2GXFA

X-ray crystal structure of protein yybh from bacillus subtilis. northeast structural genomics consortium target sr506.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
128
structure length
119
Chain Sequence
b'MEQQLKDIISACDLAIQNEDFDTLMNYYSEDAVLVVKPGMIARGKEEIKKAFITIANYFNHHIVPTQGKMILLEAGDTVLVLSQTLLDMERRATYVFKKNAQGEWLCVIDNSYGTDLIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yybH
molecule tags Structural genomics, unknown function
source organism Bacillus subtilis
publication title Crystal Structure of the Hypothetical Protein YybH from Bacillus subtilis, Northeast Structural Genomics Target SR506
rcsb
total genus 27
structure length 119
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13474 SnoaL_3 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gxfA00
2Z7AA 1GY5A 2XSOB 4WWUC 1EG9B 3HZPA 3MG3A 1ZX2A 3GRDA 3IPTA 1JN5B 3OV4A 1A2KA 4WYKB 5EVHA 2HMJB 1E3RA 1HKXA 5JPUA 3GZBA 3F8XA 4HM6B 2STDA 5D81A 1JB4A 3BLZA 2K54A 3DM8A 3NHXA 4GB5A 2GEXA 3DMCA 3FF2A 4FCMA 4HM7B 4HZ9B 4RZMA 3SOAA 1GYBA 3MG1A 3ECFA 3JUNA 1NDOB 3T8NA 1ISKA 1OUNA 3HX8A 5AIFA 4HM5B 4I4KA 4HZBB 3SEDA 1Q42A 3EN1B 3FZWA 1OHPA 1UUWB 3Q90A 3ROBA 3WMDA 5KP1A 1O7PB 1GY7A 3JUMA 3GZXB 3HK4A 1ASKA 5AIGA 5IG5A 1S5AA 1OF5B 3BB9A 3EBYA 4HJLB 5IERA 5CK6A 2BNGA 4HM8B 4IIAA 4HVNA 4L7KA 1K41A 2INXA 2QGUA 1OGZA 4L8PA 2R4IA 3CNXA 2RGQA 3FSDA 3MG2A 1ULJB 1SJWA 4XM4A 3MYTA 2IMJA 3UJMA 1GS3A 3FLJA 3VGNA 3NM2A 3B4OA 5KP4A 4K1VA 2PZVA 4U13A 3F14A 3LZAA 3NXJA 3G16A 1U5OA 3EHCA 1TP6A 2UX0A 1JKGB 2B1XB 3MSOA 4X2HA 5HGRA 3NUVA 4CDLA 4XDWA 3F40A 3KSPA 6STDA 1DMNA 3A76A 1O7MB 1W6YA 1JB5A 4HM2B 3MHEA 2HMKB 1CQSA 3H51A 4Q53A 4R1KA 2F99A 4LGQA 4XDVA 3UNLA 3EBTA 2RFRA 4LMIA 3OXAA 3DXOA 1JKGA 4HM0B 1WQLB 2B24B 1ULIB 3G0KA 4KVHA 2HMOB 1OHOA 2Z77A 5IEPA 1O7WB 1C7HA 1Z1SA 3OWYA 3S5CA 3FKAA 4HM1B 3EC9A 5CXOA 3OWUA 2HMNB 2GBXB 2Z76A 3G8ZA 4L8OA 3RGRA 5KP3A 5IG3A 3LYGA 3EF8A 3DZLA 1W01A 2QIYA 3CPOA 1EA2A 3EQQB 3DUKA 3K0ZA 3GZYB 3OX9A 3VSYA 5JPPA 1O7GB 4LEHA 4WYKA 5DREA 1JN5A 4HKVB 4J8TA 5CLKA 5FW5A 5AI1A 3E99A 4WP5A 2A15A 5CF2A 3FGYA 3F7XA 7STDA 1O7HB 4OUQA 4OVMA 4STDA 1O7NB 1STDA 2XRXB 3OWSA 4FCJA 8CHOA 4R9LA 1OHSA 2I9WA 1GY6A 5IEOA 4N3VA 2BMOB 2JQ5A 2F86B 3JUPA 3RGAA 1E97A 1OPYA 3D9RA 1DMMA 2GBWB 2XR8B 3GWRA 3MKIA 4H3UA 2RCDA 1Q40A 1OF5A 1DMQA 3EX9A 1ZO2A 3NV0A 3H3HA 4K1UA 3KZTA 3F7SA 3FF0A 4XBYA 3M8CA 5D83A 5IG4A 3K7CA 2YFJB 1W02A 3ER7A 3EN8A 1W00A 3I0YA 1OGXA 5STDA 3SOYA 3CU3A 2GXFA 3T8UA 3JUQA 5AEUB 1E3VA 1TUHA 3F8HA 3KE7A 4HM3B 5DRVA 1AR0A 5AEWB 2YFLB 1UUVB 1BUQA 4J9AA 4HM4B 4X2OA 1JB2A 2HMLB 1VZZA 3F9SA 5BXQA 2W2CA 1QJGA 1Q40B 3EJVA 1NU3A 2OWPA 3B4PA 3CNMA 2F98A 2HMMB 4ORLA 4XBTA 3NBRA 2BMRB 1IDPA 2GEYA 1QMAA 4R9KA 5G2GA 3NV0B 4XBXA 1NWWA 3JUOA 4PEJA 5TGNA 3B8LA 3STDA 4MJDA 3FH1A 4XB5A 2CKFB 5AIIA 5D82A 5CF1A 2YFIB 3KKGA 5AIHA 2XSHB 5IF6A 3GZRA 1OCVA 2BMQB 1OH0A 2CHCA 5IENA 5IG0A 5BVBA 3B7CA
chains in the Genus database with same CATH superfamily
1UUGB 1V58A 2XSOB 1AY7A 4IT7A 4WWUC 3MG3A 1T2IA 2CX1A 3IPTA 1A2KA 1W5ZA 5JPUA 1KC84 3HIGA 4FCZA 1JB4A 3NHXA 3BNDA 4NHFA 1SIHA 3SOAA 1I3FA 1TRQA 3T8NA 1I0VA 5AIFA 2IUKA 1N8QA 4HM5B 4HZBB 4J5KA 2WGQA 3Q90A 2RNTA 1O7PB 1CH0A 1GY7A 2D42A 3DH2A 1ASKA 3HK4A 3NQYA 1S5AA 1JBRA 5IERA 1U8CB 2CX0A 2C4BA 2AADA 2CFLA 2LYXA 2P0XA 2R4IA 4QWTA 3PGBA 2OOVC 2KXGA 1G0TA 1A2PA 1GS3A 3PXMA 2FXTA 1K734 3UB1A 4BTXA 3LZAA 4OK0A 4DKIA 1B2ZA 2XF3A 3D4AA 3MSOA 4IPBA 3WR2A 1N8R4 1RDSA 4XDWA 5AYSC 3U1WA 1JJ22 2UGIA 1DMNA 1Q7HA 3CPW2 2E2TA 1JB5A 4HM2B 4LSOA 3T0UA 4EC6A 2HMKB 3LTBA 2F99A 2CIUA 2XFSA 1UI8A 3CCS3 4HOHA 5A0OB 4K90B 3WHOA 3OXAA 4HM0B 2QEX3 1STFI 4J5GA 2HMOB 4CJNA 2Z77A 5HOHA 5IEPA 1O7WB 1C7HA 3S29A 1QAKA 3OWYA 1M1K4 1AVKA 5CXOA 3OWUA 1N9EA 4BU4A 4L8OA 3SYUA 3EF8A 2QIYA 3CPOA 1CEWI 3VSYA 1BSDA 3DUKA 3OX9A 4GSPA 4N6MA 1RTUA 1UW1A 1TJDA 1S723 1X1UA 5AI1A 2CW9A 1NJI4 3F7XA 3X3XA 4STDA 1STDA 3OWSA 5FW5A 3CXC2 1RCLA 4R9LA 1RRHA 1JBSA 1GMRA 1BSEA 4N3VA 2BMOB 2JQ5A 2F86B 2W56A 1RGLA 3RGAA 1OPYA 5D83A 4EV5A 2CFGA 1UCJA 1OF5A 2IUJA 4XBYA 5M19A 3CC23 3DGYA 1W00A 1SQWA 1R4YA 2P38A 3T8UA 1B20A 3V98A 2OTJ3 1E3VA 3KE7A 2OQEA 5DRVA 5AEWB 2YFLB 1BUQA 1FW7A 1MWUA 1JRQA 1SPUA 4J9AA 2H0IA 4KFEA 3K9MC 1MGRA 4HYZA 4MMZB 3NX0A 2W9PA 2P05A 1BRHA 1EUIC 1LXEA 1UCKA 3X40A 2Z6BA 2P0MA 4K61A 1QMAA 