2GXFA

X-ray crystal structure of protein yybh from bacillus subtilis. northeast structural genomics consortium target sr506.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
128
structure length
119
Chain Sequence
MEQQLKDIISACDLAIQNEDFDTLMNYYSEDAVLVVKPGMIARGKEEIKKAFITIANYFNHHIVPTQGKMILLEAGDTVLVLSQTLLDMERRATYVFKKNAQGEWLCVIDNSYGTDLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Hypothetical Protein YybH from Bacillus subtilis, Northeast Structural Genomics Target SR506
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yybH
total genus 27
structure length 119
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13474 SnoaL_3 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gxfA00
3H3HA 3BLZA 4XBXA 3STDA 1A2KA 2K54A 2HMLB 4WP5A 3UJMA 5STDA 2R4IA 2I9WA 1O7PB 3BB9A 3JUPA 4XDWA 8CHOA 2GEXA 1W00A 3ER7A 4XM4A 3GWRA 3HX8A 4R9LA 4R9KA 5CF1A 4HM3B 2HMJB 2Z76A 3CU3A 4MJDA 1OHPA 4OVMA 1W6YA 4K1UA 5IERA 1DMQA 4GB5A 3MG1A 1U5OA 5KP4A 1ZX2A 4WYKA 5DRVA 1E97A 3SEDA 2YFLB 1JKGA 3FGYA 4LEHA 4PEJA 5BVBA 1GY5A 2F98A 3EQQB 3EBTA 3FH1A 3G8ZA 1ZO2A 1OH0A 3LYGA 3RGRA 1ULIB 3GZBA 5CK6A 4HM5B 3MKIA 4HVNA 1NU3A 3MG2A 3VSYA 4XBTA 1O7NB 4HM0B 2OWPA 3CPOA 1UUWB 3B4OA 4IIAA 2IMJA 3FKAA 3MG3A 1DMNA 1AR0A 5TGNA 2UX0A 2A15A 3NV0A 3ROBA 2RGQA 1CQSA 1DMMA 1OPYA 3F8HA 1O7GB 3JUQA 4WWUC 2YFIB 1E3RA 1GYBA 3NXJA 4OUQA 3FF0A 4XDVA 3JUNA 3G16A 4HM2B 1JN5B 1GS3A 1ASKA 3KZTA 1Q40B 4HM8B 2QGUA 1ULJB 2F99A 2PZVA 5FW5A 5IEOA 1K41A 1STDA 3FF2A 1NDOB 5BXQA 4HZBB 2XSOB 5AI1A 5AIFA 3VGNA 3JUMA 2YFJB 4XB5A 1HKXA 5AEWB 5KP3A 3B7CA 4X2HA 4Q53A 3EHCA 3OX9A 1Z1SA 3DM8A 3EF8A 3F14A 3KSPA 3OXAA 4HZ9B 5IENA 1BUQA 3H51A 7STDA 3T8UA 5CF2A 5IG4A 1VZZA 5AIGA 5AEUB 3EJVA 1E3VA 2Z7AA 2XRXB 1OF5B 4HM6B 4J9AA 3LZAA 5AIHA 4CDLA 5IG3A 3F40A 2CHCA 5IG0A 3RGAA 1OGZA 2B24B 2RCDA 4ORLA 1OHSA 2XSHB 1JKGB 5EVHA 3SOYA 2W2CA 3F7XA 1SJWA 5D82A 3SOAA 3OWYA 3DUKA 3JUOA 4RZMA 4N3VA 3KKGA 3FZWA 3EN8A 4U13A 1QMAA 3B8LA 3GRDA 3CNMA 4H3UA 3Q90A 5DREA 1IDPA 2BMOB 1TUHA 3GZXB 3NUVA 5HGRA 5KP1A 2HMMB 1GY6A 2BMQB 1O7WB 5D81A 3UNLA 1EA2A 4HM4B 3NV0B 1OGXA 5CXOA 2HMOB 3OV4A 3T8NA 1OCVA 3MYTA 5CLKA 6STDA 2GBWB 1NWWA 1W02A 2STDA 4R1KA 3HZPA 4I4KA 5IEPA 3EX9A 3KE7A 1JN5A 3DZLA 3ECFA 3M8CA 1Q40A 3B4PA 3DXOA 3F9SA 3CNXA 3FSDA 4HJLB 3K0ZA 3G0KA 1Q42A 2CKFB 2XR8B 3FLJA 3NM2A 1JB4A 2Z77A 3EC9A 4L8OA 1C7HA 3MHEA 1GY7A 2B1XB 4K1VA 2GEYA 1EG9B 2RFRA 4WYKB 4FCJA 4L7KA 3OWUA 2QIYA 5G2GA 3NBRA 3EN1B 5JPUA 3WMDA 1JB2A 1OUNA 1ISKA 3K7CA 1S5AA 2HMKB 1WQLB 2BNGA 5IF6A 2INXA 1UUVB 2JQ5A 3GZRA 3IPTA 1O7MB 3DMCA 3NHXA 1O7HB 4HM7B 1JB5A 4FCMA 1OF5A 4XBYA 4KVHA 3MSOA 1TP6A 3HK4A 3F8XA 5JPPA 4L8PA 2BMRB 3GZYB 1OHOA 3I0YA 3E99A 5D83A 4HKVB 5IG5A 3S5CA 2F86B 3D9RA 3EBYA 4HM1B 2GXFA 2GBXB 3A76A 2HMNB 4LGQA 4STDA 1QJGA 4LMIA 1W01A 4X2OA 5AIIA 4J8TA 3F7SA 3OWSA
chains in the Genus database with same CATH superfamily
3H3HA 4N6MA 3STDA 2K54A 2HMLB 4JF8A 1UI7A 3CCJ3 1SARA 3BB9A 1O7PB 4EV2A 2GEXA 1VQ73 4H61A 1UCJA 4R9LA 4R9KA 3I553 2AADA 3L0RA 1FUSA 4FR9A 4HM3B 3CU3A 4MJDA 1MGRA 4RBNA 4K1UA 1I2EA 1Q864 3SEDA 1E97A 2FNQA 1JKGA 4PEJA 5BVBA 1WTHA 2BU4A 2F98A 3EBTA 3EQQB 3UL5A 1BSBA 1BAOA 2C10A 1WMNA 2H0HA 3CCM3 4KFEA 5JBSA 4LZIA 1O7NB 4HM0B 3CPOA 1UUWB 2V1LA 3B4OA 5GSPA 1MWUA 2XEPA 1I2GA 1QAKA 2RGQA 1OPYA 3S27A 1A2VA 2AAEA 1O7GB 3WOEB 1YI23 1LNHA 2E2UA 4N6LA 4XDVA 1B2XA 3BIRA 2PNCA 1K734 3KZTA 4DKIA 3V98A 1STFI 1K41A 3TDGA 2XGLA 1NDOB 1RRHA 1WNHA 3DGNA 1FGOA 3BNCA 3JUMA 3Q3FA 1B2SA 5KP3A 3EHCA 5IENA 1UGIA 3DM8A 1NB3I 3F14A 1BUQA 1M9GA 2C4BA 1Q9EA 2XFSA 7STDA 2W9PA 1RGFA 1VZZA 5AIGA 1YHQ3 2XRXB 1OF5B 2Y73A 4HM6B 4AEQA 2OQEC 2KCDA 1TIJA 2FXTA 1OGZA 2B24B 3PGBA 4EV5A 3AMOA 4IPBA 3G6E3 1ZS7A 2XSHB 3T0UA 1AQZA 3F7XA 3PS8A 1SJWA 4CPKA 1ROAA 4RZMA 1HU9A 2WGQA 3KKGA 1GSPA 3BNBA 1KQS2 3B8LA 1MNLA 3S29A 1YIT3 5A0OB 5BIRA 5KP1A 2CG0A 2HMMB 1EEJA 2BMQB 2KF4A 4N6TA 3DGLA 3GSPA 2P38A 1GD3A 3LT8A 4HM4B 1AVKA 3CCQ3 1WMOA 2HMOB 1VQK3 3T8NA 2GBWB 2KXGA 5EQLA 3EX9A 1VQO3 2RNTA 1FUWA 2KF5A 1JN5A 1B20A 1IQYA 1G0TA 3KSED 3DGYA 3DXOA 4HJLB 4ORLA 2KAAA 1B2UA 1X1UA 3D4AA 1YGEA 3FLJA 2P05A 3NM2A 1JB4A 2Z77A 3EC9A 4L8OA 1C7HA 2CX1A 1B3SA 1GY7A 2B1XB 3LXUX 3IJEB 4K1VA 3RGRA 1ISKA 1U8CB 1GMQA 3D79A 3HOHA 3K7CA 3DH2A 1WQLB 3U1WA 1B21A 4LSOA 2INXA 3LTCA 1DE3A 1JZDA 3NHXA 