2GY5A

Tie2 ligand-binding domain crystal structure
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
423
structure length
423
Chain Sequence
b'AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIPRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Angiopoietin-1 receptor
molecule tags Transferase
source organism Homo sapiens
publication title Crystal structures of the Tie2 receptor ectodomain and the angiopoietin-2-Tie2 complex.
pubmed doi rcsb
total genus 89
structure length 423
sequence length 423
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10430 Ig_Tie2_1 Tie-2 Ig-like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gy5A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gy5A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gy5A02
2.170.300.10 Mainly Beta Beta Complex Tie2 ligand-binding domain fold Tie2 ligand-binding domain superfamily 2gy5A03
1CCZA 3F12B 4C83B 2W9DL 1AGEA 1JNLL 4L3AA 2K3TA 4U0RB 4RGOH 5C08E 2PYEE 4EDXB 3QJHA 1QYGL 4G6AC 4WW2F 3SDCC 3T0EB 1UB5A 4F57H 2QBWA 3QNXA 5JR1H 2EO1A 1MFNA 3L95B 4L4TD 4PV9A 3HNTL 2QR0A 4JZJC 3C60D 4PPTA 3ZE0E 4LASH 4QNPF 4Y5VC 1OARH 4HUMB 2HLAB 3W39A 5HI5C 3ESVF 5I8KH 2E9BA 1F3JB 4HLZH 4HPYL 4ONHB 4K7PH 3VJ6A 1IC7H 2A0LD 3OBAA 4XI5D 4D9RE 1ZVHA 4RAUA 1H0DA 1U91B 4K3JL 3EOBB 2VZ1A 1DDHA 1NCCH 3GJFH 2VIRA 4JAMA 4N9OB 5FM5M 1I75A 2ARJB 5TF1L 3C8KA 3WYRA 3RWCA 1ZA3B 5DEZA 1RJCA 1RUMH 4YC2C 4Y4KD 1DLHB 2YC1B 1C1EH 3QQ3A 2APXA 4M6ML 1KB5A 2R1XA 3JWNC 4POYA 1S9XB 4WUKL 4BUGA 4LNRA 3DLQR 1GGIL 4HFWA 3H8NA 2E7CA 4Y19B 3U4BH 2YUXA 1KULA 4C56E 5CKAA 5HVWA 5T1KD 2YD3A 4M7JH 3DNKA 4UDUB 3QISA 1VGKB 4KK5D 2LQRA 2XA3A 4NKMA 4Z0XB 4KZDL 5EIIA 3PL6C 3PWNB 2W59A 1A6TA 2F5BL 4OFKA 4PJ8C 1ACYH 4HG4K 1R3JA 2V17L 4LGRB 1M71A 1KEMH 3JV5A 2PTUA 4L9LC 5FECA 4GLRH 3QQ9D 4EN3C 4GBXD 1ZWIA 4MYWB 2VAAB 5FAAA 4YXHL 3MJ8B 1ETZB 5AWNL 1BJ1H 1NLDH 5D2NC 2ITDB 2Z93A 4JZOA 3U83A 3QUXA 3TH2T 3BEVB 1ZMYA 3HE6D 3MNWB 4JHAL 4NC1E 4WDIA 4GG6A 1MCDA 4FXLA 1XGQB 3QDGE 2JELH 4NCDA 4YR6B 1FNEB 3LDBC 4OCSL 1QSED 4UI2A 1MJUL 1MCKA 1N3NA 3V5DB 5DDHB 1OGTB 1ZKAA 6CGTA 4MZ2A 1P4BH 1DEEA 4PJDB 3KNBB 1EEZB 1WBYA 3O8XC 1NMCC 1UA6L 2LAGB 2BNQD 5IW1A 4C58B 1CU4H 4LRIA 1K4DB 4JRYA 2LV4A 5LGKA 1A6VL 4MX7A 4XCNB 4HW6A 5I2IB 4OIAA 4CGTA 4NBXB 4L9LB 4PD4J 3TVMA 5CINL 1OCWL 3F62A 3VW3L 3MBXH 3QXVA 4MVBD 4YXKH 4ELMF 1A1MB 4RGMC 5FYLE 1V3JA 5DQDL 4FABH 4M93C 1FNGB 5GRJH 1OY3B 3QDJE 1NDGB 4OZGF 3PDGA 1UADC 5JLZA 2R2CA 3S3SA 4FP8L 4X6EA 4I5BB 2MMXA 3GMPA 1AH1A 5H37H 4TNWF 5BW7A 2OLDA 3P4LA 4POZD 2UZYB 4QF1A 2ATPA 4ONFH 3B2VH 3RDTD 5IEHB 4WU5B 2NLJA 1NC2A 4TSAL 5HGDB 2YK1L 3BP5A 1YC7A 5JPMA 3U36B 4ALAH 3MUGA 3PDOA 5K9JH 3WIHA 3NPSC 3HRZA 3L5JA 3EO0B 1JF6A 5CBAA 5GXBB 4PJ9C 1KYOJ 5F7MC 5F6HJ 2CDGB 5CZVL 2WBWB 1TZIB 1NGXB 5C0DB 2NXYD 4M1DH 1G84A 3ULUH 1RIUL 4S2SB 3DRTB 5FA3B 4NQXB 1R5IA 3CSPA 4K07A 4KTEL 3MRLA 3DVIA 1FFOA 2VXUL 4G6FB 3ZKQD 5GJTL 3VI3E 3VH8A 2JB6B 2Q86A 3A6BL 2NNAB 3EFDH 3QUYD 4JJHA 1CDBA 3SDCB 3LPFA 2K1MA 4CVWA 4Y16D 5LQBL 4OT1L 3RY6C 1NGPL 3D85B 2CJUH 2BHUA 4DUXA 2EXWD 3JXAA 1VACA 2VL4A 3UTSA 3I6GA 5ALBL 3MGOA 5IBLC 3HZYA 2P24A 2VLLA 3O9WD 5C0CE 2DIBA 4Z76A 4P3DB 3BP4A 3ZDYE 2EDWA 3TPUA 3LKRB 1JRHL 2VLKA 3BRDA 5FO7B 3V5KA 2A83B 3K4AA 3KPMB 3RTQA 2R29H 1KCVH 3ARUA 1T1YB 4YFEA 4NIKB 2CKNA 5GZOC 3A6CH 3ARED 3GK8L 5IEKB 4UTBH 2DM4A 4LQ1A 1ZANH 4GRWH 1J05B 3FKUS 2ICWA 4MLSA 3LKQB 5B8CA 3O4LE 4Y4KA 1S3KL 4F7MB 1ACZA 1RURL 2X4RA 3UROR 3L3GB 4NO2A 2YS4A 2RJMA 4IOFC 5F3BA 3LRGA 4MXQD 3IU4H 2C1PB 1YEKH 1FH5H 1RMFH 4L4VD 3TBYB 3I02A 1QVOB 4PRPB 4YLQT 2VDQH 5ANMA 1JF1B 3WKNA 4Q9RH 1F2XK 4XGZA 4KK8C 2IADA 4G9FE 3UTTB 3DXAE 1SYSA 2W60B 3EJJX 4JKPL 4OFIA 1KTDB 2BOBA 5L2JB 3MNZA 3NAAL 4NPYB 5E7BA 1IKFH 5DLMH 5E2TH 4FQLL 4N9GA 4GG6F 2YKLL 3UO1H 1HYSD 3QO1A 3HA0A 2XTJB 4IRSD 3SBWC 4LLWA 1KLGB 3DVGB 4OAWB 3QXAB 5BO1L 1X5LA 5BMFH 3IXTA 2QSQA 1E4XI 2D7OA 1R3LB 4E41E 3VRJA 2MFNA 4JM4L 2GQHA 4JG0L 1OAXH 4U1LA 3L5WA 1WIOA 1I1AD 2DYPB 3I3EA 5DJAA 3SJVE 5HPOA 4BZ2L 4Y2DD 1IC5L 5ESAB 3KPOB 4GS7B 5CEZE 2E7BA 4MGXA 2WUCH 1I8LA 1IAOA 2IBZY 5EN2B 5TDOB 3T4YB 5CWSA 5IFJB 2BNRB 4OF5A 1BQLL 4J7RA 2VLMD 4G8IB 4FABL 1IM3B 3EOTH 4RMUA 4XMPL 3V4UL 1QEWA 3ULVD 5CP3A 4OD1H 5DSCA 1JRHH 3BX7C 4NNXB 4XBEL 3W11C 4LLUB 2R4RL 4YZFE 1KCVL 2GT9A 1MFEH 2Q6WA 5B3JF 2ENYA 3WE6B 4GKSB 1D6EA 2Z92B 3B9AA 1A6UH 4JY4B 2NY2B 1S5HB 4JO1H 4U0RC 3MZTA 5DMGD 4EIZC 2YD9A 1QSEE 3CLEL 5E08L 3FFCD 3QULA 3RL1A 5KN5A 3FRUB 4NKOA 4MMZC 1B6UA 3MV9A 2YUVA 4NRYB 3B5GA 1WTGT 3WIHH 3O6LH 3PWUA 2B2XL 2AXGB 1NH6A 1RZJH 1YZZA 3T77B 1S7SA 2VQ1A 4J3WA 2GJZA 4YHLH 4IIQC 1FFRA 4FZEH 3D0LA 2VN4A 4HFUL 1X5IA 4UBDC 4UV4H 3QUYA 2XPGA 5E4EC 1IFHL 1LO2H 5JHDA 5FGCE 3DV6A 3OGOE 4M61B 2AV1A 2VAJA 3I50L 2AJ3A 3E3QC 1UXSB 5ISZD 4HUUA 4D9LL 4DWHA 1CN4A 4JQXC 1VKXA 5DD3L 3GGWB 4PJCF 4OT1H 3VD7A 1LEIB 4OZHA 5MEOA 5AZEH 3EJZD 1ORSA 1K5NB 1W0VB 1UH4A 2KQNA 2VITA 4RMTA 2Y5TB 3BE1L 3Q6FB 4B41A 2CLVB 1L6XA 4XPAL 1SEBB 5FGBA 3QR2A 2R0KH 1A0QL 1KXVC 2HTKD 3MZGB 5FDYA 4JFZL 3RY5A 4HWNA 4X4ZA 2X9XA 3RIAK 3D0VA 3GO1L 4M4RA 4HS8L 3BESR 4GJTB 