1RGEA 4EYCA 3NV0B 1BVIA 3U97A 1NWWA 2BHMA 1FUSA 2H0GA 1T3BA 3FH1A 3CCL3 2CKFB 5AIIA 3D5IA 5CF1A 3S67A 5AIHA 1FGRA 2JDIH 1OH0A 2CHCA 3RNTA 5IENA 2BU4A 1YVBI 3BNCA 2CWTA 5LC7A 1RSNA 3SXXA 3DY5A 5EQLA 4R80A 3TDGA 1EG9B 3HZPA 1RGAA 1ZX2A 3OV4A 1JN5B 3AGNA 4BIRA 1BNJA 3EE1A 2HMJB 1BU4A 4WYKB 1MOLA 5EVHA 1VQM3 2W6JH 5D81A 3BLZA 1UGHI 4HZ9B 2MF7A 1W2ZA 4RZMA 1GD4A 1KD14 1ISKA 2FGTA 3ZG0A 3JUNA 1MWTA 1LQGC 1IQ8A 1I8VA 1BRSA 1Q42A 1YNVX 1RGHA 4O8SA 3LT9A 1OF5B 1IU7A 4LYLB 4EV2A 3DGLA 1RMSA 4HM8B 4IIAA 3D79A 1K41A 1IT7A 4WFOA 1GSPA 4KZ1A 1UCIA 1BNEA 1FGMA 3WA2X 2RGQA 2XEPA 3AMOB 1GMQA 1ULJB 1SJWA 3LXUX 2IMJA 3EB8A 1D6ZA 3FLJA 1VQP3 3B4OA 1N5HA 1WMNA 1DVCA 1YVSA 4HBRA 3CC43 3G16A 1LQMB 3KFQC 2E2VA 2B1XB 3CCJ3 1IVUA 1GOVA 1YHQ3 3CMA3 4CDLA 1CYUA 1RNTA 6GSPA 1I0XA 2OCTA 1WTHA 3FG1A 1O7MB 1BNGA 1RLSA 1RGGA 1PU4A 4XDVA 3UNLA 3CME3 1TFOA 2W03A 4MMYB 4EW5A 1X1WA 1SARA 4KFFA 2B24B 1BUJA 1OHOA 4CCVA 2SARA 3CCU3 1A67A 1FA3A 3RDEA 3CC73 2HMNB 2GBXB 2Z76A 1TIJA 5KP3A 1J2BA 3LYGA 3K0ZA 1FUTA 2L4VA 3DZLA 1EEJA 3EQQB 4X2HA 5CF2A 3GZYB 1MGWA 4ILFA 4WYKA 1JN5A 2K3DA 4J8TA 5CLKA 1X1YA 3Q1CA 4I5QA 1I2FA 1YGWA 2WOFA 3E99A 4WP5A 2A15A 5IW9A 2O3OA 2WO0A 3FGYA 3G713 1O7HB 1EKMA 4OUQA 2ML6A 1RNBA 5AYRB 2XRXB 4FCJA 1OHSA 2GU3A 1D6UA 3GWRA 1BIRA 3WODG 3X3YA 2CFKA 1K8A4 3Q2PA 2RCDA 3EX9A 3NV0A 3H3HA 3KZTA 2YX9A 4MEIA 1LNHA 1GOUA 1OGXA 1AV4A 2GXFA 3DGOA 4O2HA 4AEQA 4HM3B 1AR0A 2E2UA 1JB2A 3AHWA 3F9SA 5BXQA 2W2CA 1QJGA 3HOHA 3EJVA 1Q9EA 1I3IA 3HI7A 1BANA 2W04A 2C10A 3CCV3 1N5PA 4N6TA 2ML5A 2F98A 3CCR3 3LH4A 2GEYA 1IQYA 1YIJ3 4N6V0 4XBXA 4O02B 1V57A 5TGNA 4PEJA 1TFKA 4EBGA 4RBNA 2RSXA 3V92A 4G1MB 2W56B 5GSPA 2YFIB 2ZHXB 3KIIA 1PYLA 2C11A 5JBSA 1G96A 2V1LA 1Q864 2XGLA 1UDII 5BVBA 1VQ63 2Z7AA 1W7CA 1T2HA 3JVCA 4LZIA 2KF4A 4FMDA 1GOYA 1BAOA 3Q3FA 9RNTA 7GSPA 1OACA 2STDA 2CFWA 4HM7B 1NNVA 1WMPA 2BO9B 3DMCA 4GB5A 1GYBA 2R41A 1Y4KA 3AHSA 3HX8A 4I4KA 2KCDA 3I563 3ROBA 3L0RA 3WMDA 3NQZA 5AIGA 7RNTA 1ROAA 3GZXB 2F5WA 4RNTA 1W6CA 1BSBA 3EBYA 4HJLB 1RCKA 5CK6A 2BNGA 2ZDJA 1LOXA 1QALA 3VF1A 1B2UA 1BNIA 2INXA 2KF3A 3KN4A 4HVNA 3FG3A 2QGUA 1OGZA 3HIIA 3PCSA 1M1XB 4L8PA 1VQQA 3CNXA 1RN7A 1YJN3 1RGFA 1CYVA 1YGEA 4XM4A 3UJMA 3VGNA 3QRDA 1QVG2 3X42A 2PZVA 3SVAA 3F14A 1BSAA 1NB3I 3NXJA 1U5OA 1TP6A 3BIRA 4N6UA 2QA43 1TTOA 2XH9A 5HGRA 1PY3A 5EEOA 3UL5A 3F40A 6STDA 1R4CA 1BNFA 3BNEA 2XFTA 3LMLA 1KQS2 2UUGC 3A76A 1W6YA 2FNQA 3CCM3 1LOWA 1CQSA 4Q53A 4BL3A 1Q7Y4 4FMAA 4LGQA 1KSIA 2AAEA 5G1LA 3ALAA 3EBTA 1DYUA 2RFRA 4LMIA 3PS8A 2H0HA 1WQLB 3G0KA 1ULIB 6RNTA 1NO3A 3S28A 1T5YA 1VQ83 1BOXA 1ROVA 1Z1SA 2F4YA 3FKAA 4JRFA 3ZG5A 1A2VA 1FUWA 4EXRA 3G4S3 1W01A 5JPPA 1EA2A 2OTL3 3PCRA 4AKYA 1V74A 3WOFB 1IV9A 1UGIA 5DREA 3OW22 1VQ73 1GD3A 7STDA 2IYJA 1BSCA 1O7NB 8CHOA 5IEOA 1GY6A 1LVNA 2ZA4A 8RNTA 1SIIA 1HZ1A 1GMPA 4HAAA 3LTCA 4R9KA 4R1KA 1DMMA 2GBWB 2SBLA 2XR8B 3MKIA 5IG5A 1VQO3 1RGKA 1DMQA 1W2B2 3WDGB 1FZUA 1LRAA 3F7SA 3M8CA 3SX1A 3N9HA 1WMOA 1UCLA 3ER7A 2OOVA 5STDA 3SOYA 3CU3A 2GSPA 2M7OA 3GSPA 1JV2B 5AEUB 1TUHA 2XGNA 1I2EA 1K9M4 1VQK3 1UUVB 1ZS7A 4HM4B 4X2OA 3PYJA 3QK9A 2HMLB 1FGTA 1VZZA 2CWUA 3LTDA 1VQN3 1JBTA 3FCSB 1IT8A 2WGOA 3B4PA 1QAFA 4ZM8A 5ELJA 2KF6A 3NBRA 3AGOA 2BMRB 1IDPA 3MPHA 5ELUA 1DETA 5G2GA 2P09A 5BIRA 4N6OB 3S27A 2W0QA 3JUOA 4XB5A 3D3LA 4TX4A 2Y74A 5D82A 5FGOA 5IF6A 1MNLA 2Q07A 1UI7A 1OCVA 2BIRA 1RN4A 3K5TA 4GL6A 1A90A 3DXOA 1LOVA 3KSED 1RJOA 4BTWA 1GY5A 1W4NA 4RNZA 3MWZA 3GRDA 2GU1A 1YJW3 1E3RA 1HKXA 1M9GA 1W6GA 3GZBA 3F8XA 3NBJA 4JF8A 2F5MA 4BL2A 5RNTA 2K54A 3DM8A 3CCQ3 2CC3A 1MWSA 2CFDA 2GEXA 1ZGXA 3FF2A 4FCMA 1C54A 3MG1A 3ECFA 1NDOB 4N6LA 4KT3B 1OUNA 3N8BA 5G1KA 3SEDA 3EN1B 3FZWA 1OHPA 1UUWB 1EQKA 2Y73A 1BRGA 1I70A 3JUMA 3K63A 4FR9A 5KP1A 1YIT3 2K0MA 3BB9A 2HOHA 1TRPA 1M904 4MMXB 4L7KA 1JZDA 1F8NA 1TU5A 1D6YA 3MG2A 3FSDA 3A5EA 3MYTA 2WOHA 1MWRA 3LT8A 5KP4A 1IVWA 3NM2A 1B2MA 1US1A 4K1VA 4O3VA 1BGSA 2IA7A 3FG4A 4U13A 2CK3H 3DGNA 1B2SA 3EHCA 1DVDA 1I2GA 1VQ53 2UX0A 1JKGB 1G02A 3CD63 1HU9A 2L1SA 3NUVA 1JNQA 3KSPA 2IY2A 1VQ43 4FMCA 1WNHA 4NPBA 2KF5A 1X1XA 3MHEA 4WHAA 3H51A 1AQZA 1PFPA 4H61A 5M18A 3WOEB 1IV7A 3CCE3 1JKGA 1AVLA 4KVHA 3X41A 3BNBA 2ZL8A 5BU4A 3N54B 2PNCA 1RRLA 2CWVA 5M1AA 1HYFA 2RBIA 3S5CA 4HM1B 3EC9A 1N9JA 3RGRA 3G8ZA 3IMAB 5IG3A 1IVVA 1BRJA 2J8XB 2MC8A 2OQEC 1O7GB 4LEHA 2CG1A 4HKVB 