1O7HB 3LH4A 4FCMA 2F5WA 4XBYA 3MSOA 1FW7A 4KFFA 3SLUA 1VQ53 1BRSA 3GZYB 3RNTA 3U97A 1IYYA 3URPA 3AGNA 1I8VA 3D9RA 3AHWA 2P0XA 2GXFA 1IK3A 1SQWA 4STDA 2D1WA 4GHOA 1T3BA 1ZGXA 3OWSA 1RGKA 4XBXA 2CFDA 5BU4A 1IU7A 1RMSA 3V99A 4I5QA 3JUPA 2I9WA 3LTBA 4XDWA 4AKZA 1S723 1A90A 1RNBA 3MPHA 1RKYA 3GWRA 3KCHA 1MGWA 1RJOA 1IT7A 3NBBA 3NX0A 1LVNA 4EC6A 3PCSA 2OOVA 1FGQA 3D5GA 1L5GB 5IERA 1FYSA 1OACA 1W7CA 3DGOA 4KFDA 3N8BA 2L4VA 1LOWA 4WYKA 5M1AA 3SVAA 1EKMA 1HZ1A 4LEHA 1W5ZA 3PXMA 5IG4A 3ZFZA 3G8ZA 3FH1A 1Q814 1BNFA 1BRHA 3IMAB 3LYGA 2ML5A 1ULIB 1RHLA 3CXC2 4HVNA 5LC7A 3FG3A 3HIIA 3MG2A 1TFOA 1YGWA 4XBTA 3WODG 4IIAA 2KF3A 1DETA 1BU4A 1DMNA 3MG3A 4FCZA 2UX0A 2A15A 2W03A 3NQZA 1GMRA 4NPBA 1GOYA 3JUQA 1D6YA 1GOUA 1E3RA 4OUQA 2Q07A 1I2FA 4FMCA 3G16A 4HYZA 1JN5B 3CCE3 2QGUA 2F99A 1IVWA 1K8A4 1B2MA 5AIFA 1UW1A 4N6UA 1Q7Y4 3O8YA 4G1MB 4MMZB 1I3FA 1CEWI 1NJI4 2OTL3 3B7CA 1B2ZA 3A5EA 4X2HA 3KSPA 3N54B 3NBJA 1FUTA 1TU5A 1JBRA 3T8UA 5CF2A 3EB8A 2OOVC 1UGHI 4O8SA 2Z7AA 3K63A 1YJN3 2H0GA 3ALAA 4BL3A 2CHCA 1YVSA 3RGAA 1RN4A 3NM7A 1V74A 2O3OA 2RCDA 1W6GA 2CIUA 4K90B 3SOYA 2W2CA 2K0MA 1JRQA 5D82A 3JUOA 1VQP3 4NHFA 4N3VA 3FZWA 4U13A 1QMAA 2SBLA 3CNMA 2CWTA 4HBRA 4GL6A 5DREA 1IDPA 2BMOB 3GZXB 3LTAA 1R4CA 1GY6A 3CCS3 1EQKA 2UGIA 1HYFA 1BSAA 2XF3A 3NV0B 1OGXA 1IVVA 4RNTA 2UUGC 3MYTA 3AHSA 1N8R4 4I4KA 1VQM3 1Q824 3UB1A 1RGLA 1IQ8A 3ECFA 3WA3A 1Q40A 3F9SA 2QEX3 3CCR3 3CNXA 5G1KA 3G0KA 1Q42A 1TRPA 3CCU3 2ML6A 4O3VA 4RNZA 2CC3A 3Q1CA 1VQQA 4WYKB 2LYXA 4J5KA 1RGGA 4L7KA 1M904 3ZG5A 3EN1B 3WMDA 1RCLA 2XH9A 2CW9A 3LOYA 4J5GA 2IA7A 2IY2A 4FMBA 2LQVA 2W04A 1I3IA 2BNGA 1CYUA 3IPTA 1UUVB 2CWUA 2F4YA 1KSIA 2JQ5A 1R4YA 3GZRA 2CK3H 5I97A 3DMCA 4R80A 1RNTA 5EEOA 1YJW3 4HAAA 2H0IA 4KVHA 3OW22 5JPPA 1GMPA 1KWIA 1T2HA 2BMRB 1OHOA 3E99A 5IG5A 3S5CA 2CWVA 3CCV3 5AYRB 1T2IA 3CC43 3EBYA 1J2BA 1A2PA 2ZA4A 1BOXA 1MWTA 1QJGA 4FMDA 1KC84 1RGAA 3AGOA 3DGMA 1VQ93 2IUJA 1VQ83 3X3XA 1K28A 1V57A 2F56A 3UJMA 2M7OA 1G02A 4GSPA 2CX0A 8CHOA 1W00A 3ER7A 4XM4A 2E2TA 1YVBI 2ZHXB 1C54A 1N8QA 5AYSC 2HMJB 2Z76A 2OTJ3 1VQN3 2RBIA 3FG1A 9RNTA 4OVMA 1N9JA 5RNTA 1UCIA 4KZ1A 1BANA 4LYLB 4IT7A 2JDIH 2P0MA 5KP4A 2C11A 1RGCA 1PYLA 2YFLB 1MWRA 1LOYA 2W6JH 4ILFA 1IV9A 5CK6A 3K5TA 2OWPA 1TTOA 1IVXA 2IMJA 2J8XB 3FKAA 2CH9A 1BSEA 1AR0A 1LXEA 3NV0A 3SX1A 1MOLA 1CQSA 3N9HA 2YFIB 1GYBA 4BTYA 3FF0A 5M19A 1JNQA 4HM2B 3SYUA 1Q40B 1TJDA 3KIIA 2ZDJA 1JV2B 2IUKA 4WFOA 1STDA 3FF2A 4CCVA 1RGHA 4HZBB 2XSOB 5AI1A 2IYJA 3VGNA 2CFLA 3UL6A 2YFJB 1W6CA 4XB5A 3S67A 3HIGA 1LRAA 2OCTA 1RN7A 1US1A 3OX9A 1Z1SA 3EF8A 1PFPA 3OXAA 3WR2A 2BT3A 4N6NB 3J7Yd 4RNYA 2OQEA 2XGNA 1FA3A 1E3VA 4J9AA 1BGSA 3F40A 1BNEA 3CPW2 2Y74A 1D6UA 5EVHA 1OHSA 1PU4A 6GSPA 1FGMA 4TX4A 3DUKA 1IV7A 1X1XA 1X1YA 3KN4A 2MC8A 3EN8A 1BRNL 2GU3A 3GRDA 3KFQC 4H3UA 3X3ZA 3Q90A 4O2HA 3VF1A 1NB5I 3NUVA 5HGRA 1O7WB 3UNLA 1EA2A 1JBSA 2O9UX 4BIRA 5CXOA 3D3LA 1SIIA 3EE1A 3Q2PA 4WHAA 1QALA 3OV4A 3LT9A 4EXRA 2STDA 1NWWA 3PCRA 1BNSA 4R1KA 1FGTA 1WMPA 3X3YA 1RCKA 2E2VA 3KE7A 3DZLA 3M8CA 2W9QA 3FSDA 2ZL8A 4Q53A 6RNTA 3G4S3 3K0ZA 1RRLA 1D6ZA 1KD14 4HOHA 1N5PA 1TRQA 1YIJ3 1LOVA 1EG9B 2P09A 2WO0A 4FCJA 5ELUA 1YJ93 2W0QA 2R41A 3QK9A 1IQXA 1BRGA 1JB2A 1OUNA 2FGTA 1S5AA 3BNEA 2HMKB 1BNJA 5IF6A 1NO3A 2WOFA 1MWSA 1VQ43 2D42A 4HM7B 5ELJA 2MF7A 5M18A 1DVCA 2Z6BA 3DY5A 1TP6A 3GAXA 3F8XA 5FGOA 4N6OB 5IW9A 2BIRA 4L8PA 4K61A 5D83A 1RDSA 3FG4A 1QAFA 4O02B 4HM1B 1CYVA 2W56A 1JZOA 1TFKA 2KF6A 3A76A 1UCLA 4NREA 4X2OA 5AIIA 4J8TA 5LC6A 1IVUA 1BNRA 3BLZA 1A2KA 1UUGB 3NQYA 4WP5A 4BL2A 1BIRA 2R4IA 5STDA 1M1K4 1JBTA 1A67A 1T5YA 3I563 3CMA3 1BUJA 2BO9B 1RLSA 2KRTA 1N9EA 3QRDA 3HX8A 1ROVA 4FMAA 5CF1A 1EUIC 5HOHA 1BVIA 1BNIA 1OHPA 1W6YA 4MEIA 2QA43 1PY3A 1DMQA 4GB5A 3MG1A 1I70A 1U5OA 1ZX2A 5DRVA 1GOVA 3CME3 3FGYA 1LQGC 7GSPA 1GY5A 1ZO2A 1OH0A 3WDGB 3GZBA 1RGEA 4HM5B 3MKIA 3S28A 4ZM8A 1NU3A 3VSYA 4BU4A 1Y4KA 4MMYB 1BRIA 1N5HA 3JVCA 5TGNA 3ROBA 1DMMA 3F8HA 4EYCA 4WWUC 3NXJA 1M1XB 4EW5A 3JUNA 1GS3A 1ASKA 3HI7A 4HM8B 3RDEA 1UDII 1LOXA 1ULJB 2PZVA 4QWTA 5FW5A 1X1WA 5IEOA 2CFGA 2HOHA 1AY7A 3WA2X 2CFWA 5BXQA 3BU4A 1K9M4 2GU1A 4BTWA 1HKXA 5AEWB 3X40A 1CH0A 2L1SA 1V58A 3D5IA 3CD63 4HZ9B 4KT3B 3H51A 1SIHA 1W4NA 5AEUB 3V92A 3EJVA 4CDLA 5IG3A 1BNGA 1F8NA 1BSCA 1W2ZA 3LZAA 5AIHA 3CC23 5IG0A 1LQMB 1BRJA 1DYUA 1JKGB 4MMXB 