3MOBL 4LHJB 3WFCL 4PJIE 4QOKA 4AEEA 4S10A 1TZGL 4D9RD 4EDWH 4GQ9L 5IQ7L 4PJEB 1X7QB 5K9QI 3GBMH 2R4RH 5C0IB 3IDIA 1TIUA 3RKDD 5C0NC 2XIDA 1JYNA 1DSFH 4DN4H 2HJLB 5EO9B 5DTFA 1S7RA 1T0PB 1YEKL 5IR1B 4G9FA 3SKNB 1D5XA 3HMXL 5ACZB 3CLEH 4YBHA 1F6AB 1LD9A 5F89A 5DMKB 4NHCL 1MWAA 1IGIH 1LNUA 4RAHA 5K93A 2Z0BA 1MY5A 4XPBL 1BZQK 1RFDH 1XR8B 4JFEE 2WP3T 4OF8A 3C5ZA 4MNHB 5E99L 5F44A 5IHLB 4XH2B 4KKBD 4LAJH 5I8CA 1LO2L 2F5AL 1CFVH 4E5XB 3QYCA 1BECA 4ODTL 4RGND 2X2YA 4XXDB 5ESQA 2CDEA 4JFPA 3TZVA 1NGWA 5J9PB 3HPLA 2XA8H 1NC4A 4JRWA 5EPMA 4LF3A 2F54A 2QQNL 1A9BA 3FAWA 3V52H 1FVEA 5D7JD 4WU7B 2BVPB 1YY9C 2FJFA 2V2WA 3D87B 5GSVA 2ADFL 4RMWA 4J3SA 4GW4A 4M7LL 3HLAB 1I1CA 4D0BA 4HAFA 4CAGA 2AGJH 2EDXA 32C2B 5DJ0B 4XVSH 3MGAA 2WM0A 4DOHB 2VXQL 4QTHA 3FAXA 2UVFA 1CGXA 1FIGL 4B7LA 4X5XA 4PJHE 2Z31B 2RCSH 3G6DL 3Q5TA 2IJ0C 4PBVC 2X4PA 1JGVL 4I3SH 4X0KB 3BQUC 1U8MB 3B9KA 3GJFK 1QSVA 5FF6B 4N0RA 4YDIL 2DIAA 4N0YL 4P46C 1ZXQA 4KKNA 2J8HA 4X7DC 5FUOL 4Y1AB 2Z8VC 5EOTB 1KELH 3P40A 1YYLL 2E7LA 3HUJE 5D72L 4FQXC 1Q0XL 4PJAA 1ITCA 5E8PA 2E8ZA 3C2AL 4FRWA 3LN4A 1AFVH 2IGFL 1KB9K 2J88L 5IJKC 4F7CB 4OI8A 4CJ1A 1S5IL 4UV4L 2G9HA 3ULVE 5KVMC 4OZIF 3EUUA 5SWZA 3RP1A 5J0BA 1U8NA 3K0WA 1XF4B 4JVUA 4X5LA 3GSNB 4NO3A 5J13C 3VFRA 2IAMB 4G9DB 4ZO6A 4ZXBA 3BD4A 3HAEA 4YO0B 1AGBB 1JPGA 1BWWA 4F7TA 3RWGA 4GKNA 3MLSL 4ODVH 2RHEA 4K7PY 2VLJB 2CMRL 5EG6C 3ABZA 1AGCA 2DQHL 1YPZA 2KDGA 1J0IA 4MQ7A 1Q94B 3FQRA 1Z5LB 2HVJB 1MRDH 3CVHH 3OKOB 5CD5D 1F11B 5TE7H 4XCEB 2LAAA 2YZ8A 1PZ5B 4JGJA 3VFGH 4MLIA 4XRCA 5GJSL 3QXDB 1EFXD 2AV7A 2JK5B 4DEPB 2GK0B 1GL4B 5IJKA 5ESVA 1WAAE 1FJ1A 3VFWA 4KJYA 4QHUB 4HS3A 2OJEB 4KXZH 4MJID 4GAFB 3MLUH 4HWUA 1LK3L 3V6OE 1J1PH 2FD6L 1WLHA 1S8DA 2OJEA 3FFDB 3VG0L 4KJYB 4QHUA 5IBTH 1D6VH 5HDOA 4QYOA 4LLVA 3CH1B 2EIEA 1FORH 2VDOH 3GSUA 5B22A 5B3JE 1HINH 4WHYH 4ORGA 1WK0A 5JNYA 5KSAA 1VERA 4X4YB 5KTEH 4PJAF 1UM5H 4CU6A 1EO5A 1UCBH 1XH3B 4I0PB 1HI6A 3OKOA 2CIKB 5AG9A 1E6JL 2GJ6D 3BIBX 1PKQE 1N0LA 1AD0A 4R2GC 1ZVSB 3B9VA 4JN2B 3KXFD 4ZUUA 3GSOA 1X5ZA 2DJSA 5E1AB 2YRLA 4N0FB 3LPGA 3K2UL 4EJ1C 4GKNB 4JFXB 1REIA 4Y4HA 4QRUB 4ISVB 5I15L 2M1KA 3V8CA 3QZWB 5IKCA 2COQA 1J12A 2IAMA 2VZVA 3BZ4B 2DQFB 5EC1A 3KYNA 1UWXH 4W81A 2E27L 4HT1H 1P9MA 4MSWA 2XXMB 3OKEA 4OZFH 4XNMA 1F90L 1OWWA 3D48R 3QUZB 4PJFE 3HE7B 2X4UB 2G9HB 5A1AA 1WF5A 1FN4A 2G5BB 3I9GL 4LVOB 3WNPA 4ZNEA 4JFFA 4PJCE 4R4FH 4KMTH 5GS0H 1BJMA 1ZGLA 3AC0A 4WO4B 4LAQL 3ILQC 1SM3L 4PJAB 1ZHKB 2Q87A 2DF3A 3VE0A 2QQKH 1L0QA 5EOTA 4LSSH 4H1LA 4H25B 3LIZH 3V4VH 2HT2D 3GB7A 3P77A 4ZAKA 5FF6A 4N1EA 1TPXB 1YEIL 1TJHL 3SKMA 2I07A 4BFIA 3BGFB 3MJ9A 5F9OH 4N8CL 1M6OA 2GW5A 5FV2A 2X4PB 3IJHB 5CJBA 1IGTB 5HHXH 4PFEA 2B1AL 3RVUC 3ZE2E 2UVEA 2EH7L 5ID0B 5KG9A 2YUWA 2HT3C 1OP5K 1FO0H 3CFBA 3X12A 5DRZA 1F13A 3AXLA 3HLAA 3LH2L 4QEGA 2KQMA 2OXHA 1CDUA 1UXWB 4XAKD 2BFVL 5EOCH 3QHZL 2I27N 4C59B 4PUBL 3REVA 3ZL4H 2DQCH 2PCPB 3GMOB 2WQRA 2ZKHL 3HPLB 5ESQB 5J9PA 1PG7X 2NY5L 1DLFH 3KJ6H 4WW2B 4JCLA 5T1LD 35C8L 1A7NL 1CLYH 5JW3H 5I15H 1VB9A 1IGCL 2GY7B 2DAVA 1W8NA 4PJBE 4WWID 4L8CA 5BV7B 5C8JA 1A6WH 1XR8A 1KTLA 1E4KA 3V7MA 5J89A 4NQDE 3BXNB 5C3TA 3IDGB 5DMYA 1R5WB 4JR9H 5HHPA 3RPIB 4RDQG 4Z78B 4ZOEA 3STZA 1MWAB 5KSBE 1OW0C 3GFUA 5C0CB 5DMKA 5GRVL 5DMIH 1V5JA 2VR5A 3U4EB 5K59E 4NN5B 5ACZA 1FGNH 5IQ9B 3LEYL 4D3CL 4X4XA 4CADB 4G9FB 3SKNA 3UTTE 4LARL 1R3IL 4KUCD 5IR1A 3CFEB 5SV3A 3QNZB 2HJLA 3QDMA 1BFTA 1EFXA 1OSZB 1TITA 2C5DC 3O0RL 4PY8J 5C0IA 5L6YL 1BM3L 5DRWA 1LO5B 1N59A 3AS3A 1J86A 4PLKC 3WJJC 3FB6A 3G6JF 3VA6A 3FRPG 1WUNT 2W0FB 2QV2A 2W91A 4HZLA 4XHJC 1HILA 4LLMA 2P5EA 4JFYA 2BSSB 4HH9A 1XAUA 5C0AD 3MOAH 4PV8B 1FO0L 1G0XA 4DKFL 3W5MA 3MPCA 3IGAB 4YNYA 3BKCH 1LK2A 3RWFB 4MXWH 1HE7A 2VITB 4MAYD 4P2CG 3O3EA 1Q9WA 1RJZA 5L8KB 5MEOB 3ZDYF 4KKCD 1T89A 4LSTL 4JDVB 3WUWA 3MRMB 2E6QA 5JMOC 4HUUB 5JPNA 1LP9E 5IK3A 2AJ3B 1BX2A 4HT1L 2X42A 3DPBA 4JHWH 4HH8A 5HD8D 3EFFA 35C8H 4LVHB 4OZGA 5JPNB 3IFLL 3MV8E 4KROD 3ULVL 4KMTL 4RX4A 4KVCL 4HUVA 3NIGF 3QIUD 1CGVA 4R8WH 3VXRD 1GZPA 4TOYH 5ISZB 3M17A 3QT2A 4XNUL 3RJQB 3AM8C 4WTWA 1RJZB 1ACYL 1Q9WB 2FX8L 3O3EB 2AXGA 4QXUL 3K7UA 4M7KH 2XZAL 2BNRE 2EZ0D 1LK2B 1AGFA 3RWFA 2WBJC 3VI4E 2MCPH 1BFVH 3IGAA 3FRUA 4U1HA 5E24E 5D7LE 2P5EB 4JFYB 4HZLB 1JZ7A 1D6EB 1F00I 4Q6IB 3ARDD 3L6FA 1MI5D 1B9ZA 1AIFB 1FZJA 2EDKA 4OGXH 5D71H 5ICXB 1HXMA 4JO3H 4RSVA 4FZ8H 4I8DA 4TUJB 4KTDH 1GGCL 1DBKL 4OKDA 4FQ1H 1IM3A 1RZKL 1PX4A 4OFVA 1BZ7A 1OSZA 3QFJB 5AZ2L 2BNRA 5T3XL 3QNZA 4K71B 2A6DA 4M48L 5EN2A 4MQTB 3HNSH 4X4XB 5DT1L 4JDTL 3KPOA 5ESAA 4CU7A 3J8F7 1NL0H 4MHHG 3IRZA 4R4NC 4DKFH 2CLRB 1ZLVK 1IGML 3OXRA 2H2PC 4UINH 2AJYL 1U0QA 1TQBB 2L7UA 2CKBB 3IKCB 3CFCH 3KJ6L 4YDVA 2JJSC 5HHPB 1CK0L 3IXTB 2DS4A 2E7MA 3IDGA 3WIFA 3RGHA 4XNXL 4GXUN 4TVPD 3S36L 5ID1A 5C8JB 3NIFE 1JPST 1QA9A 3PWPB 3GMQB 4M6OL 1OTSD 4WI8A 5CLWA 1S7VB 1S7XA 4XNYL 1RZIB 2HG5A 3WD5L 1NCAL 1BQSA 1KTDA 1VGEL 3IFLH 3WFHB 2W60A 4XCFH 3ARZA 3UTPD 1QRKA 1JF1A 4S1RL 2NY3D 2WBJB 3TBYA 1J0JA 3GIZH 2V5TA 3GBNH 4BK4A 2FSEA 3C5SA 4WO4C 1KJ2B 4H8WC 4UT7L 3HRPA 5C70A 1HN1A 5F3BB 4HK3J 4TQEL 5D2NA 4Q0XL 3WXWH 5DRZB 3IU4L 