1QVF2 1NB5I 1IYYA 5I97A 2LQVA 4OVMA 3V99A 1BNRA 3PZWA 1B2XA 3BU4A 2I9WA 3IJEB 1BRNL 4CPKA 1FGQA 1VQL3 2CH9A 1B27A 3DGMA 3JUPA 1IVXA 1E97A 3D9RA 1BRKA 3KCHA 4H3UA 4HM6B 3UL6A 1IK3A 3G6E3 1Q40A 3LOYA 1ZO2A 4K1UA 3FF0A 1RGCA 3AMOA 5IG4A 3K7CA 2YFJB 1W02A 2W9QA 3EN8A 3I0YA 3O8YA 1Q814 2KRTA 4N6NB 4R4KA 2BT3A 3JUQA 3D5GA 4AKZA 1JZOA 3WA3A 3I553 3F8HA 4RNYA 1LOYA 4NREA 2CG0A 2KAAA 3LTAA 1RKYA 3SLUA 3X3ZA 4KFDA 1Q40B 1NU3A 4FMBA 3ZFZA 1DE3A 2OWPA 1VQ93 3CNMA 4GHOA 1B21A 2HMMB 4ORLA 4XBTA 5LC6A 1YI23 1FYSA 1FGOA 1BRIA 1IQXA 3NM7A 1L5GB 3URPA 1Q824 1YJ93 2O9UX 3B8LA 3STDA 4MJDA 1RHLA 3GAXA 4BTYA 3J7Yd 1KWIA 2D1WA 3KKGA 2XSHB 1K28A 3GZRA 3NBBA 1RN1A 1B3SA 2BMQB 2F56A 1BNSA 5IG0A 1LNIA 3B7CA
chains in the Genus database with same CATH topology
2XSOB 4IT7A 4WWUC 3MG3A 3IPTA 1A2KA 1W5ZA 5JPUA 1KC84 3HIGA 4FCZA 1JB4A 3NHXA 3BNDA 4NHFA 1SIHA 3SOAA 3T8NA 5AIFA 2IUKA 1N8QA 4HM5B 4HZBB 2WGQA 3Q90A 1O7PB 1GY7A 2D42A 3NQYA 3HK4A 1ASKA 1S5AA 5IERA 1U8CB 2CFLA 2LYXA 2P0XA 2R4IA 3PGBA 2OOVC 2KXGA 1GS3A 3PXMA 2FXTA 1K734 3UB1A 4BTXA 3LZAA 2XF3A 3MSOA 4IPBA 1N8R4 4XDWA 5AYSC 3U1WA 1JJ22 1DMNA 3CPW2 2E2TA 1JB5A 4HM2B 4LSOA 3T0UA 4EC6A 2HMKB 3LTBA 2F99A 2CIUA 2XFSA 1UI8A 3CCS3 5A0OB 4K90B 3OXAA 4HM0B 2QEX3 1STFI 2HMOB 2Z77A 5IEPA 1O7WB 1C7HA 3S29A 1QAKA 3OWYA 1M1K4 1AVKA 5CXOA 3OWUA 1N9EA 4L8OA 3EF8A 2QIYA 3CPOA 1CEWI 3VSYA 3OX9A 3DUKA 4N6MA 1UW1A 1S723 5AI1A 2CW9A 1NJI4 3F7XA 3X3XA 4STDA 1STDA 3OWSA 3CXC2 4R9LA 1RRHA 4N3VA 2BMOB 2JQ5A 2F86B 2W56A 3RGAA 4EV5A 1OPYA 5D83A 2CFGA 1OF5A 2IUJA 4XBYA 3CC23 1W00A 1SQWA 2P38A 3T8UA 3V98A 2OTJ3 1E3VA 3KE7A 2OQEA 5DRVA 5AEWB 2YFLB 1BUQA 4J9AA 1JRQA 1SPUA 4KFEA 3K9MC 4HYZA 4MMZB 3NX0A 2W9PA 2P05A 1LXEA 3X40A 2Z6BA 2P0MA 4K61A 1QMAA 4EYCA 3NV0B 3U97A 1NWWA 2BHMA 3FH1A 3CCL3 2CKFB 5AIIA 5CF1A 3S67A 5AIHA 1FGRA 2JDIH 1OH0A 2CHCA 5IENA 3BNCA 1YVBI 2CWTA 5LC7A 3SXXA 3DY5A 5EQLA 4R80A 3TDGA 1EG9B 3HZPA 1ZX2A 3OV4A 1JN5B 3EE1A 4WYKB 2HMJB 5EVHA 1MOLA 1VQM3 2W6JH 5D81A 3BLZA 4HZ9B 2MF7A 1W2ZA 4RZMA 1GD4A 1KD14 1ISKA 2FGTA 3JUNA 1IQ8A 1Q42A 4O8SA 3LT9A 1OF5B 1IU7A 4EV2A 3DGLA 4HM8B 4IIAA 1K41A 1IT7A 4WFOA 4KZ1A 3WA2X 1FGMA 2RGQA 2XEPA 3AMOB 1ULJB 3LXUX 1SJWA 2IMJA 3EB8A 1D6ZA 3FLJA 1VQP3 3B4OA 1N5HA 1WMNA 1DVCA 4HBRA 3CC43 3G16A 3KFQC 2E2VA 2B1XB 3CCJ3 1IVUA 1YHQ3 3CMA3 4CDLA 1CYUA 2OCTA 1WTHA 3FG1A 1O7MB 1PU4A 4XDVA 3UNLA 3CME3 1TFOA 2W03A 4MMYB 4KFFA 2B24B 1OHOA 4CCVA 1A67A 3CCU3 1FA3A 3RDEA 3CC73 2HMNB 2GBXB 2Z76A 1TIJA 5KP3A 1J2BA 3LYGA 3K0ZA 2L4VA 3DZLA 3EQQB 4X2HA 5CF2A 3GZYB 4WYKA 1JN5A 5FW5A 4J8TA 5CLKA 3Q1CA 5IW9A 2WOFA 3E99A 4WP5A 2A15A 2O3OA 2WO0A 3FGYA 3G713 1O7HB 1EKMA 4OUQA 2ML6A 5AYRB 2XRXB 4FCJA 1OHSA 2GU3A 1D6UA 3GWRA 3WODG 3X3YA 2CFKA 1K8A4 3Q2PA 2RCDA 3EX9A 3NV0A 3H3HA 3KZTA 2YX9A 4MEIA 1LNHA 1OGXA 1AV4A 2GXFA 3DGOA 4O2HA 4AEQA 4HM3B 1AR0A 2E2UA 1JB2A 3F9SA 5BXQA 2W2CA 1QJGA 3EJVA 3HI7A 2W04A 2C10A 3CCV3 1N5PA 4N6TA 2ML5A 2F98A 3CCR3 3LH4A 2GEYA 1IQYA 4N6V0 4XBXA 4O02B 5TGNA 4PEJA 1TFKA 4EBGA 4RBNA 2RSXA 3V92A 4G1MB 2W56B 2YFIB 3KIIA 5JBSA 2C11A 1G96A 2V1LA 1Q864 2XGLA 5BVBA 1VQ63 2Z7AA 1W7CA 3JVCA 4LZIA 4FMDA 1OACA 2STDA 2CFWA 4HM7B 1WMPA 2BO9B 3DMCA 4GB5A 1GYBA 1Y4KA 3HX8A 4I4KA 2KCDA 3I563 3ROBA 3L0RA 3WMDA 3NQZA 5AIGA 1ROAA 3GZXB 1W6CA 3EBYA 4HJLB 5CK6A 2BNGA 2ZDJA 1LOXA 1QALA 3VF1A 3KN4A 4HVNA 2INXA 4OK0A 1YIJ3 1QVF2 3FG3A 2QGUA 1OGZA 3HIIA 3PCSA 1M1XB 4L8PA 4QWTA 3CNXA 1RN7A 1YJN3 1CYVA 1YGEA 4XM4A 3UJMA 3VGNA 3QRDA 1QVG2 3X42A 2PZVA 3SVAA 3F14A 1NB3I 3NXJA 1U5OA 1TP6A 4N6UA 2QA43 2XH9A 5HGRA 5EEOA 3UL5A 3F40A 6STDA 1R4CA 3BNEA 3LMLA 2XFTA 1KQS2 3A76A 1W6YA 2FNQA 3CCM3 1CQSA 4Q53A 1Q7Y4 4FMAA 4LGQA 1KSIA 3ALAA 3EBTA 1DYUA 2RFRA 4LMIA 3PS8A 1WQLB 3G0KA 1ULIB 1NO3A 3S28A 1T5YA 1VQ83 1ROVA 1Z1SA 3FKAA 4JRFA 1A2VA 1FUWA 4EXRA 3G4S3 1W01A 5JPPA 1EA2A 2OTL3 3PCRA 4AKYA 1V74A 3WOFB 1IV9A 5DREA 3OW22 1VQ73 1GD3A 7STDA 1O7NB 8CHOA 5IEOA 1GY6A 1LVNA 1SIIA 3LTCA 4R9KA 4R1KA 1DMMA 2GBWB 2SBLA 2XR8B 3MKIA 5IG5A 1VQO3 1DMQA 1W2B2 3WDGB 3F7SA 3M8CA 3SX1A 3N9HA 1WMOA 3ER7A 2OOVA 5STDA 3SOYA 3CU3A 2M7OA 1JV2B 5AEUB 1TUHA 2XGNA 1K9M4 1VQK3 1UUVB 4HM4B 4X2OA 3PYJA 3QK9A 2HMLB 1FGTA 1VZZA 2CWUA 3LTDA 1VQN3 3FCSB 1IT8A 2WGOA 3B4PA 1QAFA 4ZM8A 5ELJA 3NBRA 2BMRB 1IDPA 3MPHA 5ELUA 5G2GA 2P09A 4N6OB 3S27A 2W0QA 3JUOA 4XB5A 3D3LA 4TX4A 