3SOAA 2W56B 3OWYA 8RNTA 4EBGA 4BTXA 1RTUA 4OK0A 4AKYA 1BRKA 1TUHA 1SPUA 3CC73 3WHOA 1FGRA 5D81A 1JJ22 2GSPA 3CCL3 3LTDA 3X42A 3FCSB 1OCVA 1IT8A 5CLKA 6STDA 1W02A 3X41A 3HZPA 5IEPA 1Q7HA 1NNVA 3B4PA 2SARA 1G96A 1VQ63 2BHMA 2CKFB 1RN1A 2XR8B 3G713 1LNIA 1B27A 3BNDA 3LMLA 2CG1A 3MHEA 3WOFB 3ZG0A 4CJNA 2GEYA 2RFRA 2CFKA 5JPUA 3OWUA 2QIYA 5G2GA 3NBRA 1AVLA 1I0VA 1UI8A 1BSDA 4N6V0 7RNTA 2WOHA 3MWZA 1W2B2 1RSNA 1O7MB 2XFTA 3SXXA 1VQL3 3PYJA 1JB5A 5G1LA 1GD4A 1OF5A 3HK4A 3K9MC 3I0YA 2F5MA 1YNVX 3AMOB 4HKVB 4R4KA 2F86B 2WGOA 2RSXA 2K3DA 1QVF2 2GBXB 2HMNB 4JRFA 4LGQA 1QVG2 4LMIA 1W01A 2YX9A 1DVDA 3PZWA 3F7SA 1AV4A 1UCKA 1I0XA 1FZUA
chains in the Genus database with same CATH topology
3H3HA 4N6MA 3STDA 2K54A 2HMLB 4JF8A 1UI7A 3CCJ3 3BB9A 1O7PB 4EV2A 2GEXA 1VQ73 4H61A 4R9LA 4R9KA 3I553 3L0RA 4FR9A 4HM3B 3CU3A 4MJDA 4RBNA 4K1UA 1Q864 3SEDA 1E97A 2FNQA 1JKGA 4PEJA 5BVBA 1WTHA 2F98A 3EQQB 3EBTA 3UL5A 2C10A 1WMNA 3CCM3 4KFEA 5JBSA 4LZIA 1O7NB 4HM0B 3CPOA 1UUWB 2V1LA 3B4OA 2XEPA 1QAKA 2RGQA 1OPYA 3S27A 1A2VA 1O7GB 3WOEB 1YI23 1LNHA 2E2UA 4N6LA 4XDVA 2PNCA 1K734 3KZTA 3V98A 1STFI 1K41A 3TDGA 2XGLA 1NDOB 1RRHA 1WNHA 3DGNA 1FGOA 3BNCA 3JUMA 5KP3A 3EHCA 5IENA 3DM8A 1NB3I 3F14A 1BUQA 1M9GA 7STDA 2XFSA 2W9PA 1VZZA 5AIGA 1YHQ3 2XRXB 1OF5B 2Y73A 4HM6B 4AEQA 2OQEC 2KCDA 1TIJA 2FXTA 1OGZA 2B24B 3PGBA 4EV5A 3AMOA 4IPBA 3G6E3 3T0UA 2XSHB 3PS8A 3F7XA 1SJWA 1ROAA 4RZMA 1HU9A 2WGQA 3KKGA 1KQS2 3BNBA 3B8LA 1MNLA 3S29A 1YIT3 5A0OB 5KP1A 2CG0A 2HMMB 2BMQB 4N6TA 3DGLA 2P38A 1GD3A 3LT8A 4HM4B 1AVKA 3CCQ3 1WMOA 2HMOB 1VQK3 3T8NA 2GBWB 2KXGA 5EQLA 3EX9A 1VQO3 1FUWA 1JN5A 1IQYA 3KSED 4ORLA 3DXOA 4HJLB 3NM2A 1YGEA 3FLJA 2P05A 1JB4A 2Z77A 3EC9A 4L8OA 1C7HA 4K1VA 1GY7A 2B1XB 3LXUX 3RGRA 3IJEB 1ISKA 1U8CB 3K7CA 3U1WA 1WQLB 4LSOA 2INXA 3LTCA 3NHXA 1O7HB 3LH4A 4FCMA 4XBYA 3MSOA 4KFFA 3SLUA 1VQ53 3GZYB 3U97A 3D9RA 2P0XA 2GXFA 1IK3A 1SQWA 4STDA 2D1WA 3OWSA 4XBXA 2CFDA 1IU7A 3V99A 3JUPA 2I9WA 3LTBA 4XDWA 4AKZA 1S723 1A90A 3MPHA 1RKYA 3GWRA 1RJOA 1IT7A 3NBBA 3NX0A 1LVNA 4EC6A 3PCSA 2OOVA 1FGQA 1L5GB 5IERA 1OACA 1W7CA 3DGOA 4KFDA 3N8BA 2L4VA 4WYKA 3SVAA 1EKMA 4LEHA 1W5ZA 3PXMA 5IG4A 3G8ZA 3FH1A 1Q814 3LYGA 3IMAB 2ML5A 1ULIB 3CXC2 4HVNA 5LC7A 3FG3A 3HIIA 3MG2A 1TFOA 4XBTA 3WODG 4IIAA 3MG3A 1DMNA 4FCZA 2UX0A 2A15A 2W03A 3NQZA 3JUQA 1D6YA 1E3RA 4OUQA 2Q07A 4FMCA 3G16A 4HYZA 1JN5B 3CCE3 2QGUA 2F99A 1IVWA 1K8A4 5AIFA 1UW1A 4N6UA 1Q7Y4 3O8YA 4G1MB 4MMZB 1CEWI 1NJI4 2OTL3 3B7CA 4X2HA 3KSPA 3N54B 3NBJA 1TU5A 3T8UA 5CF2A 3EB8A 2OOVC 4O8SA 2Z7AA 3K63A 1YJN3 3ALAA 2CHCA 3RGAA 3NM7A 1V74A 2O3OA 2RCDA 1W6GA 2CIUA 4K90B 3SOYA 2W2CA 2K0MA 1JRQA 5D82A 3JUOA 1VQP3 4NHFA 4N3VA 3FZWA 4U13A 1QMAA 2SBLA 3CNMA 2CWTA 4HBRA 4GL6A 5DREA 1IDPA 2BMOB 3GZXB 3LTAA 1R4CA 1GY6A 3CCS3 1EQKA 2XF3A 3NV0B 1OGXA 1IVVA 3MYTA 1N8R4 4I4KA 1VQM3 1Q824 3UB1A 1IQ8A 3ECFA 3WA3A 1Q40A 3F9SA 2QEX3 3CCR3 3CNXA 3G0KA 1Q42A 3CCU3 2ML6A 4O3VA 4RNZA 2CC3A 3Q1CA 4WYKB 2LYXA 4L7KA 1M904 3EN1B 3WMDA 2XH9A 2CW9A 3LOYA 2IA7A 4FMBA 2LQVA 2W04A 2BNGA 1CYUA 3IPTA 1UUVB 2CWUA 2JQ5A 1KSIA 3GZRA 5I97A 3G713 2CK3H 3DMCA 4R80A 5EEOA 1YJW3 4KVHA 3OW22 5JPPA 1KWIA 2BMRB 1OHOA 3E99A 5IG5A 3S5CA 2CWVA 3CCV3 5AYRB 3CC43 1J2BA 3EBYA 1QJGA 4FMDA 1KC84 3DGMA 1VQ93 2IUJA 1VQ83 3X3XA 1K28A 3UJMA 2M7OA 8CHOA 1W00A 3ER7A 4XM4A 2E2TA 1YVBI 1N8QA 5AYSC 2HMJB 2Z76A 2OTJ3 1VQN3 3FG1A 4OVMA 1N9JA 4KZ1A 4IT7A 2JDIH 2P0MA 5KP4A 2C11A 2YFLB 2W6JH 1IV9A 5CK6A 3K5TA 2OWPA 1IVXA 2IMJA 3FKAA 2CH9A 1LXEA 1AR0A 3NV0A 3SX1A 1MOLA 1CQSA 3N9HA 2YFIB 1GYBA 4BTYA 3FF0A 1JNQA 4HM2B 1Q40B 3KIIA 2ZDJA 1JV2B 2IUKA 4WFOA 1STDA 3FF2A 4CCVA 4HZBB 2XSOB 5AI1A 3VGNA 2CFLA 3UL6A 2YFJB 1W6CA 4XB5A 3S67A 3HIGA 2OCTA 1RN7A 1US1A 3OX9A 1Z1SA 3EF8A 1PFPA 3OXAA 2BT3A 4N6NB 3J7Yd 4RNYA 2OQEA 2XGNA 1FA3A 1E3VA 4J9AA 3F40A 3CPW2 2Y74A 1D6UA 5EVHA 1OHSA 1PU4A 1FGMA 4TX4A 3DUKA 1IV7A 3KN4A 2MC8A 3EN8A 2GU3A 3GRDA 3KFQC 4H3UA 3X3ZA 3Q90A 4O2HA 3VF1A 1NB5I 3NUVA 5HGRA 1O7WB 3UNLA 1EA2A 2O9UX 4BTWA 5CXOA 3D3LA 1SIIA 3EE1A 3Q2PA 4WHAA 1QALA 3OV4A 3LT9A 4EXRA 2STDA 1NWWA 3PCRA 4R1KA 1FGTA 1WMPA 3X3YA 2E2VA 3KE7A 3DZLA 3M8CA 2W9QA 3FSDA 2ZL8A 4Q53A 3G4S3 3K0ZA 1RRLA 1D6ZA 1KD14 1N5PA 1YIJ3 1EG9B 2P09A 2WO0A 4FCJA 5ELUA 1YJ93 2W0QA 3QK9A 1IQXA 1JB2A 1OUNA 2FGTA 1S5AA 3BNEA 2HMKB 5IF6A 1NO3A 2WOFA 1VQ43 