2GY5A

Tie2 ligand-binding domain crystal structure
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
423
structure length
423
Chain Sequence
AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIPRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of the Tie2 receptor ectodomain and the angiopoietin-2-Tie2 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Angiopoietin-1 receptor
total genus 89
structure length 423
sequence length 423
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10430 Ig_Tie2_1 Tie-2 Ig-like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gy5A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gy5A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gy5A02
2.170.300.10 Mainly Beta Beta Complex Tie2 ligand-binding domain fold Tie2 ligand-binding domain superfamily 2gy5A03
1JUFB 3GB7B 3IJHA 4FQIL 3FQUB 2D2OA 3CZJA 3MBEC 4YGVB 4BQBA 4Y5YC 4GXVH 3HG1E 4GXVL 4PG9B 1DLFL 3DROB 5BQ7A 2DTMH 3SBWA 2LQRA 3QO0A 4R7DA 4YXHL 3UAJD 2XN9D 1NAML 1CBVH 5I1AA 3OSKA 4DWHA 4O9HL 4OZHF 4A2MA 4Z7QE 2HT4C 4EXKA 3DWTA 1GYAA 2D7NA 4I0KA 3CXDL 4W6WB 3RWHA 4G6MH 3NH7H 1EMTH 4QTIL 1DZBA 2XTJC 1U41A 3D9AL 3EHBD 3PQYD 4EN3A 3CPLB 4LCYA 1Q72H 5C7XL 1PQZA 3OJ2C 1ZT7B 2CJUL 3BVNB 4ERSL 3PWNA 5ANMB 5E5MA 1TPXC 4OFYD 3VGGA 2Q86B 1U8HB 1N8ZB 1UH3A 1CN4A 4PJIB 3DJ9A 2I27N 1OAUH 4NNXB 2QBWA 3MV8E 4GRWF 4Y1AD 5IK3B 2APFA 1R5IA 1QFHA 1U8MB 3OR6B 1AFVL 1TVDA 2XV6B 1G7LB 5T5NF 2Y06H 4YHKL 4LU5H 2BMKA 3B8SA 4JFHE 3AS1A 1I1AB 2VXUL 1QPXA 3FB6A 5D1ZB 2AP2A 2UUDK 1R0AL 3P11L 4DGIH 4Z7UE 4D0DA 2XWTA 4GKNB 2Q8AH 3VFNA 4X6EA 1FIGL 1VFAB 4RMQA 3VRJB 2V5RA 1BOGB 3IU3A 4M1DH 5DJ8B 3IDNB 3PGDA 5T1KD 3H6JA 4KJWD 5CD3A 1KXQE 4K3DL 1LVEA 5CP3H 2X89A 5F7WC 2HKFL 1OGAD 4ZMAT 4MSWA 3S34L 5FYLD 1OPGL 3CU1A 