2Y74A 5D82A 5FGOA 5IF6A 1MNLA 2Q07A 1UI7A 1OCVA 3K5TA 4GL6A 1A90A 3DXOA 3KSED 1RJOA 4BTWA 1GY5A 1W4NA 4RNZA 3MWZA 3GRDA 2GU1A 1YJW3 1E3RA 1HKXA 1M9GA 1W6GA 3GZBA 3F8XA 3NBJA 4JF8A 2K54A 3DM8A 3CCQ3 2CC3A 2CFDA 2GEXA 3FF2A 4FCMA 3MG1A 3ECFA 1NDOB 4N6LA 1OUNA 3N8BA 3SEDA 3EN1B 3FZWA 1OHPA 1UUWB 1EQKA 2Y73A 5KP1A 3K63A 3JUMA 4FR9A 1YIT3 2K0MA 3BB9A 1M904 4MMXB 4L7KA 1F8NA 1TU5A 1D6YA 3MG2A 3FSDA 3MYTA 2WOHA 3LT8A 5KP4A 1IVWA 3NM2A 1US1A 4K1VA 4O3VA 2IA7A 3FG4A 4U13A 2CK3H 3DGNA 3EHCA 1DVDA 1VQ53 2UX0A 1JKGB 3CD63 1HU9A 3NUVA 1JNQA 3KSPA 1VQ43 4FMCA 1WNHA 3MHEA 4WHAA 3H51A 1PFPA 4H61A 3WOEB 1IV7A 3CCE3 1JKGA 1AVLA 4KVHA 3X41A 3BNBA 2ZL8A 3N54B 2PNCA 1RRLA 2CWVA 3S5CA 4HM1B 3EC9A 1N9JA 3RGRA 3G8ZA 3IMAB 5IG3A 1IVVA 2MC8A 2OQEC 1O7GB 4LEHA 2CG1A 4HKVB 1NB5I 5I97A 2LQVA 4OVMA 3V99A 3PZWA 2I9WA 3IJEB 1FGQA 1VQL3 2CH9A 3DGMA 3JUPA 1IVXA 1E97A 3D9RA 4H3UA 4HM6B 3UL6A 1IK3A 3G6E3 1Q40A 3LOYA 1ZO2A 4K1UA 3FF0A 3AMOA 5IG4A 3K7CA 2YFJB 1W02A 2W9QA 3EN8A 3I0YA 3O8YA 1Q814 2KRTA 4N6NB 4R4KA 2BT3A 3JUQA 4AKZA 3WA3A 3I553 3F8HA 4RNYA 4NREA 2CG0A 3LTAA 1RKYA 3SLUA 3X3ZA 4KFDA 1Q40B 1NU3A 4FMBA 2OWPA 1VQ93 3CNMA 2HMMB 4ORLA 4XBTA 5LC6A 1YI23 1FGOA 3NM7A 1IQXA 1L5GB 1Q824 1YJ93 2O9UX 3B8LA 3STDA 4MJDA 3GAXA 4BTYA 3J7Yd 1KWIA 2D1WA 3KKGA 2XSHB 1K28A 3GZRA 3NBBA 2BMQB 5IG0A 3B7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z7A A;  1GY5 A;  2XSO B;  4WWU C;  1EG9 B;  3HZP A;  3MG3 A;  1ZX2 A;  3GRD A;  3IPT A;  1JN5 B;  3OV4 A;  1A2K A;  4WYK B;  5EVH A;  2HMJ B;  1E3R A;  1HKX A;  5JPU A;  3GZB A;  3F8X A;  4HM6 B;  2STD A;  5D81 A;  1JB4 A;  3BLZ A;  2K54 A;  3DM8 A;  3NHX A;  4GB5 A;  2GEX A;  3DMC A;  3FF2 A;  4FCM A;  4HM7 B;  4HZ9 B;  4RZM A;  3SOA A;  1GYB A;  3MG1 A;  3ECF A;  3JUN A;  1NDO B;  3T8N A;  1ISK A;  1OUN A;  3HX8 A;  5AIF A;  4HM5 B;  4I4K A;  4HZB B;  3SED A;  1Q42 A;  3EN1 B;  3FZW A;  1OHP A;  1UUW B;  3Q90 A;  3ROB A;  3WMD A;  5KP1 A;  1O7P B;  1GY7 A;  3JUM A;  3GZX B;  3HK4 A;  1ASK A;  5AIG A;  5IG5 A;  1S5A A;  1OF5 B;  3BB9 A;  3EBY A;  4HJL B;  5IER A;  5CK6 A;  2BNG A;  4HM8 B;  4IIA A;  4HVN A;  4L7K A;  1K41 A;  2INX A;  2QGU A;  1OGZ A;  4L8P A;  2R4I A;  3CNX A;  2RGQ A;  3FSD A;  3MG2 A;  1ULJ B;  1SJW A;  4XM4 A;  3MYT A;  2IMJ A;  3UJM A;  1GS3 A;  3FLJ A;  3VGN A;  3NM2 A;  3B4O A;  5KP4 A;  4K1V A;  2PZV A;  4U13 A;  3F14 A;  3LZA A;  3NXJ A;  3G16 A;  1U5O A;  3EHC A;  1TP6 A;  2UX0 A;  1JKG B;  2B1X B;  3MSO A;  4X2H A;  5HGR A;  3NUV A;  4CDL A;  4XDW A;  3F40 A;  3KSP A;  6STD A;  1DMN A;  3A76 A;  1O7M B;  1W6Y A;  1JB5 A;  4HM2 B;  3MHE A;  2HMK B;  1CQS A;  3H51 A;  4Q53 A;  4R1K A;  2F99 A;  4LGQ A;  4XDV A;  3UNL A;  3EBT A;  2RFR A;  4LMI A;  3OXA A;  3DXO A;  1JKG A;  4HM0 B;  1WQL B;  2B24 B;  1ULI B;  3G0K A;  4KVH A;  2HMO B;  1OHO A;  2Z77 A;  5IEP A;  1O7W B;  1C7H A;  1Z1S A;  3OWY A;  3S5C A;  3FKA A;  4HM1 B;  3EC9 A;  5CXO A;  3OWU A;  2HMN B;  2GBX B;  2Z76 A;  3G8Z A;  4L8O A;  3RGR A;  5KP3 A;  5IG3 A;  3LYG A;  3EF8 A;  3DZL A;  1W01 A;  2QIY A;  3CPO A;  1EA2 A;  3EQQ B;  3DUK A;  3K0Z A;  3GZY B;  3OX9 A;  3VSY A;  5JPP A;  1O7G B;  4LEH A;  4WYK A;  5DRE A;  1JN5 A;  4HKV B;  4J8T A;  5CLK A;  5FW5 A;  5AI1 A;  3E99 A;  4WP5 A;  2A15 A;  5CF2 A;  3FGY A;  3F7X A;  7STD A;  1O7H B;  4OUQ A;  4OVM A;  4STD A;  1O7N B;  1STD A;  2XRX B;  3OWS A;  4FCJ A;  8CHO A;  4R9L A;  1OHS A;  2I9W A;  1GY6 A;  5IEO A;  4N3V A;  2BMO B;  2JQ5 A;  2F86 B;  3JUP A;  3RGA A;  1E97 A;  1OPY A;  3D9R A;  1DMM A;  2GBW B;  2XR8 B;  3GWR A;  3MKI A;  4H3U A;  2RCD A;  1Q40 A;  1OF5 A;  1DMQ A;  3EX9 A;  1ZO2 A;  3NV0 A;  3H3H A;  4K1U A;  3KZT A;  3F7S A;  3FF0 A;  4XBY A;  3M8C A;  5D83 A;  5IG4 A;  3K7C A;  2YFJ B;  1W02 A;  3ER7 A;  3EN8 A;  1W00 A;  3I0Y A;  1OGX A;  5STD A;  3SOY A;  3CU3 A;  2GXF A;  3T8U A;  3JUQ A;  5AEU B;  1E3V A;  1TUH A;  3F8H A;  3KE7 A;  4HM3 B;  5DRV A;  1AR0 A;  5AEW B;  2YFL B;  1UUV B;  1BUQ A;  4J9A A;  4HM4 B;  4X2O A;  1JB2 A;  2HML B;  1VZZ A;  3F9S A;  5BXQ A;  2W2C A;  1QJG A;  1Q40 B;  3EJV A;  1NU3 A;  2OWP A;  3B4P A;  3CNM A;  2F98 A;  2HMM B;  4ORL A;  4XBT A;  3NBR A;  2BMR B;  1IDP A;  2GEY A;  1QMA A;  4R9K A;  5G2G A;  3NV0 B;  4XBX A;  1NWW A;  3JUO A;  4PEJ A;  5TGN A;  3B8L A;  3STD A;  4MJD A;  3FH1 A;  4XB5 A;  2CKF B;  5AII A;  5D82 A;  5CF1 A;  2YFI B;  3KKG A;  5AIH A;  2XSH B;  5IF6 A;  3GZR A;  1OCV A;  2BMQ B;  1OH0 A;  2CHC A;  5IEN A;  5IG0 A;  5BVB A;  3B7C A; 