2D42A 4HM7B 5ELJA 2MF7A 1DVCA 2Z6BA 3DY5A 1TP6A 3GAXA 3F8XA 5FGOA 4N6OB 5IW9A 4L8PA 4K61A 5D83A 3FG4A 1QAFA 4O02B 4HM1B 1CYVA 2W56A 1TFKA 3A76A 4NREA 4X2OA 5AIIA 4J8TA 5LC6A 1IVUA 3BLZA 1A2KA 3NQYA 4WP5A 5STDA 2R4IA 1A67A 1M1K4 1T5YA 3I563 3CMA3 2BO9B 2KRTA 1N9EA 3QRDA 3HX8A 1ROVA 4FMAA 5CF1A 1OHPA 1W6YA 4MEIA 2QA43 1DMQA 4GB5A 3MG1A 1U5OA 1ZX2A 5DRVA 3CME3 3FGYA 1GY5A 1ZO2A 1OH0A 3WDGB 3GZBA 4HM5B 3MKIA 3S28A 4ZM8A 1NU3A 3VSYA 1Y4KA 4MMYB 3JVCA 1N5HA 5TGNA 3ROBA 1DMMA 3F8HA 4EYCA 4WWUC 3NXJA 1M1XB 3JUNA 1GS3A 1ASKA 3HI7A 4HM8B 3RDEA 1LOXA 1ULJB 2PZVA 4QWTA 5FW5A 5IEOA 2CFGA 3WA2X 2CFWA 5BXQA 1K9M4 2GU1A 1HKXA 5AEWB 3X40A 3CD63 4HZ9B 3H51A 1SIHA 1W4NA 5AEUB 3V92A 3EJVA 4CDLA 5IG3A 1F8NA 1W2ZA 3LZAA 5AIHA 3CC23 5IG0A 1DYUA 1JKGB 4MMXB 3SOAA 2W56B 3OWYA 4EBGA 4BTXA 4OK0A 4AKYA 1TUHA 1SPUA 1FGRA 5D81A 1JJ22 3CCL3 3LTDA 3X42A 3FCSB 1OCVA 1IT8A 5CLKA 6STDA 1W02A 3X41A 3HZPA 5IEPA 3B4PA 1VQ63 1G96A 2BHMA 2CKFB 2XR8B 3BNDA 2CG1A 3LMLA 3MHEA 3WOFB 2GEYA 2RFRA 2CFKA 5JPUA 3OWUA 2QIYA 5G2GA 3NBRA 1AVLA 1UI8A 4N6V0 2WOHA 3MWZA 1W2B2 1VQL3 1O7MB 2XFTA 3SXXA 3PYJA 1JB5A 1GD4A 1OF5A 3HK4A 3K9MC 3I0YA 3AMOB 4HKVB 4R4KA 2F86B 2WGOA 2RSXA 1QVF2 2GBXB 2HMNB 4JRFA 4LGQA 1QVG2 4LMIA 1W01A 2YX9A 1DVDA 3PZWA 3F7SA 1AV4A 3CC73
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3H A;  3BLZ A;  4XBX A;  3STD A;  1A2K A;  2K54 A;  2HML B;  4WP5 A;  3UJM A;  5STD A;  2R4I A;  2I9W A;  1O7P B;  3BB9 A;  3JUP A;  4XDW A;  8CHO A;  2GEX A;  1W00 A;  3ER7 A;  4XM4 A;  3GWR A;  3HX8 A;  4R9L A;  4R9K A;  5CF1 A;  4HM3 B;  2HMJ B;  2Z76 A;  3CU3 A;  4MJD A;  1OHP A;  4OVM A;  1W6Y A;  4K1U A;  5IER A;  1DMQ A;  4GB5 A;  3MG1 A;  1U5O A;  5KP4 A;  1ZX2 A;  4WYK A;  5DRV A;  1E97 A;  3SED A;  2YFL B;  1JKG A;  3FGY A;  4LEH A;  4PEJ A;  5BVB A;  1GY5 A;  2F98 A;  3EQQ B;  3EBT A;  3FH1 A;  3G8Z A;  1ZO2 A;  1OH0 A;  3LYG A;  3RGR A;  1ULI B;  3GZB A;  5CK6 A;  4HM5 B;  3MKI A;  4HVN A;  1NU3 A;  3MG2 A;  3VSY A;  4XBT A;  1O7N B;  4HM0 B;  2OWP A;  3CPO A;  1UUW B;  3B4O A;  4IIA A;  2IMJ A;  3FKA A;  3MG3 A;  1DMN A;  1AR0 A;  5TGN A;  2UX0 A;  2A15 A;  3NV0 A;  3ROB A;  2RGQ A;  1CQS A;  1DMM A;  1OPY A;  3F8H A;  1O7G B;  3JUQ A;  4WWU C;  2YFI B;  1E3R A;  1GYB A;  3NXJ A;  4OUQ A;  3FF0 A;  4XDV A;  3JUN A;  3G16 A;  4HM2 B;  1JN5 B;  1GS3 A;  1ASK A;  3KZT A;  1Q40 B;  4HM8 B;  2QGU A;  1ULJ B;  2F99 A;  2PZV A;  5FW5 A;  5IEO A;  1K41 A;  1STD A;  3FF2 A;  1NDO B;  5BXQ A;  4HZB B;  2XSO B;  5AI1 A;  5AIF A;  3VGN A;  3JUM A;  2YFJ B;  4XB5 A;  1HKX A;  5AEW B;  5KP3 A;  3B7C A;  4X2H A;  4Q53 A;  3EHC A;  3OX9 A;  1Z1S A;  3DM8 A;  3EF8 A;  3F14 A;  3KSP A;  3OXA A;  4HZ9 B;  5IEN A;  1BUQ A;  3H51 A;  7STD A;  3T8U A;  5CF2 A;  5IG4 A;  1VZZ A;  5AIG A;  5AEU B;  3EJV A;  1E3V A;  2Z7A A;  2XRX B;  1OF5 B;  4HM6 B;  4J9A A;  3LZA A;  5AIH A;  4CDL A;  5IG3 A;  3F40 A;  2CHC A;  5IG0 A;  3RGA A;  1OGZ A;  2B24 B;  2RCD A;  4ORL A;  1OHS A;  2XSH B;  1JKG B;  5EVH A;  3SOY A;  2W2C A;  3F7X A;  1SJW A;  5D82 A;  3SOA A;  3OWY A;  3DUK A;  3JUO A;  4RZM A;  4N3V A;  3KKG A;  3FZW A;  3EN8 A;  4U13 A;  1QMA A;  3B8L A;  3GRD A;  3CNM A;  4H3U A;  3Q90 A;  5DRE A;  1IDP A;  2BMO B;  1TUH A;  3GZX B;  3NUV A;  5HGR A;  5KP1 A;  2HMM B;  1GY6 A;  2BMQ B;  1O7W B;  5D81 A;  3UNL A;  1EA2 A;  4HM4 B;  3NV0 B;  1OGX A;  5CXO A;  2HMO B;  3OV4 A;  3T8N A;  1OCV A;  3MYT A;  5CLK A;  6STD A;  2GBW B;  1NWW A;  1W02 A;  2STD A;  4R1K A;  3HZP A;  4I4K A;  5IEP A;  3EX9 A;  3KE7 A;  1JN5 A;  3DZL A;  3ECF A;  3M8C A;  1Q40 A;  3B4P A;  3DXO A;  3F9S A;  3CNX A;  3FSD A;  4HJL B;  3K0Z A;  3G0K A;  1Q42 A;  2CKF B;  2XR8 B;  3FLJ A;  3NM2 A;  1JB4 A;  2Z77 A;  3EC9 A;  4L8O A;  1C7H A;  3MHE A;  1GY7 A;  2B1X B;  4K1V A;  2GEY A;  1EG9 B;  2RFR A;  4WYK B;  4FCJ A;  4L7K A;  3OWU A;  2QIY A;  5G2G A;  3NBR A;  3EN1 B;  5JPU A;  3WMD A;  1JB2 A;  1OUN A;  1ISK A;  3K7C A;  1S5A A;  2HMK B;  1WQL B;  2BNG A;  5IF6 A;  2INX A;  1UUV B;  2JQ5 A;  3GZR A;  3IPT A;  1O7M B;  3DMC A;  3NHX A;  1O7H B;  4HM7 B;  1JB5 A;  4FCM A;  1OF5 A;  4XBY A;  4KVH A;  3MSO A;  1TP6 A;  3HK4 A;  3F8X A;  5JPP A;  4L8P A;  2BMR B;  3GZY B;  1OHO A;  3I0Y A;  3E99 A;  5D83 A;  4HKV B;  5IG5 A;  3S5C A;  2F86 B;  3D9R A;  3EBY A;  4HM1 B;  2GXF A;  2GBX B;  3A76 A;  2HMN B;  4LGQ A;  4STD A;  1QJG A;  4LMI A;  1W01 A;  4X2O A;  5AII A;  4J8T A;  3F7S A;  3OWS A; 