2X4RB 3CFBB 4XP4L 2GSIB 2VDRL 3UJTL 1KCLA 3LKQA 1CLOL 2ICWB 4Z7UB 1MQ8A 2I60L 1YJDL 5IEKA 3QDME 1FFNA 2PXYD 3PJSB 1ZT4B 5CBEB 5M94B 4TYUA 4R0LB 4Z7WF 3WLWD 1M6OB 1OAYL 5FO7A 5JIPA 2DM7A 2I07B 2VZ3A 3WNKA 4D9QD 3BSZH 3LKRA 3TPUB 2H6PA 3MREB 3BP4B 3VRIA 4Z76B 4ZAKB 2QKIA 1J8HE 3P77B 2P24B 2VLLB 3KYMA 3SJVD 5T1MA 1DP0A 3UTSB 1ADQA 3DYMA 3U0TB 3RZCA 2XKUA 1NPUA 3VE0B 4G7VL 2IANE 3MJ9H 5HJ3B 4LRIC 1ZGLB 2CGRL 4X7FC 3D85D 3OJVC 5F1KC 3SDCA 2D4DA 4JFFB 8FABB 4FNLL 1FN4B 2G5BA 4PG9A 3LS4L 2ZUUA 3HE7A 1H3UA 5DK3A 1IJ9A 4RX4D 2O93L 3O2WL 1UKTA 1TVHB 2XKNA 1FAIH 4S2SA 4NCC2 1EGJL 5HHQB 2DQFA 2PYEB 3IYLW 5A2FA 1CDGA 1TZIA 2ZUQC 2J8UB 4D0CB 3QZWA 3MX0A 5F7YC 1GGUA 5DFTA 4QRUA 4GAYB 4JFXA 3DWTA 4ZS7L 4O4YL 3HRZB 5SX4I 5DFVD 3PDOB 3UBXA 5C08B 1QSFE 4JN1L 5JPMB 1T04B 2OTWA 1IAIH 2V2TA 5HGBA 3RX5A 4ZUUB 3ARDA 5K33A 1Q72H 1RMFL 4QF1B 1DBML 1AD0B 2WUCL 3EHBD 4RA3A 4WHTB 1QKZL 4X7SL 5E9DD 3SDDC 4DEPC 4F80A 4JKWA 5EA0H 1XH3A 1BFOB 3BUYB 1WWBX 1LO4H 3SE4C 1T7WA 3QEQA 3WIHL 3EOTL 4ORGB 3C08H 4MJIB 3O6KH 1NDGA 1WFUA 5I75B 3CH1A 4LLVB 2DLFL 1EDQA 2O5YH 2C3XA 4WFGD 5C07E 4YBQD 1J8HB 1VFBA 4WTZA 2AKRB 1IFHH 1RUQL 2BHZA 2PUQT 4YPGA 2J8UF 4OZFB 3IS0X 2I9LB 4L9LA 3PWPD 2IPTH 2BY3A 1K2DB 2EECA 1W72B 4JFFE 5DMJB 3MV7B 5IMMA 4P4KC 1WBYB 4PJDA 4P5TA 3CU1A 1T2QL 3EDKA 5CP3H 4MZ3A 4U7KA 4ODWA 5GISH 1YNKL 3ZO0A 1KFAL 1N3NB 3S88H 1MHPH 4LPYA 4XCEA 1R3HA 1HYSC 3RI5K 1OGAD 3KLDA 4FQ2H 3ZKND 3QUMB 2HVJA 1XGQA 2P45B 3PF2A 1XGUA 3FQRB 2DKUA 1MHCA 1GRWA 4H1LG 4OCLC 3A0OA 1T0MA 4WDIB 5MERB 3MNWA 1F4AA 3BEVA 4XCFL 1DANU 1T03H 1G9NH 2LE9A 4F7TB 4L3EB 2Z93B 1AGBA 3ZYIA 4J4PD 5EUOA 1KPRA 5KANG 2VAAA 1QFWH 1WTLA 4ZXBB 2J7LA 3KDMA 4UV7H 3VFRB 1JTTA 5FECB 5D5MB 1CIUA 3OAUL 2NW2B 2OX5A 5TGBB 5GRUH 3QUZC 5T1LB 4U1MA 3ULUD 2NY0D 4FQCL 4AYFA 4G3YH 2H8PB 3WCYA 4F9LA 2NR6C 4Z95H 1RZ7H 1S9XA 4LSRL 4Y1AA 5I1JL 3KR3H 1T66D 3NZHH 5HPMB 1DLHA 2YC1A 3UDWA 1ZA3A 3QDJB 3B9KB 1U8MA 4U2ZA 2VIRB 4X0KA 2DTMH 2PYFB 5DUPL 1U91A 3DUUB 1HKLH 5C0RL 1EO8L 1TVDA 3MCLL 4RAUB 4BYHA 3MR9A 1RUPH 4X5XB 4HKZB 4DK6A 3BYYA 4F57L 2VR4A 4GLRI 4EZMA 2C7UA 2XA8L 1AD9B 1CE6B 2D7TH 1YPZE 4D0BB 2P8MA 1H5BA 3TWCL 5DA4A 3U6RB 3H7BA 5I1AB 3WO3B 3GO1H 2IG2L 2QR0B 1LILA 3SDYH 1QNZH 1QSFD 1FP5A 4M02A 1A9BB 2F54B 5EPMB 2BVOA 1MUJB 3ARBB 4MA8L 1NANI 1NGWB 2VXQH 4JFPB 2HT4C 4MA7H 4K3JH 1T1WB 1TCMA 4YXLL 5GS2H 4C83A 3QWQB 4HZAA 3CVHA 5I8CB 1MCLA 3KLHC 1AQDA 2XRAL 2O5ZH 3CXDH 5KANI 4M6MH 5DHXB 4ZPTB 3D39E 2O26U 5FYJH 2A6KB 1Y0LB 3SDAC 3BDXA 2AQ1A 3DMMB 3ZT7A 3MBXL 1HIMH 1XR9A 3CIQA 5FCUH 3ARVA 4AH2B 1KG0B 1I4FA 3DVFA 5F89B 3KPLB 4AK1A 1A7PH 3FB5A 1D5XB 1XMWA 3SPVA 5AG8A 3S34L 1MAJA 1A7RH 4QRPD 2YD5A 3H2WA 1S7RB 4XPTL 1F3DH 1NAKL 1CF8L 3ARPA 4FFVD 1JF5A 1OGAA 4LCYB 2R2EB 2GI7A 5DEGA 3LQMA 4JLRB 4ORZC 3NTCH 3HMWL 4X99B 5FKPB 2H9GB 4IBLT 5D1XC 1MHPL 3V6ZB 3L3OA 1SYVA 2V7HA 1B0GA 4OLVH 3BEWB 4KVNH 2VWEC 3OKDB 4ZTPH 2CLVA 3LVEA 4FQPA 3RWEB 5DC9B 2Y5TA 5D1QC 2NY1B 3EO9H 2C4FU 3MCG1 4H20L 3BN9D 4DVBA 2ITCA 5F72S 2ZCKL 4L1HA 5EU7C 4Z7WE 5GZND 3GGWA 4QRRD 1Q9LB 3Q6GH 4NGHL 4KUZL 1UZ6E 5LGJB 1UKSA 4YDIH 2VZTA 1T20A 4LU5H 4XNQB 1UXSA 5DZOA 3OAUH 4I0PC 2ESVE 4M61A 4C4KO 3M8OH 4ZQKA 4P3CL 4F37K 3C2AH 5KSBB 5BXFA 5I9QB 4PB9L 5GGQH 4PGEA 2PNDA 4LCUA 3VFPA 4L9DA 1INEL 1D5IH 5GJSH 2WIIA 2YD1A 3T65A 3LDBB 5C71A 2HA1A 4H1LH 5JDJA 3V0AC 4PB0L 3T77A 1A21A 1MY7A 2EDLA 3PWUB 5JQ6L 3QIUB 2PW2B 3MYZA 1PLGH 1MFAL 3JWDL 5H37G 3S35H 4B53A 4M1GL 4LIQE 3VFSA 4C57C 3QULB 2ZWLT 3CXHJ 4Y5YA 3S35X 3GMRB 1B4JL 1SHMA 1QZ1A 1QFUL 2WSKA 4ODSH 4JY4A 4D8PA 1YEEL 3MRCA 5D1QA 2Z92A 2Z91A 3MLWH 3I2CL 3LQAC 5K9JL 4K3GA 3OTTA 2Q6WB 4P2OC 2GT9B 1U8QB 2J3SA 4TSCL 1CFBA 5HHME 2DQIH 3K2UH 1P5VA 3W5NA 1J9CT 4AZ8A 4WCYL 1NUFA 2D7PA 4U2YA 1QEWB 1U36A 3WNMA 2BXYA 4UIMA 5H35A 2BSRB 4KK9D 3D3VE 4G8IA 4DK3A 2AK1H 2Q8AL 1UM4L 5KTEL 5KSBF 4HK0A 5CWSB 4I1NB 2AABH 4OZHE 1WEJL 2YA0A 4M5ZH 3GMNA 4JKLA 4F9LC 2HFGH 5I8KL 4ELME 2XTJD 5GS0C 1P7QA 1MAMH 5DJAB 2DYPA 1A1OB 1CGSL 3ARGB 1E28B 1ZLVH 3VRJB 2VLME 1BQHB 3CMOL 2EDHA 3C5JA 4P57A 1LK3H 3ZZ1A 3U0WH 3DVGA 1CE1L 3MA9H 4LLAA 1RUML 3WFDH 4GMSL 4WEMB 3Q6GL 3WNOA 2YN5A 5JZ7C 2ADIA 3IF1B 5FGCB 3O3UN 3MNZB 2BOBB 5L2JA 3SQBA 4RZCB 1AHWB 3N85H 2VDPH 3N9GL 2NY3B 1OLZA 4Y5XC 1JZ4A 3FQXA 1FYTD 1SYSB 3D39D 2FHCA 1FHGA 4JVWA 4WFEE 5F9AC 1F02I 5ERWB 2C1PA 2K7PA 1YJDC 2E5EA 5IBUB 3T0ED 3MGTB 4P23C 4P9ML 2ZUQB 4L8DA 4QOKD 5DHVH 1KGCE 1JWMA 3O4LD 3QG6B 4L4TB 4NO2B 3DSFH 3L3GA 4O51B 2NY6B 3A67L 3MRGB 1YMMD 5HYJD 2YR3A 4EI5B 3UZQA 5E08H 5B8CB 1XCQA 1J05A 4HEPG 4ODSL 3MLZL 3D3VB 4NWTL 2B1AH 4ZDHA 3BIAX 4NM4L 1KIUA 3EJYC 2IEPA 1T1YA 2DLHA 1A6AB 4XVTH 4YE4L 2A83A 3KPMA 3LD8B 4FZEL 2VLKB 4POZC 1P4IL 1KLFA 3U7AA 3U7YL 1YEFL 3EO9L 5F7LB 1X5YA 5D1XB 3P0YL 3PWJB 1VACB 3LV3A 1Q9KA 3D85A 1QFWM 4DAGL 5C86A 5BRZE 3EGSA 3V0WL 3FB8B 1OAXL 4NYLB 1NEUA 2EXYD 5F88B 1IC5H 4YHIA 4WTXA 3QFDB 4Z7UE 5I8OH 5IHZB 2B4CH 1FGNL 2XACC 2JIXB 1R5IB 5BJTB 2VTFA 5AZEL 1A02N 4NUGL 5KVDH 3QIWC 4XBGA 5HHXL 1CE1H 2J5LB 2CLZB 3B9KC 3F7PC 4XMPH 5F1IA 2DJUA 5C0BA 3DX7A 5T33H 1NMAH 2VXVL 4WFFD 5HYIA 1MCQA 1FE8H 4Q9BA 2VSDA 3EO0A 3IB4A 