4ZAKA 3VXQA 4LK4A 4X4YB 3L5XH 4ZDHB 3ULVH 4OZFA 1S3KH 4JRYD 3UTZA 2CKBA 3QEHB 3F65A 4F3FA 3SO3C 4N5ED 1ERNA 1CWVA 5KANG 3WN5C 1FO0A 2EICA 1J1PL 2HFTA 1NGZA 1FZJA 4UTBH 4QWWD 5DD5L 1W0VB 2IPUK 1U8MA 3O6LL 3QHZH 4IRJA 3K80A 3VFVA 3FB7A 1A14H 5EOCJ 5HYJD 1AR1D 3UP1A 3RWCB 2CRZA 5J3HD 5HYJE 2BK8A 1HKLL 3FO0H 4YHIA 2FDBP 5FYKU 1CT8A 3UTQA 1AKJB 1ZANH 4X6DE 5ETUA 1KIUA 4M8QA 1ND0B 1EFXA 4MJ5B 4F7EB 2E7LA 1LDSA 5CAYB 1LD9A 5MEND 5B8CC 4UIKL 3BDXA 3N0PB 3SKMA 4WUUB 5FHAL 1KJ3L 2NX5A 5FEBA 4JFOB 1JHKL 3HZKB 1MIML 1H5BC 2OL3H 1RMFH 5I8CA 5ICZB 5GS0H 4RQQB 4DUWA 2Y5EA 3QJFA 1T83A 2C3HA 1T20B 3D3VE 3SGKC 3TPUB 3JV6B 3STZA 3KPRA 3VFMB 3JUZA 5I75C 4HLJA 4MWFB 2G75A 4CDHA 3LRHA 5H37H 4J3VA 5FGSA 1H8NA 4P4RA 1T1WA 4HWEH 1CE6B 3EYUL 1RK1B 1G7IB 2NLJB 1XF4B 3WLWD 2ZCLL 2UZIH 2PCPA 5C08B 2ID5A 2APXA 3KYMB 1UXSB 2DL9A 1J11A 2VIRA 1BGXH 5BRZA 3V4PL 1ZHKB 4Z7UB 1S5HA 4EI5A 2E27H 3MYJA 5BVJB 5HYFA 2DLIA 2XZQL 5D4QA 5ETUB 3LSOB 4IDLA 4KTEL 1MI5D 4NSKA 4UILH 4RRPG 4AK1A 3AVEA 5C6TL 1FYTA 3DGGA 5J3HC 2F5AH 4PY7A 3I9GL 1CK0H 1EBPA 5J11B 4LLQA 3ZDZE 3KXFA 4IRZH 1AXTL 3OJDB 5F9OL 4FTVE 2X4OA 1EH9A 5I15H 2QQNL 3H42L 2EDNA 3RIAK 3RWDB 1MCKA 3OR7A 4M6OL 4PJGE 4JN2B 4UTAL 2VC2H 5I0ZA 1PYWB 1OAXL 3V5HB 4MWFA 3MLXL 5B4MC 4CADB 4DAGL 5SWSA 3GNMH 4BUGA 1DR9A 4U1KB 1MHHB 4ZSOA 5J06A 4BQ8A 2AXFA 3TV3L 4XNZB 1KT2B 4KZDL 1IAKA 1QRNA 5EU6A 3VFGH 1ONQB 4NQDA 5DJ0A 2HLAB 1XIWC 2C4XA 4U2YA 4KI1A 1D5MA 1IC5L 4Q0XL 1GC1L 3CLFL 3SPVA 1K8DB 5CINL 3K4ZA 1P2CB 1KULA 3CFEB 5DQ9B 4Y89A 3PE9A 4HJ0C 2VABA 4G6FD 4CN6A 1SQ2N 4NQXB 4X6BA 2DQIL 3SDYH 1QLFB 4WUUE 3O3DA 2IH1A 5TDOB 1JYWA 5CJQH 5E8OA 3CX5K 5MEOA 5DEGA 3OKEB 1CR9H 3QCUH 3EDJA 3PL6A 4ZPVB 2OQJA 5T1MA 1JMZA 5HHPA 4IBLT 5AG9A 3O81A 2OI9B 5DJXB 4P9HC 2EXWC 4ODHH 4TVPD 1BREA 4HG4J 4MJ4A 