#chains in the Genus database with same CATH topology
 3H3H A;  4N6M A;  3STD A;  2K54 A;  2HML B;  4JF8 A;  1UI7 A;  3CCJ 3;  1SAR A;  3BB9 A;  1O7P B;  4EV2 A;  2GEX A;  1VQ7 3;  4H61 A;  1UCJ A;  4R9L A;  4R9K A;  3I55 3;  2AAD A;  3L0R A;  1FUS A;  4FR9 A;  4HM3 B;  3CU3 A;  4MJD A;  1MGR A;  4RBN A;  4K1U A;  1I2E A;  1Q86 4;  3SED A;  1E97 A;  2FNQ A;  1JKG A;  4PEJ A;  5BVB A;  1WTH A;  2BU4 A;  2F98 A;  3EBT A;  3EQQ B;  3UL5 A;  1BSB A;  1BAO A;  2C10 A;  1WMN A;  2H0H A;  3CCM 3;  4KFE A;  5JBS A;  4LZI A;  1O7N B;  4HM0 B;  3CPO A;  1UUW B;  2V1L A;  3B4O A;  5GSP A;  1MWU A;  2XEP A;  1I2G A;  1QAK A;  2RGQ A;  1OPY A;  3S27 A;  1A2V A;  2AAE A;  1O7G B;  3WOE B;  1YI2 3;  1LNH A;  2E2U A;  4N6L A;  4XDV A;  1B2X A;  3BIR A;  2PNC A;  1K73 4;  3KZT A;  4DKI A;  3V98 A;  1STF I;  1K41 A;  3TDG A;  2XGL A;  1NDO B;  1RRH A;  1WNH A;  3DGN A;  1FGO A;  3BNC A;  3JUM A;  3Q3F A;  1B2S A;  5KP3 A;  3EHC A;  5IEN A;  1UGI A;  3DM8 A;  1NB3 I;  3F14 A;  1BUQ A;  1M9G A;  2C4B A;  1Q9E A;  2XFS A;  7STD A;  2W9P A;  1RGF A;  1VZZ A;  5AIG A;  1YHQ 3;  2XRX B;  1OF5 B;  2Y73 A;  4HM6 B;  4AEQ A;  2OQE C;  2KCD A;  1TIJ A;  2FXT A;  1OGZ A;  2B24 B;  3PGB A;  4EV5 A;  3AMO A;  4IPB A;  3G6E 3;  1ZS7 A;  2XSH B;  3T0U A;  1AQZ A;  3F7X A;  3PS8 A;  1SJW A;  4CPK A;  1ROA A;  4RZM A;  1HU9 A;  2WGQ A;  3KKG A;  1GSP A;  3BNB A;  1KQS 2;  3B8L A;  1MNL A;  3S29 A;  1YIT 3;  5A0O B;  5BIR A;  5KP1 A;  2CG0 A;  2HMM B;  1EEJ A;  2BMQ B;  2KF4 A;  4N6T A;  3DGL A;  3GSP A;  2P38 A;  1GD3 A;  3LT8 A;  4HM4 B;  1AVK A;  3CCQ 3;  1WMO A;  2HMO B;  1VQK 3;  3T8N A;  2GBW B;  2KXG A;  5EQL A;  3EX9 A;  1VQO 3;  2RNT A;  1FUW A;  2KF5 A;  1JN5 A;  1B20 A;  1IQY A;  1G0T A;  3KSE D;  3DGY A;  3DXO A;  4HJL B;  4ORL A;  2KAA A;  1B2U A;  1X1U A;  3D4A A;  1YGE A;  3FLJ A;  2P05 A;  3NM2 A;  1JB4 A;  2Z77 A;  3EC9 A;  4L8O A;  1C7H A;  2CX1 A;  1B3S A;  1GY7 A;  2B1X B;  3LXU X;  3IJE B;  4K1V A;  3RGR A;  1ISK A;  1U8C B;  1GMQ A;  3D79 A;  3HOH A;  3K7C A;  3DH2 A;  1WQL B;  3U1W A;  1B21 A;  4LSO A;  2INX A;  3LTC A;  1DE3 A;  1JZD A;  3NHX A;  1O7H B;  3LH4 A;  4FCM A;  2F5W A;  4XBY A;  3MSO A;  1FW7 A;  4KFF A;  3SLU A;  1VQ5 3;  1BRS A;  3GZY B;  3RNT A;  3U97 A;  1IYY A;  3URP A;  3AGN A;  1I8V A;  3D9R A;  3AHW A;  2P0X A;  2GXF A;  1IK3 A;  1SQW A;  4STD A;  2D1W A;  4GHO A;  1T3B A;  1ZGX A;  3OWS A;  1RGK A;  4XBX A;  2CFD A;  5BU4 A;  1IU7 A;  1RMS A;  3V99 A;  4I5Q A;  3JUP A;  2I9W A;  3LTB A;  4XDW A;  4AKZ A;  1S72 3;  1A90 A;  1RNB A;  3MPH A;  1RKY A;  3GWR A;  3KCH A;  1MGW A;  1RJO A;  1IT7 A;  3NBB A;  3NX0 A;  1LVN A;  4EC6 A;  3PCS A;  2OOV A;  1FGQ A;  3D5G A;  1L5G B;  5IER A;  1FYS A;  1OAC A;  1W7C A;  3DGO A;  4KFD A;  3N8B A;  2L4V A;  1LOW A;  4WYK A;  5M1A A;  3SVA A;  1EKM A;  1HZ1 A;  4LEH A;  1W5Z A;  3PXM A;  5IG4 A;  3ZFZ A;  3G8Z A;  3FH1 A;  1Q81 4;  1BNF A;  1BRH A;  3IMA B;  3LYG A;  2ML5 A;  1ULI B;  1RHL A;  3CXC 2;  4HVN A;  5LC7 A;  3FG3 A;  3HII A;  3MG2 A;  1TFO A;  1YGW A;  4XBT A;  3WOD G;  4IIA A;  2KF3 A;  1DET A;  1BU4 A;  1DMN A;  3MG3 A;  4FCZ A;  2UX0 A;  2A15 A;  2W03 A;  3NQZ A;  1GMR A;  4NPB A;  1GOY A;  3JUQ A;  1D6Y A;  1GOU A;  1E3R A;  4OUQ A;  2Q07 A;  1I2F A;  4FMC A;  3G16 A;  4HYZ A;  1JN5 B;  3CCE 3;  2QGU A;  2F99 A;  1IVW A;  1K8A 4;  1B2M A;  5AIF A;  1UW1 A;  4N6U A;  1Q7Y 4;  3O8Y A;  4G1M B;  4MMZ B;  1I3F A;  1CEW I;  1NJI 4;  2OTL 3;  3B7C A;  1B2Z A;  3A5E A;  4X2H A;  3KSP A;  3N54 B;  3NBJ A;  1FUT A;  1TU5 A;  1JBR A;  3T8U A;  5CF2 A;  3EB8 A;  2OOV C;  1UGH I;  4O8S A;  2Z7A A;  3K63 A;  1YJN 3;  2H0G A;  3ALA A;  4BL3 A;  2CHC A;  1YVS A;  3RGA A;  1RN4 A;  3NM7 A;  1V74 A;  2O3O A;  2RCD A;  1W6G A;  2CIU A;  4K90 B;  3SOY A;  2W2C A;  2K0M A;  1JRQ A;  5D82 A;  3JUO A;  1VQP 3;  4NHF A;  4N3V A;  3FZW A;  4U13 A;  1QMA A;  2SBL A;  3CNM A;  2CWT A;  4HBR A;  4GL6 A;  5DRE A;  1IDP A;  2BMO B;  3GZX B;  3LTA A;  1R4C A;  1GY6 A;  3CCS 3;  1EQK A;  2UGI A;  1HYF A;  1BSA A;  2XF3 A;  3NV0 B;  