ZA4 A;  3SLU A;  1BVI A;  1JBS A;  1GSP A;  1YVS A;  3OWU A;  4K1U A;  2IY2 A;  1TRP A;  1W2Z A;  1V58 A;  2F98 A;  3DMC A;  3F14 A;  1JB5 A;  5AEU B;  4HM4 B;  3IPT A;  4K1V A;  2XGN A;  3EC9 A;  3SYU A;  4STD A;  3K0Z A;  3LTA A;  2BMO B;  1W01 A;  2UX0 A;  3KE7 A;  4IIA A;  2Z76 A;  4HKV B;  3PYJ A;  4BIR A;  1BAN A;  3G4S 3;  4ZM8 A;  2BU4 A;  3K63 A;  2CWV A;  1LOW A;  4LZI A;  4N6T A;  2OOV C;  4WWU C;  2XH9 A;  4GB5 A;  5ELU A;  5BXQ A;  1MWS A;  1VQQ A;  4HYZ A;  4NRE A;  4RNT A;  1E3V A;  1FGM A;  3B4O A;  1LRA A;  5CF2 A;  4LEH A;  3A76 A;  2BIR A;  3N9H A;  2E2V A;  4HM1 B;  3EN1 B;  4KZ1 A;  1BIR A;  2R4I A;  5CXO A;  3HX8 A;  5D83 A;  9RNT A;  2QEX 3;  4HM3 B;  1LNH A;  3PCS A;  3NM7 A;  4XBY A;  4HM7 B;  2D42 A;  1BRH A;  3SED A;  3D9R A;  4EC6 A;  2M7O A;  1IVW A;  2PZV A;  1UUV B;  1UI7 A;  1UCK A;  1B21 A;  1DMQ A;  1SAR A;  5AI1 A;  4O2H A;  1BUJ A;  3WA3 A;  2CFD A;  3FZW A;  2XFS A;  1DMM A;  2QIY A;  3WOE B;  1FA3 A;  2ML6 A;  2XGL A;  3FG4 A;  3JUQ A;  3X3Z A;  1WMP A;  3OX9 A;  3HOH A;  5IEP A;  2BO9 B;  3LYG A;  4MJD A;  1LQG C;  1EKM A;  3ALA A;  3KCH A;  3NX0 A;  4WP5 A;  4X2H A;  3WR2 A;  2STD A;  3F9S A;  4N6L A;  3QK9 A;  3CCS 3;  2OWP A;  1BAO A;  2K0M A;  1NB5 I;  3EQQ B;  3GWR A;  1W02 A;  2GEY A;  2WOF A;  3EBY A;  1N9J A;  4XDW A;  1GY5 A;  4U13 A;  4MMX B;  1I3F A;  1JB4 A;  1O7W B;  3BNE A;  1EUI C;  3FLJ A;  5LC6 A;  3MG1 A;  1MGW A;  2XRX B;  2YFL B;  2CFL A;  3DZL A; 
#chains in the Genus database with same CATH homology
 2P38 A;  5CK6 A;  1TFO A;  5D81 A;  3FG1 A;  1OGX A;  3ECF A;  2OQE C;  3CCV 3;  3VSY A;  3WMD A;  1LXE A;  5KP3 A;  5IG5 A;  4HM6 B;  3DY5 A;  2F99 A;  3MKI A;  3PZW A;  2HMJ B;  2GXF A;  2B1X B;  3CCM 3;  4MMY B;  3M8C A;  5DRE A;  1NU3 A;  5IG0 A;  3NUV A;  1W6Y A;  2INX A;  2KXG A;  1OHS A;  1JB2 A;  1A2K A;  4J8T A;  1E97 A;  3D3L A;  1OF5 B;  2WOH A;  3CCJ 3;  2HMK B;  2JQ5 A;  4FMC A;  4I4K A;  3DM8 A;  1W00 A;  1Z1S A;  1IQY A;  2JDI H;  5A0O B;  2W0Q A;  3CCR 3;  2XFT A;  1N5H A;  2CW9 A;  1ROA A;  2Y73 A;  1VQ5 3;  3NBR A;  4HM2 B;  3CXC 2;  4AEQ A;  4R4K A;  4HZB B;  3Q2P A;  1K8A 4;  2QGU A;  1YJ9 3;  3K9M C;  3KFQ C;  4L7K