2BOBA 5EUOB 5KOVC 3ZTNH 3HNTH 1EUUA 3OGOE 3SKOA 3VFPB 3VCLB 3Q6GL 5EO0A 4K7PH 2OTWB 5A2LH 3VGBA 5E2TL 2DN7A 4BM7A 3GSXB 1Q9OA 3C8KA 4XP1L 3KR3L 3BN9C 3SDCC 4IMLA 3HTLX 2OJEA 2VZUA 4UMGA 4WI7A 4I3RL 1OTSC 1G7QA 4WWKA 4F2MA 3ULUF 3T0BA 1IAIM 2Y9RT 5INDA 3GMLA 5EO1A 2G2RB 3RPIA 3P4OB 5A2IH 1W8OA 2FHBA 1BOYA 2PYFB 1Q94B 4IS6B 1I3VA 3F7YA 2KQNA 1AR2A 2VDPH 2X40A 4U4BA 5CS7A 4PJ5E 3C5SA 3KPSA 4DCQB 2HKHH 4DN3H 1S7QA 4BQ6A 2QSVA 2VLJE 5IWLC 2ICWA 1UA6H 4M7JL 3FB5A 2O61A 5LGJA 4L4VB 4F37F 1LWRA 3P4MB 4KRPC 4NZRH 5KVFH 4LSRL 1EK3A 4U1GB 4JQXC 1ZLSL 5GGQH 4J3UA 4OI7A 1CVSC 1P4BH 2H3NB 3OKKA 4MA8L 1A02N 2Q76A 2GY7B 1T1YB 2Y7QA 2LAGB 4K2UH 3SDDB 1L7IL 1J1OH 1MLBA 1MCDA 5JW3L 4QOKB 4PJGB 5ALBH 3CVHB 2ITCA 4CJ0A 5E6IB 2EEDA 1OQXA 3UXFA 3PV6A 4GS7C 5D6DA 1B88A 5CD5D 2C26A 4P2YA 1QLEL 2JJUA 4Z7NF 1NGPH 1E0OB 3MUY1 4Y2DA 4YK4C 4LAQH 5MENB 4HX1A 2VXQH 2J8UA 4EDWL 4E5XB 5C9JB 5SWQA 4IMLB 4UNVA 1U8IB 3NCYP 5AZEH 1HZHL 3QZWG 3VXNB 1MOEA 5DRZA 5T3XD 3W9DA 5I17B 5CGYD 4X6FB 1ZHNA 3RWHB 4LLWB 1YEHL 5E7BA 2VZOA 4R0LC 3RTQD 3KPSB 1F3DJ 5FIEA 1NLDL 4FQXA 4NDMA 2B8OT 3QFJA 2D7TH 1NMAH 3MUZ1 2IALB 2VKXA 1DVFB 1QLRA 3MLTA 4HWZA 5CSGA 4Y1AA 1ZGLA 3TVMD 4NWUL 4UI2A 4KVNL 1K8IA 4HUWA 5FECB 5KVEH 1NCNA 4JQVC 1XF2B 2IWGA 4JPVH 3GKWH 1MLCA 3R1GH 1MCEA 2AJVL 1EX0A 4XNYH 4TTDD 4J2XA 4XI5C 1JGDA 1DQQB 3LEVH 3VG9C 1HXYA 4U1JB 3MGOB 3QDHA 1MCLA 1ZLVK 1YECH 3VXRD 5JPMB 1ES0B 4JFED 1A6AB 4R8WH 2CDFB 3BHBA 3D0LA 5E00B 4HW6A 2LU4A 3OKDA 4KGJA 1D5BB 1ZHBB 4U2ZA 4XTRC 7FABH 4X6DB 4BZYA 1I8KB 43C9B 4KI5C 1F6LL 3FTGB 2PYED 4JRWA 3I6LD 3V7MA 3BQUB 3F7VA 4OFPA 3K8MA 5DMIL 4HEME 1PKQE 5I1HH 3UCRA 2HN7A 2JIXA 5I30L 5GSVA 2V7NA 5IG7A 1I7RB 4ODVH 4JY5L 4Y4HB 3VW3L 3QUYB 4XH2B 4XHJC 4N8VB 1BLNA 3WNKA 1B9ZA 2NR6C 4JR9L 1KC5H 4CJ1A 5E2VL 5FOBB 