#chains in the Genus database with same CATH topology
 1UUG B;  1V58 A;  2XSO B;  1AY7 A;  4IT7 A;  4WWU C;  3MG3 A;  1T2I A;  2CX1 A;  3IPT A;  1A2K A;  1W5Z A;  5JPU A;  1KC8 4;  3HIG A;  4FCZ A;  1JB4 A;  3NHX A;  3BND A;  4NHF A;  1SIH A;  3SOA A;  1I3F A;  1TRQ A;  3T8N A;  1I0V A;  5AIF A;  2IUK A;  1N8Q A;  4HM5 B;  4HZB B;  4J5K A;  2WGQ A;  3Q90 A;  2RNT A;  1O7P B;  1CH0 A;  1GY7 A;  2D42 A;  3DH2 A;  1ASK A;  3HK4 A;  3NQY A;  1S5A A;  1JBR A;  5IER A;  1U8C B;  2CX0 A;  2C4B A;  2AAD A;  2CFL A;  2LYX A;  2P0X A;  2R4I A;  4QWT A;  3PGB A;  2OOV C;  2KXG A;  1G0T A;  1A2P A;  1GS3 A;  3PXM A;  2FXT A;  1K73 4;  3UB1 A;  4BTX A;  3LZA A;  4OK0 A;  4DKI A;  1B2Z A;  2XF3 A;  3D4A A;  3MSO A;  4IPB A;  3WR2 A;  1N8R 4;  1RDS A;  4XDW A;  5AYS C;  3U1W A;  1JJ2 2;  2UGI A;  1DMN A;  1Q7H A;  3CPW 2;  2E2T A;  1JB5 A;  4HM2 B;  4LSO A;  3T0U A;  4EC6 A;  2HMK B;  3LTB A;  2F99 A;  2CIU A;  2XFS A;  1UI8 A;  3CCS 3;  4HOH A;  5A0O B;  4K90 B;  3WHO A;  3OXA A;  4HM0 B;  2QEX 3;  1STF I;  4J5G A;  2HMO B;  4CJN A;  2Z77 A;  5HOH A;  5IEP A;  1O7W B;  1C7H A;  3S29 A;  1QAK A;  3OWY A;  1M1K 4;  1AVK A;  5CXO A;  3OWU A;  1N9E A;  4BU4 A;  4L8O A;  3SYU A;  3EF8 A;  2QIY A;  3CPO A;  1CEW I;  3VSY A;  1BSD A;  3DUK A;  3OX9 A;  4GSP A;  4N6M A;  1RTU A;  1UW1 A;  1TJD A;  1S72 3;  1X1U A;  5AI1 A;  2CW9 A;  1NJI 4;  3F7X A;  3X3X A;  4STD A;  1STD A;  3OWS A;  5FW5 A;  3CXC 2;  1RCL A;  4R9L A;  1RRH A;  1JBS A;  1GMR A;  1BSE A;  4N3V A;  2BMO B;  2JQ5 A;  2F86 B;  2W56 A;  1RGL A;  3RGA A;  1OPY A;  5D83 A;  4EV5 A;  2CFG A;  1UCJ A;  1OF5 A;  2IUJ A;  4XBY A;  5M19 A;  3CC2 3;  3DGY A;  1W00 A;  1SQW A;  1R4Y A;  2P38 A;  3T8U A;  1B20 A;  3V98 A;  2OTJ 3;  1E3V A;  3KE7 A;  2OQE A;  5DRV A;  5AEW B;  2YFL B;  1BUQ A;  1FW7 A;  1MWU A;  1JRQ A;  1SPU A;  4J9A A;  2H0I A;  4KFE A;  3K9M C;  1MGR A;  4HYZ A;  4MMZ B;  3NX0 A;  2W9P A;  2P05 A;  1BRH A;  1EUI C;  1LXE A;  1UCK A;  3X40 A;  2Z6B A;  2P0M A;  4K61 A;  1QMA A;  1RGE A;  4EYC A;  3NV0 B;  1BVI A;  3U97 A;  1NWW A;  2BHM A;  1FUS A;  2H0G A;  1T3B A;  3FH1 A;  3CCL 3;  2CKF B;  5AII A;  3D5I A;  5CF1 A;  3S67 A;  5AIH A;  1FGR A;  2JDI H;  1OH0 A;  2CHC A;  3RNT A;  5IEN A;  2BU4 A;  1YVB I;  3BNC A;  2CWT A;  5LC7 A;  1RSN A;  3SXX A;  3DY5 A;  5EQL A;  4R80 A;  3TDG A;  1EG9 B;  3HZP A;  1RGA A;  1ZX2 A;  3OV4 A;  1JN5 B;  3AGN A;  4BIR A;  1BNJ A;  3EE1 A;  2HMJ B;  1BU4 A;  4WYK B;  1MOL A;  5EVH A;  1VQM 3;  2W6J H;  5D81 A;  3BLZ A;  1UGH I;  4HZ9 B;  2MF7 A;  1W2Z A;  4RZM A;  1GD4 A;  1KD1 4;  1ISK A;  2FGT A;  3ZG0 A;  3JUN A;  1MWT A;  1LQG C;  1IQ8 A;  1I8V A;  1BRS A;  1Q42 A;  1YNV X;  1RGH A;  4O8S A;  3LT9 A;  1OF5 B;  1IU7 A;  4LYL B;  4EV2 A;  3DGL A;  1RMS A;  4HM8 B;  4IIA A;  3D79 A;  1K41 A;  1IT7 A;  4WFO A;  1GSP A;  4KZ1 A;  1UCI A;  1BNE A;  1FGM A;  3WA2 X;  2RGQ A;  2XEP A;  3AMO B;  1GMQ A;  1ULJ B;  1SJW A;  3LXU X;  2IMJ A;  3EB8 A;  1D6Z A;  3FLJ A;  1VQP 3;  3B4O A;  1N5H A;  1WMN A;  1DVC A;  1YVS A;  4HBR A;  3CC4 3;  3G16 A;  1LQM B;  3KFQ C;  2E2V A;  2B1X B;  3CCJ 3;  1IVU A;  1GOV A;  1YHQ 3;  3CMA 3;  4CDL A;  1CYU A;  1RNT A;  6GSP A;  1I0X A;  2OCT A;  1WTH A;  3FG1 A;  1O7M B;  1BNG A;  1RLS A;  1RGG A;  1PU4 A;  4XDV A;  3UNL A;  3CME 3;  1TFO A;  2W03 A;  4MMY B;  4EW5 A;  1X1W A;  1SAR A;  4KFF A;  2B24 B;  1BUJ A;  1OHO A;  4CCV A;  2SAR A;  3CCU 3;  1A67 A;  1FA3 A;  3RDE A;  3CC7 3;  2HMN B;  2GBX B;  2Z76 A;  1TIJ A;  5KP3 A;  1J2B A;  3LYG A;  3K0Z A;  1FUT A;  2L4V A;  3DZL A;  1EEJ A;  3EQQ B;  4X2H A;  5CF2 A;  3GZY B;  1MGW A;  4ILF A;  4WYK A;  1JN5 A;  2K3D A;  4J8T A;  5CLK A;  1X1Y A;  3Q1C A;  4I5Q A;  1I2F A;  1YGW A;  2WOF A;  3E99 A;  4WP5 A;  2A15 A;  5IW9 A;  2O3O A;  2WO0 A;  3FGY A;  3G71 3;  1O7H B;  1EKM A;  4OUQ A;  2ML6 A;  1RNB A;  5AYR B;  2XRX B;  4FCJ A;  1OHS A;  2GU3 A;  1D6U A;  3GWR A;  1BIR A;  3WOD G;  3X3Y A;  2CFK A;  1K8A 4;  3Q2P A;  2RCD A;  3EX9 A;  3NV0 A;  3H3H A;  3KZT A;  2YX9 