A;  1NJI 4;  5HGR A;  3S5C A;  1JV2 B;  2KCD A;  1OHO A;  4KFD A;  3B8L A;  3RGA A;  1YJN 3;  3STD A;  1T5Y A;  1MOL A;  1S72 3;  3G0K A;  1J2B A;  3MHE A;  3J7Y d;  5JBS A;  3CCU 3;  1E3R A;  1GY7 A;  1O7H B;  5IEN A;  3F40 A;  2RFR A;  1IK3 A;  1D6Y A;  2K54 A;  2WO0 A;  2BMQ B;  3CC4 3;  1RJO A;  5AIH A;  4K61 A;  2FXT A;  3BND A;  3CU3 A;  2D1W A;  3CD6 3;  1RRH A;  3GRD A;  1Q7Y 4;  3FKA A;  4RBN A;  5CF1 A;  5G2G A;  1YJW 3;  1FGT A;  1KC8 4;  1IDP A;  2C11 A;  3K5T A;  2L4V A;  1WQL B;  4FCM A;  3UNL A;  2CWU A;  1ULI B;  3LOY A;  3KII A;  3MWZ A;  1YI2 3;  4WYK A;  1WMO A;  1U8C B;  1YHQ 3;  2ML5 A;  3S67 A;  1CEW I;  4R9K A;  4XBX A;  5EEO A;  2C10 A;  3BB9 A;  1HU9 A;  4R80 A;  1KWI A;  1IVU A;  3DGM A;  4EYC A;  4LMI A;  1FGQ A;  1VZZ A;  2P09 A;  4Q53 A;  4MEI A;  1IQX A;  3EHC A;  3WA2 X;  2W56 B;  1STD A;  4K90 B;  3CC7 3;  3L0R A;  3OWS A;  3DGO A;  2E2U A;  2XR8 B;  3DGN A;  3S27 A;  3KN4 A;  1LOX A;  2GU1 A;  1DYU A;  1NB3 I;  1OF5 A;  2HMN B;  1N8R 4;  1DVC A;  1QAL A;  3LH4 A;  1QVF 2;  4HM8 B;  3EBT A;  4GL6 A;  4O3V A;  1WTH A;  1IV9 A;  1GY6 A;  4XM4 A;  2F86 B;  2W03 A;  3NQZ A;  5IER A;  3MPH A;  2XSO B;  3PGB A;  2Y74 A;  3ROB A;  3WDG B;  2A15 A;  3B7C A;  4PEJ A;  3LZA A;  3T0U A;  1DVD A;  1AVK A;  4KVH A;  3CMA 3;  3FH1 A;  4BTX A;  3DGL A;  2CFG A;  1OUN A;  1Q40 B;  2RSX A;  1JN5 B;  3LTB A;  1D6Z A;  1CYV A;  5JPP A;  1FGO A;  1EG9 B;  1ZO2 A;  1QJG A;  4N6N B;  4FR9 A;  1TP6 A;  4HM0 B;  3EF8 A;  1TFK A;  1AV4 A;  2BNG A;  3CPW 2;  1AR0 A;  2CC3 A;  3SX1 A;  3T8U A;  3NXJ A;  3DXO A;  3I55 3;  1STF I;  3KSE D;  3VGN A;  1K41 A;  3AMO B;  2GU3 A;  5IEO A;  3GZR A;  3LML A;  1O7G B;  1UW1 A;  1YIT 3;  1QAF A;  3V92 A;  1M1X B;  4IPB A;  3WOF B;  3CCE 3;  3EX9 A;  1W6G A;  4LSO A;  1OCV A;  5STD A;  5FW5 A;  1N8Q A;  1VQN 3;  5AYS C;  3BLZ A;  3NBJ A;  3CPO A;  1A90 A;  4OK0 A;  3HI7 A;  3FCS B;  3UL6 A;  2W04 A;  1Y4K A;  3F8X A;  2LYX A;  2P0M A;  3KKG A;  4FCZ A;  1TU5 A;  3JVC A;  2YX9 A;  4HM5 B;  1VQ7 3;  2CHC A;  2W9P A;  3NQY A;  1WMN A;  2CH9 A;  2XEP A;  1SJW A;  3RDE A;  1MNL A;  1OGZ A;  4O02 B;  4EV2 A;  1GYB A;  2W2C A;  3X40 A;  3FF0 A;  4R1K