1OGX A;  1IVV A;  4RNT A;  2UUG C;  3MYT A;  3AHS A;  1N8R 4;  4I4K A;  1VQM 3;  1Q82 4;  3UB1 A;  1RGL A;  1IQ8 A;  3ECF A;  3WA3 A;  1Q40 A;  3F9S A;  2QEX 3;  3CCR 3;  3CNX A;  5G1K A;  3G0K A;  1Q42 A;  1TRP A;  3CCU 3;  2ML6 A;  4O3V A;  4RNZ A;  2CC3 A;  3Q1C A;  1VQQ A;  4WYK B;  2LYX A;  4J5K A;  1RGG A;  4L7K A;  1M90 4;  3ZG5 A;  3EN1 B;  3WMD A;  1RCL A;  2XH9 A;  2CW9 A;  3LOY A;  4J5G A;  2IA7 A;  2IY2 A;  4FMB A;  2LQV A;  2W04 A;  1I3I A;  2BNG A;  1CYU A;  3IPT A;  1UUV B;  2CWU A;  2F4Y A;  1KSI A;  2JQ5 A;  1R4Y A;  3GZR A;  2CK3 H;  5I97 A;  3DMC A;  4R80 A;  1RNT A;  5EEO A;  1YJW 3;  4HAA A;  2H0I A;  4KVH A;  3OW2 2;  5JPP A;  1GMP A;  1KWI A;  1T2H A;  2BMR B;  1OHO A;  3E99 A;  5IG5 A;  3S5C A;  2CWV A;  3CCV 3;  5AYR B;  1T2I A;  3CC4 3;  3EBY A;  1J2B A;  1A2P A;  2ZA4 A;  1BOX A;  1MWT A;  1QJG A;  4FMD A;  1KC8 4;  1RGA A;  3AGO A;  3DGM A;  1VQ9 3;  2IUJ A;  1VQ8 3;  3X3X A;  1K28 A;  1V57 A;  2F56 A;  3UJM A;  2M7O A;  1G02 A;  4GSP A;  2CX0 A;  8CHO A;  1W00 A;  3ER7 A;  4XM4 A;  2E2T A;  1YVB I;  2ZHX B;  1C54 A;  1N8Q A;  5AYS C;  2HMJ B;  2Z76 A;  2OTJ 3;  1VQN 3;  2RBI A;  3FG1 A;  9RNT A;  4OVM A;  1N9J A;  5RNT A;  1UCI A;  4KZ1 A;  1BAN A;  4LYL B;  4IT7 A;  2JDI H;  2P0M A;  5KP4 A;  2C11 A;  1RGC A;  1PYL A;  2YFL B;  1MWR A;  1LOY A;  2W6J H;  4ILF A;  1IV9 A;  5CK6 A;  3K5T A;  2OWP A;  1TTO A;  1IVX A;  2IMJ A;  2J8X B;  3FKA A;  2CH9 A;  1BSE A;  1AR0 A;  1LXE A;  3NV0 A;  3SX1 A;  1MOL A;  1CQS A;  3N9H A;  2YFI B;  1GYB A;  4BTY A;  3FF0 A;  5M19 A;  1JNQ A;  4HM2 B;  3SYU A;  1Q40 B;  1TJD A;  3KII A;  2ZDJ A;  1JV2 B;  2IUK A;  4WFO A;  1STD A;  3FF2 A;  4CCV A;  1RGH A;  4HZB B;  2XSO B;  5AI1 A;  2IYJ A;  3VGN A;  2CFL A;  3UL6 A;  2YFJ B;  1W6C A;  4XB5 A;  3S67 A;  3HIG A;  1LRA A;  2OCT A;  1RN7 A;  1US1 A;  3OX9 A;  1Z1S A;  3EF8 A;  1PFP A;  3OXA A;  3WR2 A;  2BT3 A;  4N6N B;  3J7Y d;  4RNY A;  2OQE A;  2XGN A;  1FA3 A;  1E3V A;  4J9A A;  1BGS A;  3F40 A;  1BNE A;  3CPW 2;  2Y74 A;  1D6U A;  5EVH A;  1OHS A;  1PU4 A;  6GSP A;  1FGM A;  4TX4 A;  3DUK A;  1IV7 A;  1X1X A;  1X1Y A;  3KN4 A;  2MC8 A;  3EN8 A;  1BRN L;  2GU3 A;  3GRD A;  3KFQ C;  4H3U A;  3X3Z A;  3Q90 A;  4O2H A;  3VF1 A;  1NB5 I;  3NUV A;  5HGR A;  1O7W B;  3UNL A;  1EA2 A;  1JBS A;  2O9U X;  4BIR A;  5CXO A;  3D3L A;  1SII A;  3EE1 A;  3Q2P A;  4WHA A;  1QAL A;  3OV4 A;  3LT9 A;  4EXR A;  2STD A;  1NWW A;  3PCR A;  1BNS A;  4R1K A;  1FGT A;  1WMP A;  3X3Y A;  1RCK A;  2E2V A;  3KE7 A;  3DZL A;  3M8C A;  2W9Q A;  3FSD A;  2ZL8 A;  4Q53 A;  6RNT A;  3G4S 3;  3K0Z A;  1RRL A;  1D6Z A;  1KD1 4;  4HOH A;  1N5P A;  1TRQ A;  1YIJ 3;  1LOV A;  1EG9 B;  2P09 A;  2WO0 A;  4FCJ A;  5ELU A;  1YJ9 3;  2W0Q A;  2R41 A;  3QK9 A;  1IQX A;  1BRG A;  1JB2 A;  1OUN A;  2FGT A;  1S5A A;  3BNE A;  2HMK B;  1BNJ A;  5IF6 A;  1NO3 A;  2WOF A;  1MWS A;  1VQ4 3;  2D42 A;  4HM7 B;  5ELJ A;  2MF7 A;  5M18 A;  1DVC A;  2Z6B A;  3DY5 A;  1TP6 A;  3GAX A;  3F8X A;  5FGO A;  4N6O B;  5IW9 A;  2BIR A;  4L8P A;  4K61 A;  5D83 A;  1RDS A;  3FG4 A;  1QAF A;  4O02 B;  4HM1 B;  1CYV A;  2W56 A;  1JZO A;  1TFK A;  2KF6 A;  3A76 A;  1UCL A;  4NRE A;  4X2O A;  5AII A;  4J8T A;  5LC6 A;  1IVU A;  1BNR A;  3BLZ A;  1A2K A;  1UUG B;  3NQY A;  4WP5 A;  4BL2 A;  1BIR A;  2R4I A;  5STD A;  1M1K 4;  1JBT A;  1A67 A;  1T5Y A;  3I56 3;  3CMA 3;  1BUJ A;  2BO9 B;  1RLS A;  2KRT A;  1N9E A;  3QRD A;  3HX8 A;  1ROV A;  4FMA A;  5CF1 A;  1EUI C;  5HOH A;  1BVI A;  1BNI A;  1OHP A;  1W6Y A;  4MEI A;  2QA4 3;  1PY3 A;  1DMQ A;  4GB5 A;  3MG1 A;  1I70 A;  1U5O A;  1ZX2 A;  5DRV A;  1GOV A;  3CME 3;  3FGY A;  1LQG C;  7GSP A;  1GY5 A;  1ZO2 A;  1OH0 A;  3WDG B;  3GZB A;  1RGE A;  4HM5 B;  3MKI A;  3S28 A;  4ZM8 A;  1NU3 A;  3VSY A;  4BU4 A;  1Y4K A;  4MMY B;  1BRI A;  1N5H A;  3JVC A;  5TGN A;  3ROB A;  1DMM A;  3F8H A;  4EYC A;  4WWU C;  3NXJ A;  1M1X B;  4EW5 A;  3JUN A;  1GS3 A;  1ASK A;  3HI7 A;  4HM8 B;  3RDE A;  1UDI I;  1LOX A;  1ULJ B;  2PZV A;  4QWT A;  5FW5 A;  1X1W A;  5IEO A;  2CFG A;  2HOH A;  1AY7 A;  3WA2 X;  2CFW A;  5BXQ A;  3BU4 A;  1K9M 4;  2GU1 A;  4BTW A;  1HKX A;  5AEW B;  3X40 A;  1CH0 A;  2L1S A;  1V58 A;  3D5I A;  3CD6 3;  4HZ9 B;  4KT3 B;  