4R26H 5CSGA 3U36A 1G7IA 5IG7A 1Q38A 3ZHKA 3BP5B 5HGDA 1NC2B 2J6EH 1N2RA 1A4JA 5DMIL 4IRJA 3UJJL 5IEHA 2R23B 4FQIL 4J3XA 3QI9A 4DN3L 1VADB 1G7HA 1FCGA 4QHMA 2OK0H 2VDKH 3P2TA 4NZJA 3GSXB 2NYYD 3MLWL 4GFTB 3AREC 5FHBH 3IAPA 4MXWL 4X6EB 4JPKL 5D8JL 1EHAA 4PRAB 4ZXBD 1JE6A 4UILH 2F74B 3KPSB 4HPOH 2D0HA 1FNGA 1CFQA 3VXOB 4RNRA 4PS4H 2AK1L 4HC1L 4LHUD 5BOZG 4BZ1L 5DR5H 3PGFL 4G6KL 3UTSE 1S7WA 3BH8B 1H3GA 3E1F1 2VDNH 4IDJL 3IVKA 2AI0H 4YDLB 4OGAD 4MNQB 2R0WL 2D7QA 4BK5A 5I2IA 4ZODA 5CEZL 4YQXL 4V1DA 3KS0H 1EEZA 4GMTL 4KVCH 3S4SB 1IZKA 3HUJB 1DEEB 4GRWB 2FZ3B 3RVXC 1R24B 3TH3T 4DAGH 4OCRL 1NBZB 4MS8D 1CTOA 4M43L 4GXVL 1FSKB 1FNEA 4HWBL 4WEBL 1I85C 1EPFA 4ELKA 1HHKA 2R29L 4JANA 1L9NA 4O2EA 4BSWA 5T3ZH 1FZOB 1I9JH 4HBCH 1XGYL 1MCCA 4HS8H 1OAZH 2EKJA 2G75B 3O41B 1IM9B 4JZOB 1FZMA 3OGCA 3U0PB 25C8L 5F8QC 3UPRA 1ETZA 1ZWIB 1Y6NR 1FNHA 3RL2B 4LCCC 4YHKL 3LKNA 4LPXA 5AZ2H 3IJSB 3C6LC 4NKDB 3KPPA 1WVZA 3OF6D 3ULVC 4NNYB 4M8QB 3QG7L 1IAII 5D9SA 4O2FB 4LK4A 1I8KA 2AVGA 1QACA 1FSKC 1UZ6F 5LAXA 5E2VL 2AJYH 5F1OB 3SN6N 4JHWL 2FX9H 4PJDE 4X6FB 5ICZA 2VDMH 3UTZA 2AK4D 4CRPA 3BIKA 5E2UH 4Y8DC 4MHHI 5J12B 3GM0A 3R4DA 1QFOA 2HMID 1MCRA 1A7OH 5SWQA 1MREL 4DQOL 2HAZA 4DZBA 5IUSA 3SCMC 2I9TB 2F5AH 1MRCL 1DDHB 3OAYK 3PQYD 3T04D 4PRDA 2EYTB 1YECL 4I48B 4Q7DA 4EVNB 2R2HB 4I2XE 1TLKA 3BN3B 4ONHA 3IFPB 4XP1H 4ZO7A 1FVCB 4RQQB 5I8OL 2BNRD 1CK0H 1YEJH 3D2UD 3W39B 1UYWH 2FLBT 3W9DA 4OJFH 2IF7A 5IB5A 4U3CA 4C55A 1QSFA 5FCSH 5EU7E 1N7ML 4EUPA 2J1KA 1N6QH 3L95A 1CFTB 4HUNB 4NRZB 1F4WH 4WUUB 2A2QT 3TEUA 3T0EA 3BRFA 2X5PA 4LPWA 4EDXA 4ZNCD 4HBCL 2ZNXA 4M3JA 1AGEB 5J57B 1IE5A 4TNVK 3F12A 2XWTA 3STBA 3T3MF 2X9WA 2Q20A 4LHUB 2HN7B 1K85A 3BZFB 2X4SB 4S0SD 4UQ3A 5FEBA 2ZG1A 4C56A 1CDCA 1JHTB 5B39B 4M8VA 1CXHA 4YFLI 2NXZD 2OXGA 3E6FA 4QT5B 4Y2DB 1CFSB 4XNXH 2O5XL 5FKAB 4L3CA 1INQB 4RGOL 4AEIL 4M3KB 5B38G 3G9AB 4HC1H 5BZWA 5HYSB 5F9WC 2XZQH 4UT6H 2YMXL 2IANA 3S7GA 1VFUA 4ZAKD 5GS1A 4QWWC 2YWZA 1HINL 1X6NA 1CIDA 3ROLB 3RHWK 2GAZA 2YPKA 3QNYB 4HCRL 3PV6B 4R4ND 3X13A 3GMMB 2Q7NA 4XTRC 3C87A 3P0VH 4J3UA 2Z8RA 4PP2A 3MRRB 1I1YA 1BVZA 5TPWH 3FO2A 1CD9B 3SBWA 3U2SB 3PGCA 2CK0L 1U95B 1PG7L 1BP3B 4JFQB 1EMTH 5INDB 3R8QA 3L1OH 3SKOB 3OZ9L 4ODUB 5DJYB 2OZ4A 5A16B 3L3IA 3MROA 3U9UB 1LE5B 4ZS6C 3PL6B 2GJJA 1OTSC 1D7FA 4XP1L 2R0KL 1TQCC 1I7RB 1NGQH 4Y5XB 3TF7C 1HHHA 5KW9L 1K4CB 1AP2B 1XCTA 4XPFL 4G8GE 4RFOH 3CZFA 1MH5B 1I9JL 4OJFL 4RBPH 4U05A 4YGAB 3VFGL 1OARL 1WFTA 2V7NA 1KPUA 3UBXG 2OSLB 4L8SA 1I8MA 3E8UH 3DRQB 4P4KB 4OZFG 3GBML 4WO4D 1PY9A 1VDGA 3BP6B 2R8SH 2FEDC 3TO2B 4NKIH 3PWVA 5BCAA 5CJQL 5FFLA 4LKCA 3P4NA 4XWGH 5IB3A 4LSSL 5C0AA 3JTSA 1PX3A 5D96B 4U1GB 1JN6B 2A0LC 1U3HB 4MAYA 5E2VH 2BX5A 4OB5L 2EDBA 1YN7A 5JR1L 3QDMD 4H5SB 2Z35A 3NZ8B 1KBGH 5FGRA 2ZSVB 4KZEH 3HC3L 4OTXH 1ONQB 4IS6A 4JEGB 4A2MA 3ARYA 3EOAB 1EJOL 4S1SH 1FC1A 1T2JA 1A7OL 3ARGC 3WHXB 5JOEA 2YBRA 3F7VA 4Z7WB 1P7HL 4P4RB 5IM7B 1G7JA 4E0RB 5BZDA 3WLBA 1INDH 2Y7QB 4HPYH 4QRTA 1B90A 4YHYB 2XG4A 1I8LC 3MRPA 3TA3C 4U0QB 2JTDA 4AT6B 5JUEL 4XP5H 5AWNH 5J13B 4NZTL 5GGSB 4MCZB 1Q72L 3MV8B 3ETBF 5ENWB 4LFHG 3LY6A 3BO8B 3TT3L 3NOIA 1F6LL 2GTZB 1DL7H 3FQTA 3QRGH 4K7FB 3HZVA 4AQ1B 1C5CL 4FQ2L 3IAQA 4YWGL 5DJ6B 5H2BA 3AS0A 3IU3B 2AJSL 2AQ3A 1KLUB 1QLRA 5BVJB 4QO1A 5HHOB 3AMKA 1HHIA 4YGVA 3IETB 1W0YT 1KC5L 4GRLB 1TCRB 1KN4L 3WO4C 1MJUH 3BRGC 3GIVA 3GKWH 5EZJA 4BQ8A 4YAQA 4O5LL 2R69H 4XMLH 4ZFOB 1DR9A 1NAMA 3RI5F 1RUQH 2ESVB 2QQKL 1CL7I 2IFFH 5DWUH 4NQVA 4JHZA 2Y1VA 4KKAD 3LKPA 5E6IC 1WSST 4YC2B 1S78C 4OV5B 1CLZH 1HEZA 3MACL 3BPCA 5T3ZD 4ZFOA 2C4FT 5DI8B 2EYRB 3NGBB 5KVGL 2H41A 4GRLA 3IETA 4PG2A 5T5FL 2GFBB 5M7QA 6FABL 3IU3A 4NWUL 5DYOA 1CICC 4XC1L 2JJTC 1D5MB 4PR5A 1C5BL 3S37H 3FQTB 3WL9A 4UDTA 2GTZA 1EAJA 3H42H 5I1EH 1BVKB 3WMSA 4RFNB 2IG2H 3Q5YA 3FN3A 1JBJA 1ZEAL 1OT2A 2DLGA 4Z7VF 5B38A 3WS3B 4WHCA 4DGVH 4J3TA 3S3PA 4HJ0C 2P5WE 3BDYH 1R0AH 4ZSOE 2CH8A 3IS1X 4R97B 3TNMB 3OZ9H 4OBSA 4LCWA 5HDQL 5F1SA 1G9ML 2Z8WC 2Y7QA 1PYWB 1A4KA 1ND0B 5AYQA 5IM7A 4P4RA 4IJ3C 3RHWF 2VISA 2R9HC 4WWKD 4NQCA 5I76A 4HX1A 4B50A 5BQ7A 1ZHBB 5DVLA 1ONQA 4IS6B 4Y4HD 4FG6D 3NZ8A 4R3SA 2YN3A 1QR1A 3TGXA 4U1KA 4ENEC 2XWBB 3LEXA 4KKLD 2EH8L 4JCMA 4J4PC 3QA3B 4JFEB 4L4TE 5GGTA 2Z31C 2DKSA 4KK6D 1KN4H 1EGJA 1FZKB 2J4WL 1KTRL 4MQXD 4X8JA 4XPHL 1G7MB 1EXUB 2AJUL 1JPTH 2EKSB 3S5LG 2Z8SA 3O11A 5I1DB 3CK0L 4WY7L 3SDAB 3INUH 5K9KB 4P4KA 3VG0H 4X98A 3NCJL 4WIQA 3FO1A 1CF8H 5E56A 1I8MB 5DFWH 1BGXH 1FL5A 3ILQD 4TTDD 1G7PB 5CUSH 4HV8A 4PYGA 2NY6D 5IVOA 3CZFB 3LMJL 5DZNA 3SGEH 3G08A 3RPKA 4LSQH 3AMLA 1A7PL 1AP2A 2YPLE 4Y5XA 4AENB 1U3HC 1LE5A 1DBKH 5A16A 4JE4B 5IV2A 3SKOA 5INDA 1QBBA 4UUJA 3UTTD 1OT1A 3GZKA 2ZOLA 4LBEA 4DUWA 1U95A 1I9EA 3KPRD 4BH7B 2BDNH 1T5WA 1ZHLB 1J0HA 3I6KB 3MRRA 1AKJD 2HWZL 2O5ZL 3RX7A 4DGVL 1J0ZA 1GH7A 3TJHD 5J6GB 1I3UA 2B8OT 3FQUA 3PV6A 2OQJA 4MA3A 4NGHH 4PJHB 4J8RB 1KIQB 2X10A 4UAOB 2CDFA 2ICWJ 3B6SB 4AIOA 2IANB 1Q8MA 5DJZB 5BRZB 2EDQA 5J1AA 4HKXA 5BZWB 3RGVB 4NT6A 4OM0H 5EU5A 3WN5C 4ZNEE 2P8LA 3RBGA 2WP3O 3F7RA 4PRIE 5GRVK 5L9DL 1UC6A 1DBJL 5B39A 5EZIH 1GAFH 5B8CC 3T1FA 2D3VA 3BGFC 4F37F 1MVUA 