2X7LA 2WLYA 1VFUA 2RFXB 4KC3B 3VD9A 4ODUB 4RMUA 1UWEL 3BKCH 4OJFL 3BKYH 1A1OA 1MLCB 3U0PB 4YIQB 3QO1B 1RZJH 4QRQA 15C8H 1DEEB 1FDLL 1EFQA 4NQCE 3WFDH 3H7LA 1R5WB 4J6RH 2AABH 5IEKA 5C2BL 4PJ5B 2W9EL 4TUKH 1SYVA 5L9DH 2YHGA 2VLJB 1U8PA 5DURB 2Z4QB 4M7ZB 2X1QA 4HULB 2G60L 5HYSB 5SX4H 2O5ZL 3S36H 4KVCH 3O4LB 1F4YH 4NCDA 4HMEA 4LDOB 1IARB 4ZTPH 1FC2D 1Q0XH 2R1XB 3HNSH 1ZS8B 5T3ZD 1GZPB 3GSNL 1OHQA 1T20A 4D9QD 4PV9B 3QCTL 5IMLA 3MODL 3W2DH 1W0WA 3QQ9C 3TGXA 3UC0L 3ROLB 4FXKA 3JV5A 5CBAB 5IFAL 1J0HA 5IFJB 3QIUD 4YHMH 4WNQA 1G1CA 3EHBC 2GAZB 5KZCB 1QKZL 1Y18A 4HC1H 2NTSP 2WBKA 4YUEL 3CFJA 3FFDB 1K6QL 4HS3B 3RWFB 4X80L 4OAWA 2NLJA 3UJTL 1FO0L 5JTWA 5LAXA 1VGEH 2BSTA 3IFLL 3KLAB 4X4XA 3E2HC 4H20H 1HIMH 3QIBD 1OD7A 4JRYA 4IDJL 2RCSH 1DQLL 5FGBA 5GQBA 4G43A 3QXTA 4A6YA 4AZ8A 3OKNA 2CLZA 1S8DA 1G6VK 4IRSB 3BD3A 2R29L 3QI9C 1S9VA 5HHVL 5K59E 3BXNB 3TN0C 5AUMB 1E6JH 5D7KD 2X05A 1YMME 2JCCA 3U0WL 2FJHA 3K1DA 5DRNA 1KEGH 3GUTB 5F6HJ 3NPSB 4NYLA 3WDIA 1L6XA 3I2CL 4HIIB 4BFIB 2WIIA 4ELMB 5ISZE 4PGCA 3RZWA 1XZ0A 1FPTH 3QQ3B 1R6VA 1RK0B 1VFMA 3QZWB 2GJJA 4OZHA 1CDCA 3VU2A 2V2XA 4M9PA 5DSCA 3PGCA 4N0CC 4ALAL 3DSFL 2EE2A 4DN4H 1MQ8A 4M62H 3QDAA 4FQ1H 5C86A 4RWYL 3TH4T 5I18H 4PJDF 5I1EL 4HH8A 5HHOB 2Q3ZA 4PJAB 1JHTA 1QRNB 4NQDE 5EU6B 4RMTA 3ULUL 4RAHA 3HNVH 1FLRL 1JGUL 5FYKE 4WI5A 4OUUB 3EOTL 5DMJB 3WJLA 3TBWB 4HV8B 4K3HA 4Y5VB 4ZO7A 4YNYA 1MHEA 4AEIH 5L8LB 4XXDA 1U3ZA 1TDQA 4XXCC 1KPRA 1VGKB 2OP4H 2H26B 3KXFD 2LU7A 1H3TA 4KUZH 3BXNA 3CUPA 4OCNC 4PRIB 2CKBH 3P30L 3LEXB 4CMHB 3O4LE 4P46C 3ES6B 3RI5F 4XCCL 2VZTA 4X7CC 3IFOA 4LLAA 3SOBL 1MRCL 4E42A 3MMEA 5BXFA 4PTTB 3PL6D 4GLRH 3WSQL 3EO1A 2R0WL 4OGXL 4XAKD 3SDXF 4G8GB 2BSSB 3ARTA 2AEPH 5IKCA 2Z92A 5F97E 4WENB 4L4JA 1P7QD 1DBKL 2W9DL 3UTSB 4JPIA 2OK0L 4HWNA 5I66B 