A;  4MEI A;  1LNH A;  1GOU A;  1OGX A;  1AV4 A;  2GXF A;  3DGO A;  4O2H A;  4AEQ A;  4HM3 B;  1AR0 A;  2E2U A;  1JB2 A;  3AHW A;  3F9S A;  5BXQ A;  2W2C A;  1QJG A;  3HOH A;  3EJV A;  1Q9E A;  1I3I A;  3HI7 A;  1BAN A;  2W04 A;  2C10 A;  3CCV 3;  1N5P A;  4N6T A;  2ML5 A;  2F98 A;  3CCR 3;  3LH4 A;  2GEY A;  1IQY A;  1YIJ 3;  4N6V 0;  4XBX A;  4O02 B;  1V57 A;  5TGN A;  4PEJ A;  1TFK A;  4EBG A;  4RBN A;  2RSX A;  3V92 A;  4G1M B;  2W56 B;  5GSP A;  2YFI B;  2ZHX B;  3KII A;  1PYL A;  2C11 A;  5JBS A;  1G96 A;  2V1L A;  1Q86 4;  2XGL A;  1UDI I;  5BVB A;  1VQ6 3;  2Z7A A;  1W7C A;  1T2H A;  3JVC A;  4LZI A;  2KF4 A;  4FMD A;  1GOY A;  1BAO A;  3Q3F A;  9RNT A;  7GSP A;  1OAC A;  2STD A;  2CFW A;  4HM7 B;  1NNV A;  1WMP A;  2BO9 B;  3DMC A;  4GB5 A;  1GYB A;  2R41 A;  1Y4K A;  3AHS A;  3HX8 A;  4I4K A;  2KCD A;  3I56 3;  3ROB A;  3L0R A;  3WMD A;  3NQZ A;  5AIG A;  7RNT A;  1ROA A;  3GZX B;  2F5W A;  4RNT A;  1W6C A;  1BSB A;  3EBY A;  4HJL B;  1RCK A;  5CK6 A;  2BNG A;  2ZDJ A;  1LOX A;  1QAL A;  3VF1 A;  1B2U A;  1BNI A;  2INX A;  2KF3 A;  3KN4 A;  4HVN A;  3FG3 A;  2QGU A;  1OGZ A;  3HII A;  3PCS A;  1M1X B;  4L8P A;  1VQQ A;  3CNX A;  1RN7 A;  1YJN 3;  1RGF A;  1CYV A;  1YGE A;  4XM4 A;  3UJM A;  3VGN A;  3QRD A;  1QVG 2;  3X42 A;  2PZV A;  3SVA A;  3F14 A;  1BSA A;  1NB3 I;  3NXJ A;  1U5O A;  1TP6 A;  3BIR A;  4N6U A;  2QA4 3;  1TTO A;  2XH9 A;  5HGR A;  1PY3 A;  5EEO A;  3UL5 A;  3F40 A;  6STD A;  1R4C A;  1BNF A;  3BNE A;  2XFT A;  3LML A;  1KQS 2;  2UUG C;  3A76 A;  1W6Y A;  2FNQ A;  3CCM 3;  1LOW A;  1CQS A;  4Q53 A;  4BL3 A;  1Q7Y 4;  4FMA A;  4LGQ A;  1KSI A;  2AAE A;  5G1L A;  3ALA A;  3EBT A;  1DYU A;  2RFR A;  4LMI A;  3PS8 A;  2H0H A;  1WQL B;  3G0K A;  1ULI B;  6RNT A;  1NO3 A;  3S28 A;  1T5Y A;  1VQ8 3;  1BOX A;  1ROV A;  1Z1S A;  2F4Y A;  3FKA A;  4JRF A;  3ZG5 A;  1A2V A;  1FUW A;  4EXR A;  3G4S 3;  1W01 A;  5JPP A;  1EA2 A;  2OTL 3;  3PCR A;  4AKY A;  1V74 A;  3WOF B;  1IV9 A;  1UGI A;  5DRE A;  3OW2 2;  1VQ7 3;  1GD3 A;  7STD A;  2IYJ A;  1BSC A;  1O7N B;  8CHO A;  5IEO A;  1GY6 A;  1LVN A;  2ZA4 A;  8RNT A;  1SII A;  1HZ1 A;  1GMP A;  4HAA A;  3LTC A;  4R9K A;  4R1K A;  1DMM A;  2GBW B;  2SBL A;  2XR8 B;  3MKI A;  5IG5 A;  1VQO 3;  1RGK A;  1DMQ A;  1W2B 2;  3WDG B;  1FZU A;  1LRA A;  3F7S A;  3M8C A;  3SX1 A;  3N9H A;  1WMO A;  1UCL A;  3ER7 A;  2OOV A;  5STD A;  3SOY A;  3CU3 A;  2GSP A;  2M7O A;  3GSP A;  1JV2 B;  5AEU B;  1TUH A;  2XGN A;  1I2E A;  1K9M 4;  1VQK 3;  1UUV B;  1ZS7 A;  4HM4 B;  4X2O A;  3PYJ A;  3QK9 A;  2HML B;  1FGT A;  1VZZ A;  2CWU A;  3LTD A;  1VQN 3;  1JBT A;  3FCS B;  1IT8 A;  2WGO A;  3B4P A;  1QAF A;  4ZM8 A;  5ELJ A;  2KF6 A;  3NBR A;  3AGO A;  2BMR B;  1IDP A;  3MPH A;  5ELU A;  1DET A;  5G2G A;  2P09 A;  5BIR A;  4N6O B;  3S27 A;  2W0Q A;  3JUO A;  4XB5 A;  3D3L A;  4TX4 A;  2Y74 A;  5D82 A;  5FGO A;  5IF6 A;  1MNL A;  2Q07 A;  1UI7 A;  1OCV A;  2BIR A;  1RN4 A;  3K5T A;  4GL6 A;  1A90 A;  3DXO A;  1LOV A;  3KSE D;  1RJO A;  4BTW A;  1GY5 A;  1W4N A;  4RNZ A;  3MWZ A;  3GRD A;  2GU1 A;  1YJW 3;  1E3R A;  1HKX A;  1M9G A;  1W6G A;  3GZB A;  3F8X A;  3NBJ A;  4JF8 A;  2F5M A;  4BL2 A;  5RNT A;  2K54 A;  3DM8 A;  3CCQ 3;  2CC3 A;  1MWS A;  2CFD A;  2GEX A;  1ZGX A;  3FF2 A;  4FCM A;  1C54 A;  3MG1 A;  3ECF A;  1NDO B;  4N6L A;  4KT3 B;  1OUN A;  3N8B A;  5G1K A;  3SED A;  3EN1 B;  3FZW A;  1OHP A;  1UUW B;  1EQK A;  2Y73 A;  1BRG A;  1I70 A;  3JUM A;  3K63 A;  4FR9 A;  5KP1 A;  1YIT 3;  2K0M A;  3BB9 A;  2HOH A;  1TRP A;  1M90 4;  4MMX B;  4L7K A;  1JZD A;  1F8N A;  1TU5 A;  1D6Y A;  3MG2 A;  3FSD A;  3A5E A;  3MYT A;  2WOH A;  1MWR A;  3LT8 A;  5KP4 A;  1IVW A;  3NM2 A;  1B2M A;  1US1 A;  4K1V A;  4O3V A;  1BGS A;  2IA7 A;  3FG4 A;  4U13 A;  2CK3 H;  3DGN A;  1B2S A;  3EHC A;  1DVD A;  1I2G A;  1VQ5 3;  2UX0 A;  1JKG B;  1G02 A;  3CD6 3;  1HU9 A;  2L1S A;  3NUV A;  1JNQ A;  3KSP A;  2IY2 A;  1VQ4 3;  4FMC A;  1WNH A;  4NPB A;  2KF5 A;  1X1X A;  3MHE A;  4WHA A;  3H51 A;  1AQZ A;  1PFP A;  4H61 A;  5M18 A;  3WOE B;  1IV7 A;  3CCE 3;  1JKG A;  1AVL A;  4KVH A;  3X41 A;  3BNB A;  2ZL8 A;  5BU4 A;  3N54 B;  2PNC A;  1RRL A;  2CWV A;  5M1A A;  1HYF A;  2RBI A;  3S5C A;  4HM1 B;  3EC9 A;  1N9J A;  