4P9HH 3P9MA 4U7MA 4YEEA 5ALCL 4PJCA 3LIZL 1DZBA 5JQ6H 1HWGB 3NA9L 1JNNL 3PABB 1A7QH 2HFFA 2HN7A 5KS9F 1FYTE 3SDXA 1UH3A 3BAEH 2H32A 4RGNE 2XWTB 3QXTA 4YZFF 3KJ4C 1J1XL 3HMXA 1RSFA 3EYFB 1BQLH 4WY7H 5L2KD 1T4KB 3VFOB 2NPLX 4X80H 2BVTA 3BHBA 4OD1L 5C0GB 4WUUA 1XGTA 4NRZA 4FQLH 3RNQB 1CLOH 2NY2D 2YKLH 2NY7L 2Y36L 3D18B 3MV7E 2EDYA 3PUCA 5IB5B 2DQTH 3HE7D 3AS2A 1UM4H 3QEUB 5L88H 2BOCA 1PW3A 4LKXA 4LCIL 1G0YR 3B43A 4M93B 1FVCA 1WEJH 4RQQA 2IQAA 2Q7YA 1L4IA 4XAWH 4Y4FB 4EVNA 4FFWD 4I48A 1CICB 1ERNA 4YHYC 3CLFL 5E8EA 4HXBL 1L6ZA 1G9MH 1F58L 5FYLD 3V6OA 4JPWL 4JFFD 2EICA 5D4QA 3ARSA 3JSSA 3PQYE 1NEZG 2J2ZA 3TNNA 3NIDE 4JKMA 4BQ9A 3FB7B 4HDIB 5HHMD 2OJZL 3QCUL 3TNNB 1X4ZA 3UTZB 2AABL 5ICZB 2FX7L 3JWOC 4KV5F 5DVMA 3EO1A 1CICA 1EGJH 3BZDA 4I13B 4TSBH 2BMKB 3MOBH 1CGSH 1U3ZA 3Q0HA 3GHEL 2IQAB 5KZCD 5D9SB 5DHYA 4KY1L 3HE6B 3O2DH 3IJSA 1K9TA 4NKDA 4CVUA 5F6IB 3LKNB 3W82A 3RL2A 3H9SD 4XP4H 3U0PA 3QIUC 1XGTB 5ITFA 3Q2CA 1LO0L 1OQOA 5C0GA 3TV3H 2V9TA 4PJ7F 1NUNB 3BHBB 1JHKH 1E4XH 2EZ0C 3VXSD 4BSWB 4CMHC 4CMMA 1PZUB 2HFEB 1HHKB 1RK0A 2IWGA 4AJ0A 1NAMH 3O6KL 2DLFH 1U8LB 4P2QD 4CDHA 3P9MB 3GI8H 5A43C 4YDKH 4P2OD 4RISH 1R24A 2FZ3A 4PJAE 3DSFL 3HUJA 3BI9X 4WFHD 1CLCA 2W65A 5ADOH 3MA9L 4HWZA 3THMH 1JMXA 3BE1H 1QRNB 4QGTA 3RKDC 2W9EH 3RAJH 3BPNC 5D6CA 4JPIA 1KB5L 2CXGA 4MNQA 5J1AB 2VABA 3O2WH 5DJZA 5BRZA 2MPAL 2CDFB 1F58H 3BH8A 1S7WB 1KIQA 5CJXA 1P53A 5TE4H 4NOBA 4EKXA 3DIFB 4PGBB 4PJHA 2VDPL 3N9GH 3HG1A 3OR7A 5JXEC 3DX6B 5J6GA 4M6AA 3KPSA 2AGJL 4A6YA 4K8RD 4LBEB 5IQ7H 1KIRB 4UUJB 4QXUH 1LE9B 4QHMB 4X4MA 1PBYA 3VWJC 3MC0A 1G7HB 1N4XH 4X7SH 4X8XA 2JKXA 4M6NL 4JM2F 4IMKC 1QFWL 4MDJB 5EC2B 4X9BA 4PJHF 1G7IB 4LP4A 5IG7B 5FK9A 3VDAA 3C08L 5T33L 4HV8B 2APWA 2FEEL 1G7PA 3TFKC 4JZJB 2F54E 3FO1B 2LTQB 3OB0K 1QPPA 5DUMH 1NCTA 4X98B 3MLVL 4WRLA 1YY9D 4FQ1L 5F1IB 3T0EC 2CLZA 3OG4B 2DQTL 5LBSH 3UJJH 5BJTA 4MJ2A 3AVEA 4LCIH 4GS7C 1TQBC 2HTLD 4ODXB 2WANA 3NFSL 2GYSA 5MEQB 1G7MA 2WV3A 2GCYB 3B83A 4YHIB 4X8JB 1FZKA 1QRNE 2VO5A 1E6OH 1J5OL 1II4E 5A2LH 4JFEA 2UZIH 4NYLA 1DQDH 5E8DH 5DXWA 3EGSB 5FHBL 3MBED 1BWMA 3BFOA 3QPXL 2QQLL 1DTUA 4JPWH 1HZHH 4IRSA 4M7ZC 5KAQF 1R6VA 1QR1B 5D1XA 2MQ3A 3K74B 4P2YA 2IPUK 3OV6A 2NY4C 4XB8A 5BQ7B 1H3PH 4HX1B 2OJZH 3R06A 4GXVH 4NQCB 1MCWW 2VZUA 2DQHH 4CJ0A 2VISB 5HY9B 1QG3A 1D9KD 1A4KB 1ND0A 2F15A 4RBPK 4QOKE 4Q6IC 5DJ2B 1AXIB 5MI0C 3RRQA 5TE4L 3RNKA 4Z7QF 2HLFC 3D3VA 5FYJU 1FGVH 3BGAA 3MODL 1X5JA 2DTSA 3MRGA 5EO0A 4S1RH 2ZNWA 1EHLL 4UMGA 2GTWA 1BVKA 3GIZL 2XG5A 2APVA 5LXGL 5DK2A 1PAMA 1DQMH 2EEAA 2VE6B 1WCQA 4M4PA 4EN3D 3ULSA 2H2SD 4NM8L 1EVUA 3P73B 3TZVD 4Q74A 1U92A 4P2QB 1N4XL 4KRLB 1VSCA 1JMZA 1V8HA 4S1DC 1EX0A 4LVHC 1MJ7H 4FXKB 4ZUSA 2EYRA 1XF2B 3FMGL 5DI8A 1OAZL 4G42B 5D7LB 3Q48A 2AJZB 3KLSA 5JMRA 5FCUL 3W0WD 5C6TH 2ADIB 3LKPB 5A2JH 4Y5YC 1Z9LA 4TULL 2CQVA 2DLIA 3T0VA 1NGZB 1MREH 4P57B 2HKHH 4PJEE 3C5JB 5INCB 2ESVA 4ZXBC 4DGYH 4KI1A 3BKYH 1JK8B 3ZE0F 3X14A 1A1OA 2CMRH 4WHYG 5EZJB 4BM7A 1TCRA 1E6OL 5IBTL 2WWKT 1J5OH 4YDLC 4NC1C 1YEGL 3UYRH 2NX5A 1QLRB 1MCHA 4WGVB 5BVJA 1QSEA 4OLZL 5DD5L 2XNAA 3QAZB 2XTJE 3KJ4B 1WCBB 4HK0B 3ROOA 4K7FA 3HI6L 3MV9E 3BO8A 4M9PA 1N6QL 5JW5B 3QQ9C 4ZTPL 4UB0H 3PWPE 4WFHE 5DK0B 3IDUA 3FO9A 1X3DA 1TJIL 1AXTL 5EU3B 5IIEA 3W2DL 1LEGB 4D8PB 1WZMA 4QRTB 3WLBB 1G7JB 1BIIA 4P2QE 3NH7H 4X6CF 3NIDF 3VFSB 2YBRB 3TVMC 4OD3H 3X3FL 1IMHC 4KHXH 5FYJL 4LU5L 4JO4H 2ZSVA 4NP4L 4H5SA 1YN7B 2WIIB 1ED3A 1DANT 1F97A 1JN6A 5E2UL 3T09A 4N90E 3NMEA 4IHOA 4PY7A 1CU4L 3WS6A 5LBSL 5C0AB 4WI4A 5IB3B 4PRNB 1A7RL 2DBLL 4HKJA 4OLEA 1QBLL 1ZT1A 5CINH 5IF0A 1T20B 1EEYB 3B4NA 3FFCE 1TENA 5C6TL 1S9VB 3FOMA 3DRQA 1NBQA 2MOVA 4IOIB 4S1QL 3M1BB 1GOHA 2ED9A 3DECA 1B4JH 1FNAA 4L8SB 3CUPB 1YEHL 2Y25A 4MA1B 3EDEA 1JJUA 4YHNB 3DXAA 3QCTL 1K4CA 1HHHB 2R4SL 4XNZB 4ZMAT 5LWYL 2DDQL 4I0KA 1F4WL 4HSQA 4Y88A 3PL6A 2JELL 1AI1L 3BEWA 3L3IB 3MROB 3U9UA 5JTWA 3HI6H 1N5AB 2H9GA 1DUZB 3MLYL 4FTVB 4X99A 5FKPA 5GPRA 3P0VL 4UU9B 2BFVH 5EOCL 1J8HD 5HVHB 2FL5A 1H3WM 3O9WA 3VA2C 5J11B 4YHMH 1I1YB 1BEYH 2NTSP 1Z0NA 4PP2B 5JW4N 2WAHA 1YEDA 4DVRH 2YPKB 1D9KA 1DQML 3FRPA 5IMLA 3LEYH 4D3CH 1PEWA 4IRJD 4ETQA 3NABL 4XVJL 1G9MC 2NXYC 5JW3L 1OPGL 2DQUH 3RA7L 2CSPA 4QRPE 1TETL 3KPLA 2DIJA 1I4FB 4OD3L 4AH2A 1CXFA 3T2PA 4L3CB 4U6VH 4X4ME 5EOQH 4Y2DA 1A7BA 1KNOB 4BKLB 3KG5A 1JHTA 2V9QA 5TH2A 3DARA 1C16A 4UQ3B 5LJYH 2BERA 2HFTA 1U58B 4IRSC 4LHUA 3TO4C 1JHLH 3LCYA 3PNWB 4RA0C 4N90D 2A1WH 1NDMA 2YK1H 4KRPB 1NFIA 4XP6L 1MUJA 3ARBA 2BVOB 3CCHA 5KAQG 4YHOH 4OLZH 5I74B 2HH0H 2VZSA 4TVPH 3HNVH 2DI7A 3S96B 3JWDC 1YC8A 1QSFB 2QADD 2Z4QB 1Q0YH 4LVNB 2EE2A 4PD4K 3H7BB 4RFOL 4U33A 5I1AA 5CZXC 4FTVE 1H5BB 4U6YA 4G6FD 4XMKH 2P8MB 3VXPB 2D9CA 2D31A 4HWEH 4EOWH 1UWGH 2NY0B 4OF3A 3IFPA 4HKZA 2EYTA 3GKWL 1BQHG 5DS8A 5MP6L 2F8OA 2PYFA 2QSCL 3T3PF 3KPTA 5E03A 4LSTH 2DD8L 4XVUD 5FHAH 3QDJA 5AYUL 5T1KA 5FM5O 5KSAD 4G80B 4RRPG 5HPMA 1IKFL 5DLML 5E2TL 5IMOA 2BRQA 4JRYE 5I0ZA 2OZ4H 4K71C 3RVTD 5DQ9A 1G6RH 5EBWB 1HK6A 5CGYC 2HRPH 3TBVA 4TTGA 4X6FA 4RMVA 5F96L 5EBLA 3S36X 5CCKL 2H8PA 5LAXB 4YX2H 4U1MB 3VI4F 5T1LA 4RAVB 1H3TA 1TDQA 3OKLB 5TGBA 