1F6FB 1TJGH 5E8PB 2FGWH 1UWGH 5IESL 4Z18A 3Q5TA 1MAKA 3BZEA 5HI5C 1KIQA 4NUGH 2H32B 2A83A 2W0KA 5DQJA 1HNFA 3ARGD 1G7QB 5C0AA 4G7VL 1VESA 5E5RB 3UEZA 2CIIA 4GRLA 4HXAH 3U6RB 1WEJL 2WW8A 2EDFA 2X1XR 4JB9H 4U6HB 1RVFL 3QDME 5C09E 3FN9A 4HIXH 5GRYA 2NPLX 4WHYH 5EORL 1J05B 3IVKB 4OF5A 1C7TA 1Q9WA 3FB5B 5ESQA 2ARJB 4UB0L 5HTSA 2YD4A 3L95B 3WO3B 3BI9X 1KG0A 4XPTH 3BN3B 3QI9B 3IDYB 3P77A 3ARPA 3EJZD 3B5HA 4PUBL 5E2JA 2I26N 1T1YA 2Y7QB 2KL6A 1NFDA 3B4NA 4HUUB 1JF5A 4AYFA 5JDSB 2C1PB 4KMQA 4Z8FL 1A9EA 3DX7A 5I1GL 1ADQL 4AIXA 2EDTA 2P8LB 2AXGA 4JVPA 3BPCA 4G9DA 4P5KB 2VLLA 5EWIL 2NXZC 1AXSB 1T7YA 3BO8B 4ZXBA 3NIGF 5J1AA 3K81A 4XC1H 2LU3A 1CFNA 1HXMA 4R4FH 4O2FB 5SWQB 3QHFH 5F7KC 4F7CA 2C3GA 3C09C 4MJ2A 1WT5C 4NQCA 4LRIA 1BD2D 3VGDA 2Z35A 3MOAH 3MLPA 3VXNA 4FA8A 3VWJB 3BWUC 4R6UA 5TF1L 3MRDB 5DYOB 5LG1A 3DMMB 2OL3A 3O3UN 3H9SB 1ZHNB 4LARL 2EKSA 1DQML 2ED8A 5DRWB 4WU7B 2FIKA 3B2UC 3PWLB 4U6HA 3UDWA 3ZLQC 4AQSA 5IQ9B 4NNPL 5IB4B 2NX5D 3MBEB 3Q6FA 3VJ6A 4EVNA 1MCQA 1P84J 5FXCH 4WO4C 4PJ9B 4M6NH 3WCYA 4OZIE 1QUNA 4KKCD 1U8OB 4WO4D 1UH2A 4ZS6D 5GS2D 3G6JA 2E7CA 3BUYB 5HD8C 2DLTA 2X9WA 4ORZC 3FAWA 3FQNA 4GG6A 1LGVA 1ZGLB 4E0RB 1G9NL 5GJSH 3VXTB 5JLZA 4PJ8D 1TJIH 1ZVHA 1LNUA 5DJCB 5H2BB 5D2NA 1SBSL 4JDTH 2OLDA 4WFHE 1UFUA 3DROA 3PHOB 4NN5C 4ODWA 2KQMA 3ULSA 1GRWA 1AGBB 2GQHA 1MFDH 3HE6A 4KQ4H 3LS4H 4XRCB 3AS2A 1NFIB 2Z31B 1BFOB 4XP4L 5F7LB 4JANA 5GGSY 3QUYC 1AJ7H 5SWZD 3MLUH 3PP4L 3FFCE 1MWAB 1OARL 2ENSA 3FHAA 4H5SB 3WBDA 5JW4N 4XVUC 1A7PL 1W8NA 3I84A 3MRDA 3DX9A 3HKFA 3O2VL 4L9DA 5CP7A 3HPJA 4XBEL 2XG5A 4OZFG 4Y5YA 2C5DC 3F7QA 2VDRH 3HI6H 1LEKA 1X6LA 4JGMA 2ADJA 5CWSA 3RZCC 1CFTA 5HHXH 5DHVA 1JF1A 1TQBB 3JZ7A 1S78D 5F1NA 3KYKH 1NH6A 4Z77A 4PJ9A 1KCSH 1BLNB 3G6DH 2ATPB 1OGTA 3Q3GB 5B22A 2VE6A 1U9KA 5E7FA 