3RGR A;  3G8Z A;  3IMA B;  5IG3 A;  1IVV A;  1BRJ A;  2J8X B;  2MC8 A;  2OQE C;  1O7G B;  4LEH A;  2CG1 A;  4HKV B;  1QVF 2;  1NB5 I;  1IYY A;  5I97 A;  2LQV A;  4OVM A;  3V99 A;  1BNR A;  3PZW A;  1B2X A;  3BU4 A;  2I9W A;  3IJE B;  1BRN L;  4CPK A;  1FGQ A;  1VQL 3;  2CH9 A;  1B27 A;  3DGM A;  3JUP A;  1IVX A;  1E97 A;  3D9R A;  1BRK A;  3KCH A;  4H3U A;  4HM6 B;  3UL6 A;  1IK3 A;  3G6E 3;  1Q40 A;  3LOY A;  1ZO2 A;  4K1U A;  3FF0 A;  1RGC A;  3AMO A;  5IG4 A;  3K7C A;  2YFJ B;  1W02 A;  2W9Q A;  3EN8 A;  3I0Y A;  3O8Y A;  1Q81 4;  2KRT A;  4N6N B;  4R4K A;  2BT3 A;  3JUQ A;  3D5G A;  4AKZ A;  1JZO A;  3WA3 A;  3I55 3;  3F8H A;  4RNY A;  1LOY A;  4NRE A;  2CG0 A;  2KAA A;  3LTA A;  1RKY A;  3SLU A;  3X3Z A;  4KFD A;  1Q40 B;  1NU3 A;  4FMB A;  3ZFZ A;  1DE3 A;  2OWP A;  1VQ9 3;  3CNM A;  4GHO A;  1B21 A;  2HMM B;  4ORL A;  4XBT A;  5LC6 A;  1YI2 3;  1FYS A;  1FGO A;  1BRI A;  1IQX A;  3NM7 A;  1L5G B;  3URP A;  1Q82 4;  1YJ9 3;  2O9U X;  3B8L A;  3STD A;  4MJD A;  1RHL A;  3GAX A;  4BTY A;  3J7Y d;  1KWI A;  2D1W A;  3KKG A;  2XSH B;  1K28 A;  3GZR A;  3NBB A;  1RN1 A;  1B3S A;  2BMQ B;  2F56 A;  1BNS A;  5IG0 A;  1LNI A;  3B7C A; 
#chains in the Genus database with same CATH homology
 2XSO B;  4IT7 A;  4WWU C;  3MG3 A;  3IPT A;  1A2K A;  1W5Z A;  5JPU A;  1KC8 4;  3HIG A;  4FCZ A;  1JB4 A;  3NHX A;  3BND A;  4NHF A;  1SIH A;  3SOA A;  3T8N A;  5AIF A;  2IUK A;  1N8Q A;  4HM5 B;  4HZB B;  2WGQ A;  3Q90 A;  1O7P B;  1GY7 A;  2D42 A;  3NQY A;  3HK4 A;  1ASK A;  1S5A A;  5IER A;  1U8C B;  2CFL A;  2LYX A;  2P0X A;  2R4I A;  3PGB A;  2OOV C;  2KXG A;  1GS3 A;  3PXM A;  2FXT A;  1K73 4;  3UB1 A;  4BTX A;  3LZA A;  2XF3 A;  3MSO A;  4IPB A;  1N8R 4;  4XDW A;  5AYS C;  3U1W A;  1JJ2 2;  1DMN A;  3CPW 2;  2E2T A;  1JB5 A;  4HM2 B;  4LSO A;  3T0U A;  4EC6 A;  2HMK B;  3LTB A;  2F99 A;  2CIU A;  2XFS A;  1UI8 A;  3CCS 3;  5A0O B;  4K90 B;  3OXA A;  4HM0 B;  2QEX 3;  1STF I;  2HMO B;  2Z77 A;  5IEP A;  1O7W B;  1C7H A;  3S29 A;  1QAK A;  3OWY A;  1M1K 4;  1AVK A;  5CXO A;  3OWU A;  1N9E A;  4L8O A;  3EF8 A;  2QIY A;  3CPO A;  1CEW I;  3VSY A;  3OX9 A;  3DUK A;  4N6M A;  1UW1 A;  1S72 3;  5AI1 A;  2CW9 A;  1NJI 4;  3F7X A;  3X3X A;  4STD A;  1STD A;  3OWS A;  3CXC 2;  4R9L A;  1RRH A;  4N3V A;  2BMO B;  2JQ5 A;  2F86 B;  2W56 A;  3RGA A;  4EV5 A;  1OPY A;  5D83 A;  2CFG A;  1OF5 A;  2IUJ A;  4XBY A;  3CC2 3;  1W00 A;  1SQW A;  2P38 A;  3T8U A;  3V98 A;  2OTJ 3;  1E3V A;  3KE7 A;  2OQE A;  5DRV A;  5AEW B;  2YFL B;  1BUQ A;  4J9A A;  1JRQ A;  1SPU A;  4KFE A;  3K9M C;  4HYZ A;  4MMZ B;  3NX0 A;  2W9P A;  2P05 A;  1LXE A;  3X40 A;  2Z6B A;  2P0M A;  4K61 A;  1QMA A;  4EYC A;  3NV0 B;  3U97 A;  1NWW A;  2BHM A;  3FH1 A;  3CCL 3;  2CKF B;  5AII A;  5CF1 A;  3S67 A;  5AIH A;  1FGR A;  2JDI H;  1OH0 A;  2CHC A;  5IEN A;  3BNC A;  1YVB I;  2CWT A;  5LC7 A;  3SXX A;  3DY5 A;  5EQL A;  4R80 A;  3TDG A;  1EG9 B;  3HZP A;  1ZX2 A;  3OV4 A;  1JN5 B;  3EE1 A;  4WYK B;  2HMJ B;  5EVH A;  1MOL A;  1VQM 3;  2W6J H;  5D81 A;  3BLZ A;  4HZ9 B;  2MF7 A;  1W2Z A;  4RZM A;  1GD4 A;  1KD1 4;  1ISK A;  2FGT A;  3JUN A;  1IQ8 A;  1Q42 A;  4O8S A;  3LT9 A;  1OF5 B;  1IU7 A;  4EV2 A;  3DGL A;  4HM8 B;  4IIA A;  1K41 A;  1IT7 A;  4WFO A;  4KZ1 A;  3WA2 X;  1FGM A;  2RGQ A;  2XEP A;  3AMO B;  1ULJ B;  3LXU X;  1SJW A;  2IMJ A;  3EB8 A;  1D6Z A;  3FLJ A;  1VQP 3;  3B4O A;  1N5H A;  1WMN A;  1DVC A;  4HBR A;  3CC4 3;  3G16 A;  3KFQ C;  2E2V A;  2B1X B;  3CCJ 3;  1IVU A;  1YHQ 3;  3CMA 3;  4CDL A;  1CYU A;  2OCT A;  1WTH A;  3FG1 A;  1O7M B;  1PU4 A;  4XDV A;  3UNL A;  3CME 3;  1TFO A;  2W03 A;  4MMY B;  4KFF A;  2B24 B;  1OHO A;  4CCV A;  1A67 A;  3CCU 3;  1FA3 A;  3RDE A;  3CC7 3;  2HMN B;  2GBX B;  2Z76 A;  1TIJ A;  5KP3 A;  1J2B A;  3LYG A;  3K0Z A;  2L4V A;  3DZL A;  3EQQ B;  4X2H A;  5CF2 A;  3GZY B;  4WYK A;  1JN5 A;  5FW5 A;  4J8T A;  5CLK A;  3Q1C A;  5IW9 A;  2WOF A;  3E99 A;  4WP5 A;  2A15 A;  2O3O A;  2WO0 A;  3FGY A;  3G71 3;  1O7H B;  1EKM A;  4OUQ A;  2ML6 A;  5AYR B;  2XRX B;  4FCJ A;  1OHS A;  2GU3 A;  1D6U A;  3GWR A;  3WOD G;  3X3Y A;  2CFK A;  1K8A 4;  3Q2P A;  2RCD A;  3EX9 A;  3NV0 A;  3H3H A;  3KZT A;  2YX9 A;  4MEI A;  1LNH A;  1OGX A;  1AV4 A;  2GXF A;  