1EJOH 1MFCL 3BD5A 2FEDD 1BF8A 2P47B 5T5FH 3T8XB 4OFDA 1KJVB 4P5KA 4GAGL 4A2LA 2YD8A 3S37L 2J6EL 1P6AB 1GOGA 4KQ4L 1KPRB 5EUOB 4P49A 1ZTXH 2HYMA 3LQAL 4HHAA 1CI5A 4Y19D 5MI0B 4XWOC 5JA8B 1FL6B 1QQDA 2OI9C 3TN0C 1IM9A 3FZUC 3HS0B 1A3RL 4ZFOL 3LS5H 2G75A 3TT3H 1M05B 3VRLF 2HRLA 3QCTH 1TJGL 2WBJD 3FL7A 3GEWB 1QYGH 4JANB 4OUOA 1MHCB 4JY6B 1XGUB 3QUMA 3VRLE 2HTKC 4HPOL 3HI5H 1KC5H 1R3HB 2Q3ZA 3HNVL 1H3XA 4U6XB 1DBAH 2Y6SC 4M6OH 4XXCA 4X6CA 4ODWB 5BO1H 1ZEAH 3S4SA 2ZCKH 2R0WH 1JP5A 4V1DB 1UWGL 3MV7A 1HSBA 4YHLL 5DWUL 3K8LA 1K2DA 3CFCL 3BW9A 4WUUE 3C5ZD 1UEYA 4R7NB 4UBDD 4AIZB 3IDMA 4OCRH 5DD6B 4HUKB 1TQCB 1VFBB 3UX9B 2X44D 4P3CH 2XWJB 1J8HA 4HG4J 3VXOA 1V3MA 1CFQB 4WV1C 3UYOD 5IFAH 1CXKA 5EWIL 1O5DT 3PWLA 2F74A 2VDRH 4FTVD 4PRAA 4OCYL 5DEFA 4LPUA 4HS6B 4L4VB 1UZ8A 5C9JB 3ZKXC 5BV7H 4YX2L 1XGYH 1F4HA 1OP3H 3GSXA 5E6ZA 2ZUWA 4UNUA 3LMJH 3ARBD 3MSPA 3HC4L 1VADA 4QXGL 1QBMH 3U30C 3P9LA 1JGDA 5HGBB 4IRJB 1N2RB 1T04A 5HBBA 3RGVC 4LOUD 4MD4B 5C08A 3UBXB 5FA4A 5D8JH 4CN6A 3L7FA 3NCJH 1EEQA 4YHOL 3BKJH 4GAYA 3V4PH 3MJ9L 1MCPH 4YHZH 3T2QA 5C7XH 3DX7B 4LPTA 2PYEA 5HHQA 2P49B 4XBGB 1W8OA 2XKNB 1TVHA 2JLLA 5EBGA 2BRRH 5DVNA 4NJ9H 4PG9B 8CGTA 4K55A 1OP9A 4WVRA 4Z5RA 3EYVB 1DVFD 2JJSA 2WWKO 4V2BA 5FXCH 3PGDB 2Q76B 1Q9KB 3LV3B 12E8L 4M9OA 3RZCB 3U0TA 3PWJA 2DWDB 3GBNL 2P43B 3KYMB 1HSAA 3G6JB 4APQB 2QKIB 4QCIA 4GMSH 3MREA 2H6PB 3DSNA 1DBMH 1A6AA 3UJTH 3VWKD 5CBEA 1ZT4A 1G9EA 4M5YL 4MNGB 1E4JA 2EDDA 4D9QE 2YWYA 5J4MA 3O2VH 1FFNB 3EYQC 3QEHB 4PG2C 1CXIA 2EXYC 1GHFH 2LTQC 1FCCA 3NFPB 1XCQB 5DC4B 4LCCA 3UTPE 4EI5A 1U3JA 4F3FB 1V7NH 5L7XH 4OCXH 4Z9KB 4G6AD 4O51A 4Q9QL 4L4TA 4MB5A 3QG6A 5D2NB 3EYUL 1JWMB 3HR6A 3BQUA 2ZZUT 5BV7L 1OAUL 3VDBA 4P9MH 1KUMA 4N8PA 2OM5A 2WBJA 3C60C 4G7VH 2AEQL 1LHZA 1WZKA 3NPSB 3RVVD 1V05A 3UC0H 1E4WH 2YD2A 1I1FA 3HZKB 4N5EC 1BQUA 4NQCE 3WFHA 1QO3B 1Z3GL 4DZ8B 1RULH 1AHWA 3SE3C 2V5MA 2YRPA 4LCWE 2C3HA 5E1HB 1RZIA 2HG5B 3IF1A 4HGWB 1MQKL 4BQCA 2OR7A 3BJ91 3GMQA 1JZ2A 5ID1B 4XPGH 5EUKB 4JM2A 1I3GL 2X4OB 5E4IA 2WQ8A 3LN9A 4PIRF 3WIFB 5CFHA 5LGHH 1BQHA 1VENA 3QFJE 4NJ9L 3IKCA 4NNPH 2XZCH 2YD7A 3QIBB 4JN1H 1MCEA 2XQYK 2CLRA 5CS7A 4GSDL 1EV2E 4EI6A 1P7QB 2IFGA 4OIIL 1A22B 3CLFH 2FWOA 1AR2A 3V52L 1OD9A 5IB1A 12E8H 5DGRA 3HCVA 4LSPH 1EMTL 3QFJA 2ADFH 4JFHD 4UIMB 3TBSA 1JNJA 3MRIB 3VI3F 5IWLC 4A6YH 4ERSL 5FYJD 1HXMB 5ICXA 1MAKA 4GBXC 3FN9A 3ES6A 3MV9D 1FE8L 1GGBL 4XPFH 5J6HB 4IJ3B 1U8QA 1GXEA 5HHVL 2Y36H 3CDGB 3GMLA 3O2VL 4Q6IA 3IFNH 1L9MA 2B20A 4X9GA 1BZ9B 5HYJA 3MRCB 4U6TA 4NO5A 1MIEL 3GHEH 4U1HB 4M7LT 3VD4A 1CYGA 4ONGH 4Y5YB 1BLNB 1LP9F 5L7XL 3H9SB 4QHNB 3E8UL 1AGFB 5ACLA 2PW2A 2DLEA 3ULVF 3MUY1 3L5IA 3DI3B 3LAFA 1S7UB 1U8KB 3T65B 5IVNA 5ISZA 1GZPB 1YNKH 1HH9A 5CGMA 3S88L 4HUVB 3VFPB 1D5BA 1E4WL 3HTLX 2WLZA 5KSBA 2R1WB 3O8XD 4PJ8B 4ZQKB 4S11A 3GM8A 3RAJL 5E94B 1HQ4A 1JPSL 1T7XA 4FN0A 1BX2B 2MPAH 4XNQA 4TSBL 5I73C 5LGJA 5J3HD 3I3DA 3GI8L 4J12A 3WUWB 2APFA 1QNZL 1LVEA 1I9IH 4HIXL 2ITCB 3WIIL 3VXMB 2GHWB 4NNPL 5EB9A 4J23A 2HMIC 4GSDH 4HWBA 4BZ2H 5GSRB 4LASL 4PV8A 3WO4B 3OKDA 2DL2A 1IT9H 4WW1B 1MRDL 1MCIA 1WISA 4P0DA 1HILB 4LLMB 2P7TA 3NACL 2ORBH 3V6ZA 4RIRA 5FYJE 3DROB 4PBWD 4PLJC 5HHOD 1XZ0B 4DKEH 3FB6B 3NCBB 4H0GA 1F3RB 5DEGB 1IEBA 2WMPA 4LCYA 2XKSA 1N59B 4OF6A 1Z6JT 4OD2A 4OFYA 2AK4A 4QLRA 1GGBH 4HLZG 4GOSA 2FO4A 2EC9T 1EFXB 3KPQB 3QDMB 3SE9L 1OL0A 2FB4L 3CFEA 5FUCE 3D9AH 3DO7A 3QRFM 1A14H 3SPVB 3S34H 5C9KA 1KYOK 1A8JH 1HKLL 3O2DA 5D7IE 3FB5B 4XX1G 4UIKH 2C9AA 4PJIB 5C09B 2BZDA 4TRPL 1FIEA 4Z78A 2OL3B 2N7BA 3AS1A 3RPIA 4M7JL 3WSQL 3O3DA 1Y0LA 5FO9B 1F8TH 5LCVH 2EE6A 2CIIB 5T5NF 4HFUH 7CGTA 4L8CB 3RWJA 4YHPA 3V4VL 3QI9C 1I3GH 4KXZI 4QNPE 3CVHB 2DMCA 4G8FA 3DGGB 4WW2A 1EJ6A 4MD5A 1T1WA 3AROA 3QB7C 4ZUVA 4KFZC 3GMOA 3F6LA 5I19H 5GZOD 5CIPH 4GRWF 5FV1L 1Z0MA 2UY6A 1YEJL 4LQFL 1BREA 5F7NC 3NCMA 4MD0A 3U6RA 3I75B 1F3DJ 4GRWE 3AXLB 1NFDA 4X6CE 1CE6A 3X12B 2YRZA 4MXQC 1PKQA 1MSPA 1AD9A 2C7UB 3NN8B 1ZSDA 1IT9L 5KG9B 4JGUA 4HCRA 1FYTB 4PUBH 1TVBA 3ZL4L 3T0DA 5GS0L 2IBGA 3MR9B 3CMGA 1OW0A 3DUUA 5IB4B 1WZLA 3IJHA 5F7EL 4OV6F 4PJ5B 2QLVB 1ROWA 3SKMB 5JA9A 4YFDB 3MFGB 4K8RL 2YZ1A 4KGJA 1MF2L 4YXKL 4H1LB 4OGYL 2FR4B 1RU9H 4RFEA 3T0XA 1IGYB 1M7IA 1QFUH 1CBVL 4WO4A 5I30H 1U6AH 4QY8A 5C3LD 1UJ3B 2O5XH 4OLYH 2VH5L 3H3KA 3MCKA 1H3PL 2YD4A 4NHCH 1RV6X 4L1DA 6FABH 1NANH 2NW2A 3KPRA 4X7TA 3KYKL 2ZJSL 4NJAL 3K3QA 3OKEB 4XNMB 3ARFB 5HD8C 3H0TB 4KJWD 3H42L 5D5MA 1F8TL 5LCVL 2X1XR 3KDMB 4WWKB 3VXRB 5IKCB 4P46B 4TULH 1BHGA 4KJQC 2YPVL 3QHZH 4ISVA 3RVWC 3FONA 3U9PH 3SO3B 4L3EA 4Y4HB 4EQ3A 3QWOB 4N0FA 1WIPA 5MERA 5E1AA 2VNCA 1T0MB 4CVXB 3RUGB 4TNVF 3LRHA 2DQIL 2GITA 4JN2A 2CUIA 1L7TL 4I77H 5F1NA 3OL2A 4YEFA 3X3GH 4J3VA 2CIKA 5D1ZC 3CGTA 4I0PA 3ECBB 4LDOB 5KW9H 4I2XB 4WI6A 2J8UE 5IVZA 1LEKA 5A3ID 4X4YA 4J4PA 1S9YA 1QLFA 2YD6A 5KSAB 2NW3B 4GO6B 4LDEB 3ARTA 4NDMA 4P5TB 1WWWX 3P30H 4QYOB 5IMMB 5L2KA 1ZLWK 1W72A 1FG2B 1JNHA 1S8DB 5ALBH 3TO4B 3SOBH 3PHOB 1ZLWH 4NOFA 3CMOH 2I9LA 4EUPH 1ODAA 4OZFA 4QGYA 2H2SC 4YPGB 4NN5C 2AKRA 5HGGS 3T0AA 5ADPH 1EIBA 5E8OA 4BJLA 2CD0A 4H26B 5HI4C 3RZWA 5JOPD 5E9DB 4MWFA 2YA2A 4W6XB 