1W0YT 1AC6A 2P8PA 2ZOKA 4GSDH 3RX7A 1EHLH 3R06A 4JY4B 3RWGA 3C5ZC 3H2WA 3ECBA 3HZVB 4Q2ZB 1UYWL 5GGUA 2V2TA 2H32H 5AZ2H 2DD8L 2CQVA 5D2NB 3HFMH 5FUZL 5KS9E 3IJHB 2YXMA 2V6HA 5F7EL 3FCTA 5JZ7D 1FVDB 5D2LF 5LQBH 1HSBB 1RZ8A 3EOBB 3QDMB 5C09B 2X4TA 5DJ8A 1X5JA 4UDUA 4D0CA 4ZFZA 4GRWB 3QISA 1IGIL 4EXPX 1N5YL 4POUB 5EOQL 3L7EB 1CXKA 3A6BL 4WHYG 2OMNA 3ARFB 4XPGL 1OP5H 4ZOCA 1P7KB 5GGVL 1ETZA 2AGJL 3K4AA 1XGYH 1MH5A 1QSEB 5E4EC 3UPAA 2W0FB 4L5FL 3LQAC 5DXWA 2CKBB 2DBLL 4UZGA 4X5WA 2QSTA 2X4NA 1MCHA 3VXRA 5BZWB 1YZZA 3G5ZA 3PWNB 2F5BH 5ANMA 1U8HA 1I3UA 1UKSA 2NY7H 1DLHA 1KB5B 1UADC 3IETA 5K9JH 3GI8L 2ED7A 4NOFA 4LASL 1X5IA 4GMTL 1WFOA 3FZUD 2YMXH 1BX2A 4XPGH 1S7VA 3KYNA 5J12B 2RBLA 2AV1A 3S4SB 1OWWA 4GQPH 5I73B 3RKDC 3UTQB 1AD9B 1HHKA 3PNWB 3QEGL 3U7WL 4LIQL 2IBBA 2DKUA 1Z2KA 4C56E 5T1DL 4GUPB 1EHXA 5FUZH 2XWTB 4GKNA 3GJFB 5DK3A 2DD8H 4C56D 4ONOA 5GGRY 4I3SL 4MVBC 4KRPB 3UZQA 3SGDI 1IGMH 1JV5B 4OM0H 5CCKL 2FJHB 4PG2C 4BFEA 4UV7H 4JHAL 2JB5H 1EHLL 1QSFD 1UJ3A 1FL3A 2HJLB 1UACH 1JTTA 1BF8A 4XMLL 2CRYA 1R3HA 4JFDE 4WHTB 4PJAF 2W0FA 1OT2A 3C2SA 3UTPE 4LSQL 4PJ5D 5GRJH 3WNOA 1K5NA 2J3SA 4PJ9D 4F3FB 1K3ZA 1MCBA 1EEYB 3S35H 3BMVA 4PRHB 3FOMA 3QG7H 5J8OA 4L3ED 5C3TA 2CIKA 1YEDA 1H5BA 5DFWH 3KYNB 3MNZB 4PJAA 5GZNC 4N0YL 5D1ZD 3WUZA 3GGWB 5KG9A 1JZ2A 2LFGA 3GEWB 1FG2A 1NSNL 5FKPB 1FCGA 5ICXA 3X14B 2KPNA 4K7PY 5ELIA 3CDYA 1T4KB 4FQJL 3LEXA 3KWWB 1LD9B 3LV3A 3WIFB 2QR0B 3C6SA 2ZCKL 4ZNEE 4KK8D 43CAB 3V4VH 1N0XL 4YWGL 5GGSA 3RVTC 3MMEB 1EHNA 4MD0B 1RSFA 2ADFH 3P9WB 4NOBA 5JO5B 3GHEH 3LD8B 3PGFL 1C5CL 4OQTA 5D7LB 3UYOD 5D7IE 4LCIL 2HJKB 1A6WH 4CADA 3CSPA 2Z31D 3B9KA 1HH9A 5HGHA 4RAUB 3UYRL 5HSFA 4NC0B 1S9WA 2X44D 2XTJE 1ZWIA 4PBVC 3RVXD 2Y6SC 3ZYIA 1UENA 2YN3A 3F5WA 5C0AE 1WZMA 4M4RA 3C6LC 3CDGB 3ELAT 1FVEB 