3H51 A;  1SIH A;  1W4N A;  5AEU B;  3V92 A;  3EJV A;  4CDL A;  5IG3 A;  1BNG A;  1F8N A;  1BSC A;  1W2Z A;  3LZA A;  5AIH A;  3CC2 3;  5IG0 A;  1LQM B;  1BRJ A;  1DYU A;  1JKG B;  4MMX B;  3SOA A;  2W56 B;  3OWY A;  8RNT A;  4EBG A;  4BTX A;  1RTU A;  4OK0 A;  4AKY A;  1BRK A;  1TUH A;  1SPU A;  3CC7 3;  3WHO A;  1FGR A;  5D81 A;  1JJ2 2;  2GSP A;  3CCL 3;  3LTD A;  3X42 A;  3FCS B;  1OCV A;  1IT8 A;  5CLK A;  6STD A;  1W02 A;  3X41 A;  3HZP A;  5IEP A;  1Q7H A;  1NNV A;  3B4P A;  2SAR A;  1G96 A;  1VQ6 3;  2BHM A;  2CKF B;  1RN1 A;  2XR8 B;  3G71 3;  1LNI A;  1B27 A;  3BND A;  3LML A;  2CG1 A;  3MHE A;  3WOF B;  3ZG0 A;  4CJN A;  2GEY A;  2RFR A;  2CFK A;  5JPU A;  3OWU A;  2QIY A;  5G2G A;  3NBR A;  1AVL A;  1I0V A;  1UI8 A;  1BSD A;  4N6V 0;  7RNT A;  2WOH A;  3MWZ A;  1W2B 2;  1RSN A;  1O7M B;  2XFT A;  3SXX A;  1VQL 3;  3PYJ A;  1JB5 A;  5G1L A;  1GD4 A;  1OF5 A;  3HK4 A;  3K9M C;  3I0Y A;  2F5M A;  1YNV X;  3AMO B;  4HKV B;  4R4K A;  2F86 B;  2WGO A;  2RSX A;  2K3D A;  1QVF 2;  2GBX B;  2HMN B;  4JRF A;  4LGQ A;  1QVG 2;  4LMI A;  1W01 A;  2YX9 A;  1DVD A;  3PZW A;  3F7S A;  1AV4 A;  1UCK A;  1I0X A;  1FZU A; 
#chains in the Genus database with same CATH homology
 3H3H A;  4N6M A;  3STD A;  2K54 A;  2HML B;  4JF8 A;  1UI7 A;  3CCJ 3;  3BB9 A;  1O7P B;  4EV2 A;  2GEX A;  1VQ7 3;  4H61 A;  4R9L A;  4R9K A;  3I55 3;  3L0R A;  4FR9 A;  4HM3 B;  3CU3 A;  4MJD A;  4RBN A;  4K1U A;  1Q86 4;  3SED A;  1E97 A;  2FNQ A;  1JKG A;  4PEJ A;  5BVB A;  1WTH A;  2F98 A;  3EQQ B;  3EBT A;  3UL5 A;  2C10 A;  1WMN A;  3CCM 3;  4KFE A;  5JBS A;  4LZI A;  1O7N B;  4HM0 B;  3CPO A;  1UUW B;  2V1L A;  3B4O A;  2XEP A;  1QAK A;  2RGQ A;  1OPY A;  3S27 A;  1A2V A;  1O7G B;  3WOE B;  1YI2 3;  1LNH A;  2E2U A;  4N6L A;  4XDV A;  2PNC A;  1K73 4;  3KZT A;  3V98 A;  1STF I;  1K41 A;  3TDG A;  2XGL A;  1NDO B;  1RRH A;  1WNH A;  3DGN A;  1FGO A;  3BNC A;  3JUM A;  5KP3 A;  3EHC A;  5IEN A;  3DM8 A;  1NB3 I;  3F14 A;  1BUQ A;  1M9G A;  7STD A;  2XFS A;  2W9P A;  1VZZ A;  5AIG A;  1YHQ 3;  2XRX B;  1OF5 B;  2Y73 A;  4HM6 B;  4AEQ A;  2OQE C;  2KCD A;  1TIJ A;  2FXT A;  1OGZ A;  2B24 B;  3PGB A;  4EV5 A;  3AMO A;  4IPB A;  3G6E 3;  3T0U A;  2XSH B;  3PS8 A;  3F7X A;  1SJW A;  1ROA A;  4RZM A;  1HU9 A;  2WGQ A;  3KKG A;  1KQS 2;  3BNB A;  3B8L A;  1MNL A;  3S29 A;  1YIT 3;  5A0O B;  5KP1 A;  2CG0 A;  2HMM B;  2BMQ B;  4N6T A;  3DGL A;  2P38 A;  1GD3 A;  3LT8 A;  4HM4 B;  1AVK A;  3CCQ 3;  1WMO A;  2HMO B;  1VQK 3;  3T8N A;  2GBW B;  2KXG A;  5EQL A;  3EX9 A;  1VQO 3;  1FUW A;  1JN5 A;  1IQY A;  3KSE D;  4ORL A;  3DXO A;  4HJL B;  3NM2 A;  1YGE A;  3FLJ A;  2P05 A;  1JB4 A;  2Z77 A;  3EC9 A;  4L8O A;  1C7H A;  4K1V A;  1GY7 A;  2B1X B;  3LXU X;  3RGR A;  3IJE B;  1ISK A;  1U8C B;  3K7C A;  3U1W A;  1WQL B;  4LSO A;  2INX A;  3LTC A;  3NHX A;  1O7H B;  3LH4 A;  4FCM A;  4XBY A;  3MSO A;  4KFF A;  3SLU A;  1VQ5 3;  3GZY B;  3U97 A;  3D9R A;  2P0X A;  2GXF A;  1IK3 A;  1SQW A;  4STD A;  2D1W A;  3OWS A;  4XBX A;  2CFD A;  1IU7 A;  3V99 A;  3JUP A;  2I9W A;  3LTB A;  4XDW A;  4AKZ A;  1S72 3;  1A90 A;  3MPH A;  1RKY A;  3GWR A;  1RJO A;  1IT7 A;  3NBB A;  3NX0 A;  1LVN A;  4EC6 A;  3PCS A;  2OOV A;  1FGQ A;  1L5G B;  5IER A;  1OAC A;  1W7C A;  3DGO A;  4KFD A;  3N8B A;  2L4V A;  4WYK A;  3SVA A;  1EKM A;  4LEH A;  1W5Z A;  3PXM A;  5IG4 A;  3G8Z A;  3FH1 A;  1Q81 4;  3LYG A;  3IMA B;  2ML5 A;  1ULI B;  3CXC 2;  4HVN A;  5LC7 A;  3FG3 A;  3HII A;  3MG2 A;  1TFO A;  4XBT A;  3WOD G;  4IIA A;  3MG3 A;  1DMN A;  4FCZ A;  2UX0 A;  2A15 A;  2W03 A;  3NQZ A;  3JUQ A;  1D6Y A;  1E3R A;  4OUQ A;  2Q07 A;  4FMC A;  3G16 A;  4HYZ A;  1JN5 B;  3CCE 3;  2QGU A;  2F99 A;  1IVW A;  1K8A 4;  5AIF A;  1UW1 A;  4N6U A;  1Q7Y 4;  3O8Y A;  4G1M B;  4MMZ B;  1CEW I;  1NJI 4;  2OTL 3;  3B7C A;  4X2H A;  3KSP A;  3N54 B;  3NBJ A;  1TU5 A;  3T8U A;  5CF2 A;  3EB8 A;  2OOV C;  4O8S A;  2Z7A A;  3K63 A;  1YJN 3;  3ALA A;  2CHC A;  3RGA A;  3NM7 A;  1V74 A;  2O3O A;  2RCD A;  1W6G A;  2CIU A;  4K90 B;  3SOY A;  2W2C A;  2K0M A;  1JRQ A;  5D82 A;  3JUO A;  1VQP 3;  4NHF A;  4N3V A;  3FZW A;  4U13 A;  1QMA A;  2SBL A;  3CNM A;  2CWT A;  4HBR A;  4GL6 A;  5DRE A;  1IDP A;  2BMO B;  3GZX B;  3LTA