1DUYB 2XICA 4MJIA 4WCYH 1MRFH 3WSQH 1AY1H 2MQ0A 3MRJA 4S1QH 4P2OA 2AV7B 1DQQB 1YYLH 5EFIB 4MQSB 4NUJA 4XRCB 3QPQC 5GGVL 3I85A 3QEQB 4Y89A 1Z2KA 1I7UB 2ZG2A 5CP7B 1BFOA 3BUYA 5FYLL 1F11A 5HYQA 1C5DB 4V1DE 4WHTA 1Z5LA 4MNQD 1Q94A 1YPZB 2IAMD 3IJYA 3ARDB 1AGCB 5L2KE 3IDXH 2OTWB 2V2TB 5IJVA 5CILL 3L3DB 3P0YH 3CFDA 3MMEB 4JKPH 5KOMC 4QHKI 4D0CA 4DCQA 1CICD 2J8UA 1G7QA 3DMMC 3WFDL 2ADGA 2W07A 3PXJA 3D25A 3GI9H 1U8NB 2OR9H 4OF7A 5SWZB 4PRID 2I26N 3MRQB 2D9QB 2HKFH 1N5YH 4AG4L 3RIFK 2X6MA 8FABA 4IRZL 3RY4A 4F7CA 4APQC 5TE7L 3LN4B 1UACH 4ZFZA 3FN0H 1DBJH 2PXYC 5HJ3A 1DBBL 4G8GB 5T1MB 5E2JA 4I9WD 3WLWC 5D96C 2IH3A 1IQWL 3QWRD 3VRIB 2DI8A 2D0FA 3KPRE 1RZJC 4OGYH 4PP1C 3O45A 3GHBH 4PRBB 1WV7T 4R0LA 3V4UH 1WC7B 4M62H 1FAKT 3PJSA 3VFMA 4BSVA 2Z31A 3OHXA 3WD5H 2CRMA 1FFPB 4X80L 4GW1A 4XP6H 4Z7UA 3OJ2C 1CL7H 4NN6B 4WI9A 2GSIA 4UILL 1EHNA 4U1JB 5DJ0A 5LWYH 3SDCD 3T2NH 4WEUD 4FZ8L 3TJEH 4XC1H 2DQJH 4M00A 1KJ2A 2CO6B 1OHQA 2V2WB 5JW4R 2FJFB 3F8UB 3MRNB 2FSEB 3C5SB 1DN2A 4WU7A 4XMKL 1FVEB 4DN3H 5D7IF 3DJ9A 4XAWL 1RZJL 4LF3B 4UQ2B 2AI0L 3L3JB 4TTDC 5HI5D 4XNZC 2X1WL 3RQ3A 2NY6C 2CDEB 4CKVX 4UINL 2ATKB 4HXBH 1L7IL 1GVIA 3CDYA 1NFDE 3EYSL 4N0CC 4O58H 5CJ5A 1S7XB 1S7VA 5IMKA 3UTOA 1OAYH 3DURA 1E27B 3PWPA 1A9EA 1QA9B 1ZA6A 1YMMA 1PVHA 3QIWA 5F8RC 4NFDA 4D9LH 3RZCC 4HWBH 4WEBH 3CXHK 4Y4KC 1G6RL 4JREC 4BFEA 4EN3A 4JFED 2BY0A 4X6DF 2YEZB 1LNUB 4EOWL 4YDVB 2VQTA 2CKBA 2W9DH 3LKOB 3OXRB 3ALPA 3RTQD 4YQXH 2NX5E 4J1UB 3ISWA 1OVZA 5CD3A 2V2XB 5HYSG 2FIKA 5JHLH 4IRJC 1UH2A 25C8H 1MI5B 3EW3B 4K9EH 5TQ2H 2A6DB 2RFXB 3GSWB 3C8DA 5DTFB 5EO9A 3TN0A 1EEUA 5I6XC 3JVGC 1BZ7B 3IDIB 4R6UA 4PJEA 4TUJA 4X83A 4E41B 2VL5B 4L8BB 1AJ7H 1N64H 1AY1L 1JWUB 5IT2H 1FZJB 1AIFA 3RVXD 4TVPL 3HR5B 3L6FB 5HTSA 1GIGL 3D0VB 5DR5L 1I85A 1NCDL 5K9OB 1YQVL 3U1SH 3MRDB 1NAML 3SDDA 3AAZA 4OLWL 2FX9L 4NQUA 3TO4D 2BNQE 4UTAL 2AK4E 2H45A 3FQWA 3Q6FA 3MLVH 3OG6B 3MO1A 4YHKH 3U48A 3O6FA 3UCRA 4JDZB 1ORSB 1XF1A 4CN4A 4FQXD 4PREB 2DD8H 4UOW1 3M17B 4KH2A 5T3XD 4D0DA 1RAMA 1YNTA 2ED7A 1GGIH 3U4BL 1BAFL 4KK5C 3MNVB 2LU4A 2D2OA 4OZGB 3MLRL 2NY5H 2OR9L 3EFFB 4YBQC 1EZVX 2AV1B 3DV6B 2JJTA 3SCMB 2FBJH 1A47A 5JHDB 2F5BH 5IK3B 2XPGB 3QUYB 4JB9L 1J1OH 2VQUA 1WICA 1W72L 5KSUB 3MRMA 4W6WB 3CX5J 4JDVA 1JZ8A 5EWIH 4I3GA 2VQ1B 1S7SB 4P4KD 3ARFC 1GAFL 5LG1A 4QRSB 4YNYB 3MV9B 4NRYA 4NKOB 3RL1B 1T6VN 5H8DA 1DE4B 3AU1B 4JPVH 5C0JA 1UJ3C 3BAEL 2BSSA 3N1QC 4HH9B 1R3IH 1S5HA 4Y8AA 1CDYA 5I9QC 1J10A 3WE6A 2W0FA 2OI9B 1PQZB 5L6YH 3L9RA 1ADQL 4H88H 4NNXA 5EZOL 2KZWA 5DSCB 3O4LA 1LO5A 5C2BH 5DRWB 1UA6H 3MFFB 3H9ZA 2PN5A 2XZQL 3T4YA 2LVEA 3VFNB 1CQYA 1KCUH 5TDOA 4HF5L 5MHSD 4CADA 4GAJH 5IQ9A 2DQEH 1OCWH 4KDTC 3VW3H 4KTEH 3U4EA 2A6IA 5TDNA 4UTAH 1TMCB 2NXYB 5C0CA 1UWEL 3A6BH 3STZB 1I3VA 5JW4Q 3UJIH 1B3JA 2AJVH 1R3LA 2FHFA 1R5WA 3QXAA 3BXNA 4GRMA 3MRHB 2SEBA 2CJUL 1F5WA 2FYYB 4OAWA 4WNQA 2GIYA 4LLWB 3JZ7A 4G9FD 1KTLB 4Z95L 4IDLA 4OFYD 1S7QB 2RQ8A 1P6FA 5GQBA 4Y16B 3KR3L 1HOCA 4ELMB 4NZRL 4WI7A 5C08D 4K94H 3STLB 5I74C 5DA0B 3N06B 5GGRY 1RIHH 3MV01 2DMKA 4Q97A 4UTBL 1UGNA 2PCPA 3VXNB 5TPWL 1CXLA 3REVB 5ANMB 3C5ZC 4TUOB 3I02B 3DXAD 4QXGH 1S3KH 3C60A 4OCXL 1T1XB 1RURH 4O2CB 4DW2H 2KPNA 1UXWA 3AREB 2D7TL 1CFNA 1RZFL 4FQJL 2UV3A 3L5XL 2B0SL 3QDAA 5ACMA 4F7PB 2GK2A 2JF1A 1AJ7L 4F7MA 4KDTA 1E4KC 2FDBP 1OTTC 2WIMA 1RPQA 4QHLB 4AEIH 3WHE1 5ID0A 2VXUH 3OJDA 2BC4A 4U4BA 4KHXL 3IDJA 5FB8A 3LZFL 1IGTA 1NCDH 3ZT5A 3RTQB 4DGIH 3V5KB 4BFIB 4WGWB 1RZ7L 4PGZA 2QL1A 1CGUA 1QFWI 3EDJA 3GB7B 4PLOB 3UO1L 3HZYB 3DHJA 2IBZX 5FDWB 3TCLA 4H25A 1TTUA 3WFBL 3O3AB 3ULUF 1P84J 1QRND 1ZHKA 3IDYC 3C6LA 3TYGH 5C0RH 3OKKA 3L1OL 2DQEL 2B1HH 2NNAA 4FXGA 5SV4A 2Q86B 2JB6A 4JM4H 2X4UA 3ULUE 1FFOB 5J56B 3MLRH 3MRLB 3QUZA 5DD5H 3N0PB 4NQXA 4MSWB 1EVTC 3DRTA 3QXUA 2N1KA 3ZSSA 1ES0A 3KYNB 5EC1B 2F54D 1OD7A 3BZ4A 4NBZB 2CDGA 2R15A 5H94B 4Y19E 3RWIB 2X4QB 1NJ9B 1RIVL 4U1IA 5GRYA 4KK8D 3V7AG 4CDGC 4TN9A 1AI1H 4LP5A 3NCYS 2DBJA 4LLQA 2GY5A 2ZSWA 3W11D 5F71A 3GSOB 4WU5A 1JTPA 5DO2C 4NZTH 2ATPB 5D70H 1ZVSA 3NH7L 3RIAF 4YHML 3SGJA 2XTLA 1HI6B 2W9LA 1IRAY 4XP9L 4JQIL 4RWYH 5JNYB 4I5BA 4ZFGL 5I1HL 3PIQB 1IAMA 2AJSH 2VUYA 3GSUB 3GRWA 1N0XL 2OS7A 1IBGH 4RFNC 4JZNA 5HVFB 2W38A 3UAJC 1T5XA 4KKCC 1T7ZA 3MRBA 3FFDA 1IKNC 4P5TD 4HMCA 1KCUL 3JBG7 1INDL 1YUHA 5EU4A 1MNUH 3TVMB 1TJHH 5I66B 3BPLC 2WINA 3I50H 4X6DE 2ICEA 4I0PD 4TUKL 3ZTNL 1KJ2H 4JRYB 4HS3B 4N5ED 1UWEH 1ZLSL 5IW1B 1FBIH 1FJ1B 3BKMH 3VFWB 5ESVB 3KNBA 5IB2A 2GK0A 4KROC 1RJYA 1P7QD 2JK5A 5EORL 5HGHA 3QXDA 5DDHA 5JDSB 3V5DA 4X6DA 2GUOA 4HIIA 4QTIL 1DL7L 1T3FA 3VXTA 5KVGH 1PZ5A 2FJGB 4UAOC 4R4BA 4JY5H 2B1HL 3LHPH 3ET9F 1KT2A 2E9WA 5ILTL 4NZRH 4NWUH 2BSTA 1KPVB 4MQ7B 4QRQA 1S78D 4KJPC 3B9EA 2GKIA 1VFOA 3DYPA 3IDNA 4NZUH 3TYFA 2VLJA 3MLYH 2X9YA 2R2BB 5KS9A 4EI5C 1X44A 3RWGB 4AIXA 1JPGB 2DWEB 2ITDA 4YO0A 3HAEB 4ONGL 5GRXG 3MJ8A 2NY1D 4F33B 1QTYT 5C07A 15C8L 1DFBH 4KUZH 4K3DL 4G9DA 5KOVC 1RZFH 3GSNA 4NO3B 5LXGH 1XF4A 1M71B 3NABH 3GNMH 4XVJH 1WBXA 3V95A 2AJUH 1A6TB 1C8PA 2C1OB 3EAKA 1R5VA 1U8HA 4G43B 4BA8A 4WHDA 1BD2B 4KQ3H 4NKMB 4Z0XA 3BT2H 1EBAA 2PR4L 1U93A 3DO3A 4OF0A 