A;  8CHO A;  4N6M A;  5FGO A;  1C7H A;  1D6U A;  2SBL A;  1VQ6 3;  3SXX A;  5IF6 A;  1NDO B;  4LGQ A;  3NV0 B;  2OTJ 3;  3GAX A;  4HZ9 B;  1VQK 3;  3G8Z A;  1YGE A;  3OXA A;  5TGN A;  1VQ8 3;  3PS8 A;  4AKY A;  1VQM 3;  3K7C A;  3HII A;  2ZL8 A;  1RN7 A;  5KP4 A;  3FGY A;  3MSO A;  3O8Y A;  5AIF A;  1SQW A;  2Z77 A;  5AEW B;  3V98 A;  3B4P A;  3LTD A;  1NO3 A;  2WGO A;  1JRQ A;  1Q40 A;  3H51 A;  3H3H A;  1HKX A;  2IMJ A;  4L8O A;  2FNQ A;  1ROV A;  1TUH A;  1V74 A;  3I56 3;  3Q90 A;  4KFF A;  1O7P B;  3CCQ 3;  4H3U A;  2Z7A A;  1IVV A;  2CKF B;  1M9G A;  4FMB A;  2O9U X;  3LT9 A;  2PNC A;  2FGT A;  1GD4 A;  2XSH B;  3JUM A;  1IU7 A;  3GZX B;  5EQL A;  1VQP 3;  4N6U A;  1QAK A;  3CNX A;  1ASK A;  4XB5 A;  3G6E 3;  1JNQ A;  1CYU A;  4HVN A;  1SII A;  4QWT A;  1A67 A;  2O3O A;  1Q86 4;  3F7X A;  2HMM B;  3JUO A;  1KD1 4;  1YIJ 3;  1A2V A;  4H61 A;  2BT3 A;  2KRT A;  3OW2 2;  3PCR A;  4TX4 A;  4ORL A;  2LQV A;  4JF8 A;  2E2T A;  1SIH A;  7STD A;  4RZM A;  2GBW B;  1W7C A;  1EA2 A;  1K73 4;  4RNZ A;  3OWY A;  1F8N A;  5I97 A;  5DRV A;  3CME 3;  2OQE A;  5JPU A;  1VQ4 3;  3FG3 A;  3JUN A;  5AIG A;  1N5P A;  4X2O A;  2YFJ B;  1US1 A;  4BTW A;  1OAC A;  3UJM A;  1DMN A;  1FUW A;  1JJ2 2;  4KFE A;  1O7M B;  3X3X A;  1TIJ A;  1N9E A;  1U5O A;  2CK3 H;  3EE1 A;  3EN8 A;  3U97 A;  5BVB A;  3EJV A;  3PXM A;  3X41 A;  3OV4 A;  2RGQ A;  3SOY A;  3HZP A;  3F8H A;  2V1L A;  1OH0 A;  4XBT A;  1QVG 2;  3KSP A;  2QA4 3;  4G1M B;  1W6C A;  4RNY A;  1KQS 2;  3X3Y A;  3E99 A;  5D82 A;  3NV0 A;  2HMO B;  2Q07 A;  2XF3 A;  1W4N A;  4WHA A;  3UB1 A;  1VQ9 3;  4EBG A;  4FMA A;  2OCT A;  3S28 A;  3GZB A;  1YVB I;  3FF2 A;  2GEX A;  3G16 A;  3GZY B;  3N8B A;  3UL5 A;  5IW9 A;  2I9W A;  3QRD A;  1W5Z A;  3LT8 A;  3CNM A;  2MF7 A;  3Q1C A;  3TDG A;  4IT7 A;  4XDV A;  3V99 A;  1S5A A;  3EB8 A;  1G96 A;  1GD3 A;  1Q82 4;  3X42 A;  4EXR A;  4N6O B;  1IT8 A;  3U1W A;  4HJL B;  4CDL A;  3LTC A;  1OHP A;  4J9A A;  2WGQ A;  2IUJ A;  5KP1 A;  1OPY A;  2W9Q A;  4WYK B;  1BUQ A;  1JKG B;  4BTY A;  3HIG A;  3CC2 3;  1R4C A;  4N6V 0;  1L5G B;  1IVX A;  4HBR A;  2HML B;  1WNH A;  3MG2 A;  3NHX A;  4L8P A;  3BNC A;  1RKY A;  1K9M 4;  