3DGO A;  4O2H A;  4AEQ A;  4HM3 B;  1AR0 A;  2E2U A;  1JB2 A;  3F9S A;  5BXQ A;  2W2C A;  1QJG A;  3EJV A;  3HI7 A;  2W04 A;  2C10 A;  3CCV 3;  1N5P A;  4N6T A;  2ML5 A;  2F98 A;  3CCR 3;  3LH4 A;  2GEY A;  1IQY A;  4N6V 0;  4XBX A;  4O02 B;  5TGN A;  4PEJ A;  1TFK A;  4EBG A;  4RBN A;  2RSX A;  3V92 A;  4G1M B;  2W56 B;  2YFI B;  3KII A;  5JBS A;  2C11 A;  1G96 A;  2V1L A;  1Q86 4;  2XGL A;  5BVB A;  1VQ6 3;  2Z7A A;  1W7C A;  3JVC A;  4LZI A;  4FMD A;  1OAC A;  2STD A;  2CFW A;  4HM7 B;  1WMP A;  2BO9 B;  3DMC A;  4GB5 A;  1GYB A;  1Y4K A;  3HX8 A;  4I4K A;  2KCD A;  3I56 3;  3ROB A;  3L0R A;  3WMD A;  3NQZ A;  5AIG A;  1ROA A;  3GZX B;  1W6C A;  3EBY A;  4HJL B;  5CK6 A;  2BNG A;  2ZDJ A;  1LOX A;  1QAL A;  3VF1 A;  3KN4 A;  4HVN A;  2INX A;  4OK0 A;  1YIJ 3;  1QVF 2;  3FG3 A;  2QGU A;  1OGZ A;  3HII A;  3PCS A;  1M1X B;  4L8P A;  4QWT A;  3CNX A;  1RN7 A;  1YJN 3;  1CYV A;  1YGE A;  4XM4 A;  3UJM A;  3VGN A;  3QRD A;  1QVG 2;  3X42 A;  2PZV A;  3SVA A;  3F14 A;  1NB3 I;  3NXJ A;  1U5O A;  1TP6 A;  4N6U A;  2QA4 3;  2XH9 A;  5HGR A;  5EEO A;  3UL5 A;  3F40 A;  6STD A;  1R4C A;  3BNE A;  3LML A;  2XFT A;  1KQS 2;  3A76 A;  1W6Y A;  2FNQ A;  3CCM 3;  1CQS A;  4Q53 A;  1Q7Y 4;  4FMA A;  4LGQ A;  1KSI A;  3ALA A;  3EBT A;  1DYU A;  2RFR A;  4LMI A;  3PS8 A;  1WQL B;  3G0K A;  1ULI B;  1NO3 A;  3S28 A;  1T5Y A;  1VQ8 3;  1ROV A;  1Z1S A;  3FKA A;  4JRF A;  1A2V A;  1FUW A;  4EXR A;  3G4S 3;  1W01 A;  5JPP A;  1EA2 A;  2OTL 3;  3PCR A;  4AKY A;  1V74 A;  3WOF B;  1IV9 A;  5DRE A;  3OW2 2;  1VQ7 3;  1GD3 A;  7STD A;  1O7N B;  8CHO A;  5IEO A;  1GY6 A;  1LVN A;  1SII A;  3LTC A;  4R9K A;  4R1K A;  1DMM A;  2GBW B;  2SBL A;  2XR8 B;  3MKI A;  5IG5 A;  1VQO 3;  1DMQ A;  1W2B 2;  3WDG B;  3F7S A;  3M8C A;  3SX1 A;  3N9H A;  1WMO A;  3ER7 A;  2OOV A;  5STD A;  3SOY A;  3CU3 A;  2M7O A;  1JV2 B;  5AEU B;  1TUH A;  2XGN A;  1K9M 4;  1VQK 3;  1UUV B;  4HM4 B;  4X2O A;  3PYJ A;  3QK9 A;  2HML B;  1FGT A;  1VZZ A;  2CWU A;  3LTD A;  1VQN 3;  3FCS B;  1IT8 A;  2WGO A;  3B4P A;  1QAF A;  4ZM8 A;  5ELJ A;  3NBR A;  2BMR B;  1IDP A;  3MPH A;  5ELU A;  5G2G A;  2P09 A;  4N6O B;  3S27 A;  2W0Q A;  3JUO A;  4XB5 A;  3D3L A;  4TX4 A;  2Y74 A;  5D82 A;  5FGO A;  5IF6 A;  1MNL A;  2Q07 A;  1UI7 A;  1OCV A;  3K5T A;  4GL6 A;  1A90 A;  3DXO A;  3KSE D;  1RJO A;  4BTW A;  1GY5 A;  1W4N A;  4RNZ A;  3MWZ A;  3GRD A;  2GU1 A;  1YJW 3;  1E3R A;  1HKX A;  1M9G A;  1W6G A;  3GZB A;  3F8X A;  3NBJ A;  4JF8 A;  2K54 A;  3DM8 A;  3CCQ 3;  2CC3 A;  2CFD A;  2GEX A;  3FF2 A;  4FCM A;  3MG1 A;  3ECF A;  1NDO B;  4N6L A;  1OUN A;  3N8B A;  3SED A;  3EN1 B;  3FZW A;  1OHP A;  1UUW B;  1EQK A;  2Y73 A;  5KP1 A;  3K63 A;  3JUM A;  4FR9 A;  1YIT 3;  2K0M A;  3BB9 A;  1M90 4;  4MMX B;  4L7K A;  1F8N A;  1TU5 A;  1D6Y A;  3MG2 A;  3FSD A;  3MYT A;  2WOH A;  3LT8 A;  5KP4 A;  1IVW A;  3NM2 A;  1US1 A;  4K1V A;  4O3V A;  2IA7 A;  3FG4 A;  4U13 A;  2CK3 H;  3DGN A;  3EHC A;  1DVD A;  1VQ5 3;  2UX0 A;  1JKG B;  3CD6 3;  1HU9 A;  3NUV A;  1JNQ A;  3KSP A;  1VQ4 3;  4FMC A;  1WNH A;  3MHE A;  4WHA A;  3H51 A;  1PFP A;  4H61 A;  3WOE B;  1IV7 A;  3CCE 3;  1JKG A;  1AVL A;  4KVH A;  3X41 A;  3BNB A;  2ZL8 A;  3N54 B;  2PNC A;  1RRL A;  2CWV A;  3S5C A;  4HM1 B;  3EC9 A;  1N9J A;  3RGR A;  3G8Z A;  3IMA B;  5IG3 A;  1IVV A;  2MC8 A;  2OQE C;  1O7G B;  4LEH A;  2CG1 A;  4HKV B;  1NB5 I;  5I97 A;  2LQV A;  4OVM A;  3V99 A;  3PZW A;  2I9W A;  3IJE B;  1FGQ A;  1VQL 3;  2CH9 A;  3DGM A;  3JUP A;  1IVX A;  1E97 A;  3D9R A;  4H3U A;  4HM6 B;  3UL6 A;  1IK3 A;  3G6E 3;  1Q40 A;  3LOY A;  1ZO2 A;  4K1U A;  3FF0 A;  3AMO A;  5IG4 A;  3K7C A;  2YFJ B;  1W02 A;  2W9Q A;  3EN8 A;  3I0Y A;  3O8Y A;  1Q81 4;  2KRT A;  4N6N B;  4R4K A;  2BT3 A;  3JUQ A;  4AKZ A;  3WA3 A;  3I55 3;  3F8H A;  4RNY A;  4NRE A;  2CG0 A;  3LTA A;  1RKY A;  3SLU A;  3X3Z A;  4KFD A;  1Q40 B;  1NU3 A;  4FMB A;  2OWP A;  1VQ9 3;  3CNM A;  2HMM B;  4ORL A;  4XBT A;  5LC6 A;  1YI2 3;  1FGO A;  3NM7 A;  1IQX A;  1L5G B;  1Q82 4;  1YJ9 3;  2O9U X;  3B8L A;  3STD A;  4MJD A;  3GAX A;  4BTY A;  3J7Y d;  1KWI A;  2D1W A;  3KKG A;  2XSH B;  1K28 A;  3GZR A;  3NBB A;  2BMQ B;  5IG0 A;  3B7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...