A;  1R4C A;  1GY6 A;  3CCS 3;  1EQK A;  2XF3 A;  3NV0 B;  1OGX A;  1IVV A;  3MYT A;  1N8R 4;  4I4K A;  1VQM 3;  1Q82 4;  3UB1 A;  1IQ8 A;  3ECF A;  3WA3 A;  1Q40 A;  3F9S A;  2QEX 3;  3CCR 3;  3CNX A;  3G0K A;  1Q42 A;  3CCU 3;  2ML6 A;  4O3V A;  4RNZ A;  2CC3 A;  3Q1C A;  4WYK B;  2LYX A;  4L7K A;  1M90 4;  3EN1 B;  3WMD A;  2XH9 A;  2CW9 A;  3LOY A;  2IA7 A;  4FMB A;  2LQV A;  2W04 A;  2BNG A;  1CYU A;  3IPT A;  1UUV B;  2CWU A;  2JQ5 A;  1KSI A;  3GZR A;  5I97 A;  3G71 3;  2CK3 H;  3DMC A;  4R80 A;  5EEO A;  1YJW 3;  4KVH A;  3OW2 2;  5JPP A;  1KWI A;  2BMR B;  1OHO A;  3E99 A;  5IG5 A;  3S5C A;  2CWV A;  3CCV 3;  5AYR B;  3CC4 3;  1J2B A;  3EBY A;  1QJG A;  4FMD A;  1KC8 4;  3DGM A;  1VQ9 3;  2IUJ A;  1VQ8 3;  3X3X A;  1K28 A;  3UJM A;  2M7O A;  8CHO A;  1W00 A;  3ER7 A;  4XM4 A;  2E2T A;  1YVB I;  1N8Q A;  5AYS C;  2HMJ B;  2Z76 A;  2OTJ 3;  1VQN 3;  3FG1 A;  4OVM A;  1N9J A;  4KZ1 A;  4IT7 A;  2JDI H;  2P0M A;  5KP4 A;  2C11 A;  2YFL B;  2W6J H;  1IV9 A;  5CK6 A;  3K5T A;  2OWP A;  1IVX A;  2IMJ A;  3FKA A;  2CH9 A;  1LXE A;  1AR0 A;  3NV0 A;  3SX1 A;  1MOL A;  1CQS A;  3N9H A;  2YFI B;  1GYB A;  4BTY A;  3FF0 A;  1JNQ A;  4HM2 B;  1Q40 B;  3KII A;  2ZDJ A;  1JV2 B;  2IUK A;  4WFO A;  1STD A;  3FF2 A;  4CCV A;  4HZB B;  2XSO B;  5AI1 A;  3VGN A;  2CFL A;  3UL6 A;  2YFJ B;  1W6C A;  4XB5 A;  3S67 A;  3HIG A;  2OCT A;  1RN7 A;  1US1 A;  3OX9 A;  1Z1S A;  3EF8 A;  1PFP A;  3OXA A;  2BT3 A;  4N6N B;  3J7Y d;  4RNY A;  2OQE A;  2XGN A;  1FA3 A;  1E3V A;  4J9A A;  3F40 A;  3CPW 2;  2Y74 A;  1D6U A;  5EVH A;  1OHS A;  1PU4 A;  1FGM A;  4TX4 A;  3DUK A;  1IV7 A;  3KN4 A;  2MC8 A;  3EN8 A;  2GU3 A;  3GRD A;  3KFQ C;  4H3U A;  3X3Z A;  3Q90 A;  4O2H A;  3VF1 A;  1NB5 I;  3NUV A;  5HGR A;  1O7W B;  3UNL A;  1EA2 A;  2O9U X;  4BTW A;  5CXO A;  3D3L A;  1SII A;  3EE1 A;  3Q2P A;  4WHA A;  1QAL A;  3OV4 A;  3LT9 A;  4EXR A;  2STD A;  1NWW A;  3PCR A;  4R1K A;  1FGT A;  1WMP A;  3X3Y A;  2E2V A;  3KE7 A;  3DZL A;  3M8C A;  2W9Q A;  3FSD A;  2ZL8 A;  4Q53 A;  3G4S 3;  3K0Z A;  1RRL A;  1D6Z A;  1KD1 4;  1N5P A;  1YIJ 3;  1EG9 B;  2P09 A;  2WO0 A;  4FCJ A;  5ELU A;  1YJ9 3;  2W0Q A;  3QK9 A;  1IQX A;  1JB2 A;  1OUN A;  2FGT A;  1S5A A;  3BNE A;  2HMK B;  5IF6 A;  1NO3 A;  2WOF A;  1VQ4 3;  2D42 A;  4HM7 B;  5ELJ A;  2MF7 A;  1DVC A;  2Z6B A;  3DY5 A;  1TP6 A;  3GAX A;  3F8X A;  5FGO A;  4N6O B;  5IW9 A;  4L8P A;  4K61 A;  5D83 A;  3FG4 A;  1QAF A;  4O02 B;  4HM1 B;  1CYV A;  2W56 A;  1TFK A;  3A76 A;  4NRE A;  4X2O A;  5AII A;  4J8T A;  5LC6 A;  1IVU A;  3BLZ A;  1A2K A;  3NQY A;  4WP5 A;  5STD A;  2R4I A;  1A67 A;  1M1K 4;  1T5Y A;  3I56 3;  3CMA 3;  2BO9 B;  2KRT A;  1N9E A;  3QRD A;  3HX8 A;  1ROV A;  4FMA A;  5CF1 A;  1OHP A;  1W6Y A;  4MEI A;  2QA4 3;  1DMQ A;  4GB5 A;  3MG1 A;  1U5O A;  1ZX2 A;  5DRV A;  3CME 3;  3FGY A;  1GY5 A;  1ZO2 A;  1OH0 A;  3WDG B;  3GZB A;  4HM5 B;  3MKI A;  3S28 A;  4ZM8 A;  1NU3 A;  3VSY A;  1Y4K A;  4MMY B;  3JVC A;  1N5H A;  5TGN A;  3ROB A;  1DMM A;  3F8H A;  4EYC A;  4WWU C;  3NXJ A;  1M1X B;  3JUN A;  1GS3 A;  1ASK A;  3HI7 A;  4HM8 B;  3RDE A;  1LOX A;  1ULJ B;  2PZV A;  4QWT A;  5FW5 A;  5IEO A;  2CFG A;  3WA2 X;  2CFW A;  5BXQ A;  1K9M 4;  2GU1 A;  1HKX A;  5AEW B;  3X40 A;  3CD6 3;  4HZ9 B;  3H51 A;  1SIH A;  1W4N A;  5AEU B;  3V92 A;  3EJV A;  4CDL A;  5IG3 A;  1F8N A;  1W2Z A;  3LZA A;  5AIH A;  3CC2 3;  5IG0 A;  1DYU A;  1JKG B;  4MMX B;  3SOA A;  2W56 B;  3OWY A;  4EBG A;  4BTX A;  4OK0 A;  4AKY A;  1TUH A;  1SPU A;  1FGR A;  5D81 A;  1JJ2 2;  3CCL 3;  3LTD A;  3X42 A;  3FCS B;  1OCV A;  1IT8 A;  5CLK A;  6STD A;  1W02 A;  3X41 A;  3HZP A;  5IEP A;  3B4P A;  1VQ6 3;  1G96 A;  2BHM A;  2CKF B;  2XR8 B;  3BND A;  2CG1 A;  3LML A;  3MHE A;  3WOF B;  2GEY A;  2RFR A;  2CFK A;  5JPU A;  3OWU A;  2QIY A;  5G2G A;  3NBR A;  1AVL A;  1UI8 A;  4N6V 0;  2WOH A;  3MWZ A;  1W2B 2;  1VQL 3;  1O7M B;  2XFT A;  3SXX A;  3PYJ A;  1JB5 A;  1GD4 A;  1OF5 A;  3HK4 A;  3K9M C;  3I0Y A;  3AMO B;  4HKV B;  4R4K A;  2F86 B;  2WGO A;  2RSX A;  1QVF 2;  2GBX B;  2HMN B;  4JRF A;  4LGQ A;  1QVG 2;  4LMI A;  1W01 A;  2YX9 A;  1DVD A;  3PZW A;  3F7S A;  1AV4 A;  3CC7 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...