2IQ9H 5E8PB 1MCFA 1H3VA 2KH2B 2ADJB 4HFWB 4Y19A 4LNRB 3RWHA 1AGDB 1HCVA 3VD3A 4XB7A 3IFOB 4WWKC 3VFTA 2R1XB 4L4JA 3QQ3B 3OR6B 2JCCE 2YA1A 2XN9A 5F6IC 4K2UH 3RWCB 3C8KB 2ARJA 5C0BD 1BM3H 5SX4H 3BDYL 1H0DB 4C4KT 4KKBC 5IROC 3I2CH 3MUJA 1NSNL 3VJ6B 1HQRA 2OTUA 4QTHB 1DQLH 1CR9H 4KMQA 1BGXL 1F3JA 5ECJE 4F2MA 2P44B 32C2A 3MXVL 3P4MB 2HLAA 5C0ND 4Y7MA 3U82B 1P7KA 2CR6A 3LS5L 3T3ME 4GW4B 1EA9C 5GGTH 5GSVB 4QTIH 1JVKA 4OI7A 1IVLA 3B9KD 2BVPA 2VWEE 1I1AA 3QNXB 4R97C 1OAQH 2J12B 3FQNB 2Q8BL 1UB5B 1RK1B 1NC4B 4Q6YA 3QP3A 3D69A 4XXDA 2OBGA 3TZVB 3UDWC 2QSCH 5JXAH 1YN6B 2VLKD 4E5XA 5D70L 2PTTB 5I19L 5FHAL 4XH2A 4ZSOA 2YHGA 2P5WA 5FO8B 4MNHA 3C5ZB 2JJWA 4OQTA 4KGLA 5IW6B 2HRPL 1CT8A 2RGSA 3ULVH 4GW5B 2VKWA 1DQJA 1SEQL 2XV6B 2ZUTA 1NBVH 2A73A 3DUSB 4X9FA 1AFVL 2HJKA 1F6AA 1LD9B 2D7MA 1FV1B 3CSBA 3EZJB 1SJEA 2NY3C 4FQCH 2MCPL 1P2CB 3P3YA 2X1OA 1SJHB 5FYKH 1IAKA 4NRXA 1WIUA 1I3RA 3D39B 3WN5A 1KCRL 3VG9B 1QBLH 1AE6L 2W0LA 1X7QA 4LSDA 3ARQA 3VXQA 1RU9L 2DLTA 3L7EA 4QOKB 1MLBA 4G6JH 5EORH 1GZQA 1QD0A 4QRPA 1NBYB 5EZLB 1YY8B 4NWTH 2NCMA 1T21B 4NQDB 4ODVL 3X11B 2NXZB 1RUPL 3DETC 3NIGE 3QI9D 3FO0H 1HHGA 1MCPL 4YHZL 1SEBA 2IH1B 4Q9CA 2X4TB 4ZD3H 4P46D 1K8IB 1K5NA 1U3YA 1W0VA 2ZOKA 3DTXA 5L88L 4QXTB 3DV4A 1IKNA 4X9IA 4OZHB 1HNGA 1LEIA 5D72H 1RVFL 4LLYA 4P9HL 2YSSB 1BEYL 1VKXB 2IGFH 4MA8H 4HUXB 5KVEL 2RIKA 2MNUA 3PHSA 4JG1L 5DURB 5DJ8B 3RUGF 4YXLH 1FL3A 4HKBA 1I7TA 1RHHB 2EC9U 5JOPE 4RGMB 3HB3C 1RZGA 1FNSH 3BH9B 4MXVF 4KI5E 1TETH 5IFAL 4G6ML 5AUMA 3D0LB 5E8NB 1J18A 2GJZB 4FQXA 1VEPA 3BMVA 3V9FA 4GMTH 3FFCA 4R26L 3P30L 4RDQF 3GUTA 2F19H 3HPJB 3D2UA 4WENB 3GK8H 3OF6A 4E42B 4LSVH 5DJCB 5ICYB 2LFGA 5KN5B 1BFSA 2VJXA 3OJMB 5F6HI 1U8JA 4MJ4A 4MS8C 2DM3A 1HH6A 5CGYD 1FNLA 1E6JH 3ZYOA 1FRGL 1HHJB 1P1ZB 1BVLB 3WJLC 5C0AE 4GKSA 4OCNC 2A1WL 1OAUH 1ZT7B 1DQLL 5ICYA 1NAKH 4CUCA 2DB8A 4LLUA 3D2UB 3G9VA 3N1MC 4Q9RL 4JFHE 2LABA 3I6LE 3X3GL 2IPKA 2F8VA 1BPVA 1YMHA 3Q5OA 4FQXB 4POUB 1B4RA 4WI5A 1UB6A 4L5FH 5IFJA 3TBWB 4I3RH 5F7DA 3G5VA 3NIFF 4CW1A 2VDLH 1IAOB 1RZGB 4KVNL 2HJFB 1OAQL 2E9JA 1FL3B 2FD6H 2ENSA 2YPLB 3VWJB 3L5WB 4U1LB 1IGFH 5DJ8A 3G04B 3LRSB 3VU2A 3K1KC 3N50A 4OBRA 4W70A 5EIVA 4DTGH 4GKZB 4LLYB 2BVYA 3S9DB 3O8XA 1KLGA 1MEXH 2MKLC 1EK3A 2XZCL 4M43H 3QO1B 1K8IA 2OZ4L 4N9GB 4OLXL 5IBLD 2X4TA 2X7LA 2EIBA 4NPYA 3RU8H 1HHGB 1JHKL 5J8OA 1G1YA 4ODHL 5I1IH 1FYHB 2MTPA 5DRNB 4HUWA 1TFHA 3UP1A 1AO7A 4MJ5B 2UYLA 2IADB 3UTTA 4XGZB 1Q9OB 1D5ZA 1U41A 1YY8A 4DJMA 1B88A 4PRPA 1QVOA 1EERB 2R1YA 3Q1SL 1MLBB 4Z8FH 3B9DA 1CGTA 4GAGH 4W6YB 3S6CA 1C1EL 5F7HA 3H9HA 3GSNH 1S9WA 2R0ZL 2EDJA 4WUKH 4JO2L 1N6UA 4Y4KB 1IAKB 4KC3B 1JGEA 2W0KA 4PJBA 1O0VA 3THML 1P2CA 1FFQA 1SY6L 3H9YA 1FC2D 1FV1A 3ESUF 1NMBH 5E8DL 5KSVB 5DVKA 2HJKB 4K23H 1T83C 1CL7L 5HGAB 3SGKA 4UZGA 4UT9L 3MV11 2HKFL 3NBNA 4P3DA 4GW5A 3ZE2F 1CT8B 1ZE3C 2VKXA 2L7JA 4OIBA 3CSGA 4LOUC 5IW6A 3MGOB 2Q8AH 3I6GB 3PP3K 4AEHL 1CVSC 1I9RH 1A3LH 5FUZH 2ZUVA 4LEXL 2NQCA 2PYED 4G5ZL 5BW7C 1YNLL 1U8IB 3OQ3B 2DMBA 1YECH 3VH8B 4B7IA 2ILLA 3SKUD 1RK1A 2CRZA 2FH6A 5FA3A 2D03L 1A2YB 4OGZA 4WV1A 2R0LH 5C0DA 1NGXA 5I75C 5I8EB 4G6MH 3O4OB 1WBZB 1WFOA 4NBYB 5CBAB 4PJXA 4RGNB 1P7KB 1GC1L 3QCVH 5C1MB 1P4BL 4ODBD 4JRXD 3N1FC 3GSRA 4N1HB 1FPTL 3MUGB 1PG7H 4F2MB 4XCYA 4J6RH 4WW2C 5ITBL 1IEAA 1GIGH 2OTUB 2NLJB 1MIEH 2X70A 3O6FC 1YQVH 4XBPB 3RWDB 3NVQA 1CLYL 5D7KE 1LDPH 3G5XB 4Z8FL 3GMPB 1NGQL 4PJFA 4JHBA 1DQDL 2R39A 5CHNB 4I9WE 3OR6A 4OQTH 1H8SA 4JKKA 1RJLA 2CUHA 2V5SA 5GRJL 3SDAD 5JLZB 5FOBA 1MJJA 1MLCB 2P8PB 3IFOA 1QOKA 1X6LA 2Y06L 4NQEE 5B4MC 4WI2A 4UIKL 5AEAA 3VCLA 5TQ0H 2PO6A 3MLZH 1SY6H 1A1MA 5IW3A 5TDPA 43CAA 1X4YA 2FLRT 1BD2A 5DD1L 4MCYB 1R5VB 1U8HB 2C1OA 4G43A 3RVVC 1CG9A 4XCNA 4MX7B 1WBXB 3C9NA 3DOSA 1K4DA 4N0UE 4P2RE 43C9A 3V6BR 3O0RH 1YEFH 4MJIE 4PLKD 3ZKMD 1H8NA 3KPSE 2Z9TA 4PLNC 2OP4L 4F33A 4K9EL 4YUEL 5TQ2L 1OGTA 1KB9J 4LEXH 1DQTA 2DWEA 1G6VK 5KS9B 2R2BA 4OTXL 4YR6A 3G5YA 4MNQE 3OSKA 4CL7A 4LVOC 3TYFB 3IDNB 1VPOH 3G5ZB 5SWSE 3TA3A 3TA3B 4GG6B 4QRQB 2F53E 2A9NL 2BSTB 5D1QD 1YQ2A 3B2UC 1KT2B 3PV7A 3K8KA 4R4BB 2FJGA 3QUXB 2VN7A 4MA7L 4X6DB 3CJJA 4UB0L 1KV3A 3S8WA 1GC1H 3DI2B 1KENL 1WAAA 2PKDA 2R8SL 1KCSL 1MCOL 1RZKH 5J06A 1BD2D 3G6DH 3C9NB 1A14L 1R3JB 3TT1L 1CG9B 3FOLA 4OCMC 4FQIH 4JO2H 4MCYA 4HF5H 3VXSA 3PWNA 2ICCA 5EU4B 5EIIB 1YUHB 4JDTH 2PW1A 3PE9A 1VGKA 4FMKA 4UDUA 3QUKA 4IMLA 3EIFA 4HAGA 5JOFB 5FUOH 4NQED 3MRBB 3MUZ1 3KPSD 1T5XB 3BJLA 4JPKH 3VCLB 4JRYD 4P2RD 3K2MC 1KBGL 4UT9H 4I0CC 1MQKH 5IESH 5C07D 1KB5B 1NLBL 3T2OA 3FT2B 4OCWL 5CHNA 4KI5F 3ILPA 4LSUH 1TNMA 4Y4HC 2R4SH 1I9RL 4JAMB 4KTYA 3EOBA 1P69B 3RWDA 4XBPA 1U42A 3U30B 3SHSA 4GG8A 2X70B 1VGEH 2ARJQ 1MIML 3NA4A 5SWZE 3S5LB 4HC1A 1WAAF 2I5YH 2ZG3A 4X7CC 4LLQB 3TP4A 2D7NA 2APTA 3PQYA 1WBZA 3CZJA 4MMXC 4PV9B 1ES0B 4WV1B 3LKSA 3UZEA 4DKDC 1BBJB 1A2YA 1CD1A 2H1PH 3LOWA 1H9VA 2ED8A 4R0LC 3QJHB 1NL0L 4XT1C 4JG0H 5ITBH 1R0AL 3IFNL 2Y9RT 1U8IA 4CNIA 3OKKB 3C6LB 1U3HD 4JFDE 3QH3A 1CDIA 3ZTJG 3TCLB 4Z6AT 4WJ5B 5FDWA 1JV5A 1MCOH 2W0PA 2DOCA 4PB9H 5GGQL 3TIDB 3E6HB 2YXFA 3VGDA 4U1GC 3VD5A 5ADPL 1B0RB 5DURD 3NCCB 4ENED 3UTSD 5DC0A 5I1CL