1O7N B;  1NWW A;  1VQL 3;  2W56 A;  1Q42 A;  2P0X A;  1ZX2 A;  4N3V A;  2B24 B;  6STD A;  1FGR A;  2ZDJ A;  1M1K 4;  1PFP A;  1CQS A;  3MG3 A;  4MMZ B;  1UUW B;  1SPU A;  1AVL A;  3F7S A;  5CLK A;  5AYR B;  3ER7 A;  3MYT A;  1GS3 A;  1LVN A;  1K28 A;  3NBB A;  1UI8 A;  2P05 A;  4CCV A;  4OUQ A;  4EV5 A;  1QMA A;  2CIU A;  3I0Y A;  2OOV A;  1M90 4;  3NM2 A;  2BHM A;  1VQO 3;  2YFI B;  3N54 B;  1IV7 A;  2MC8 A;  3S29 A;  2W6J H;  3IJE B;  4AKZ A;  2RCD A;  5AII A;  2IUK A;  1JN5 A;  4R9L A;  1W2B 2;  4WFO A;  3BNB A;  2CG0 A;  3IMA B;  1IQ8 A;  3KZT A;  1RRL A;  3VF1 A;  2OTL 3;  3FSD A;  1KSI A;  3CCL 3;  5EVH A;  3G71 3;  2CFW A;  1EQK A;  2GBX B;  4FCJ A;  2BMR B;  1Q81 4;  3AMO A;  3LXU X;  3RGR A;  4FMD A;  5IG4 A;  5LC7 A;  5ELJ A;  4JRF A;  3HK4 A;  5IG3 A;  3SOA A;  2Z6B A;  4O8S A;  1PU4 A;  1IT7 A;  3T8N A;  3DUK A;  2CWT A;  4NHF A;  1ULJ B;  3SVA A;  3JUP A;  1ISK A;  2IA7 A;  1JKG A;  3WOD G;  2CFK A;  3SLU A;  3OWU A;  4K1U A;  1W2Z A;  2F98 A;  3DMC A;  3F14 A;  5AEU B;  1JB5 A;  4HM4 B;  3IPT A;  4K1V A;  2XGN A;  3EC9 A;  4STD A;  3K0Z A;  3LTA A;  2BMO B;  1W01 A;  2UX0 A;  3KE7 A;  4IIA A;  2Z76 A;  4HKV B;  3PYJ A;  3G4S 3;  4ZM8 A;  3K63 A;  4N6T A;  2CWV A;  4LZI A;  4WWU C;  2OOV C;  2XH9 A;  4GB5 A;  5ELU A;  5BXQ A;  4HYZ A;  4NRE A;  1E3V A;  1FGM A;  3B4O A;  5CF2 A;  4LEH A;  3A76 A;  4HM1 B;  3N9H A;  2E2V A;  4KZ1 A;  3EN1 B;  4OVM A;  5CXO A;  2R4I A;  5D83 A;  3HX8 A;  2CG1 A;  2QEX 3;  4HM3 B;  1LNH A;  3PCS A;  3NM7 A;  4XBY A;  4HM7 B;  2D42 A;  3SED A;  3D9R A;  4EC6 A;  2M7O A;  1IVW A;  2PZV A;  1UUV B;  1UI7 A;  1DMQ A;  5AI1 A;  4O2H A;  3WA3 A;  2CFD A;  3FZW A;  2XFS A;  1DMM A;  2QIY A;  3WOE B;  1FA3 A;  2ML6 A;  2XGL A;  3FG4 A;  3JUQ A;  3X3Z A;  1WMP A;  3OX9 A;  5IEP A;  2BO9 B;  3LYG A;  4MJD A;  1EKM A;  3ALA A;  3NX0 A;  4WP5 A;  4X2H A;  2STD A;  3F9S A;  4N6L A;  3QK9 A;  3CCS 3;  2OWP A;  2K0M A;  1NB5 I;  3EQQ B;  3GWR A;  1W02 A;  2WOF A;  2GEY A;  3EBY A;  1N9J A;  4XDW A;  1GY5 A;  4U13 A;  4MMX B;  1JB4 A;  1O7W B;  3BNE A;  3FLJ A;  5LC6 A;  3MG1 A;  2XRX B;  2YFL B;  2CFL A;  3DZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...