2YA2A 3MNZA 4GRMA 1F3DH 5DJDA 2MSPA 2OJZH 4I13B 2VWEE 2DLHA 3BZ4B 1I9JL 3IT8D 1DQJA 2ORBH 3QH3A 1AGDA 2AEIT 4PS4L 1NC4B 2XIDA 1WZKA 3B83A 4XP9H 3SE3A 1X5AA 3OZ9H 2EH8H 4L4VE 3FQWA 4Q58C 3E0GA 3DIFA 2AJYL 4Z6AT 5DD1L 2XZAL 4LPTA 1LMKA 3S5LG 3HI1A 4WFFD 3SDCA 1EIBA 5D8JH 1KPUA 1DCLA 2KKQA 3BP6A 4I5BB 3L95A 1KIPB 3O45B 5ITBH 1U92B 1RIUL 1EGJA 4MAYC 3JBG7 3MR9A 3D6GA 1HK6A 5JXEC 5M95B 2E8ZA 5GRUL 3UZVB 1MY5A 4MD4B 5JO5A 4X7FC 2EDLA 5T3ZH 3WHXA 1RZFL 4MHHI 4OQTL 4PRBB 2XNAA 2HWZH 1OSZA 4HIXL 4JN2A 1XR8B 2AV7B 4MDJB 4CMHC 3S36X 2GUOB 4ZUWB 2GI7A 4JB9L 5IOPB 5DGQA 2ESVA 1EAPA 3F7PC 4WO4B 4ZAKC 3PL6C 4MQ7A 1I9RH 1WV7T 5JXAL 4RMSA 3G04B 4B53A 3GKZA 1PQZB 3SQBA 3BKML 4XX1G 5JR1H 1S7QB 5IESH 1K4CB 1FYTD 1NGXB 3VWKA 2VAAB 2FGWL 3QFDA 1TFHA 1TJGL 3BZ4A 3WDHA 4F57H 1DBKH 1WWBX 1PW3A 3K8KA 1NJ9A 3QUZB 4OLWL 1ORQA 3DV4A 2P1YA 2VABB 5F96L 2CDGA 4F7PA 5HI3C 3WYRA 5EU5A 1U8OA 4KV5E 1F90H 2NTFB 3U46A 2V5MA 5GRVL 1DJSA 4Y4KD 2CO7B 4BSVA 1P1ZB 3HMXA 2VDKL 5ERWB 4OB5L 5T5NG 5BS0B 1QFWH 1KJ2A 3LEYL 3TC9A 3EDFA 2CLVB 1KBGH 4CMMA 1MUJB 5IVXF 5FO7B 2XKSA 5EC1B 3CSBA 3VXPB 1MCPL 4GW5B 4MNGB 4R0LA 4AEIL 1F4AA 1NCCL 1Q9OB 3VGEA 1JYVA 2MPAH 3G5YA 4OGYH 3L3KB 4HT1H 5JMRA 2Z31A 4JM4H 5I1AB 2Q6WB 3LMJL 5HXMA 2NY4C 1OGAE 4YDJB 2GY5A 3GRWA 3MV9B 5I16A 3E2HB 3SJVD 3MUGA 3LRSA 4JO2L 2A6JA 4ZUVB 3JWNC 1CLZL 3SJVE 1UWXK 3WIHL 3MFFB 4NJAL 4H8WC 2YPKB 1I7ZA 4FQXB 1F45A 3OAUH 3SE9L 4NFBA 1FC1A 4WW2C 4F80A 4X7DC 3CFKB 1FZJB 4JO2H 1XF5B 2FBJH 2EYTA 1WC7B 5D6CB 2H1PH 4WI3A 32C2A 4W68A 3I2CH 3KS0H 3HAEA 4BSVB 4FTVA 1AE6H 4JJ5A 1VB9A 2EYRA 5F70A 4OGYL 2MPAL 4TUJB 4XNQA 4RSVA 4ODTH 1A9BA 4JZNB 4LP4A 3GMPA 4U1LB 5HGAA 3VXSE 3NCMA 1RUAL 1IKFL 1MCPH 5EC1A 1XCTB 3MRRA 3VXMA 1YEIL 1L4IA 5T5FH 2BY1A 2MHAB 3WXWL 5FA3B 4P2RE 4HKXB 3TEUA 3IFLH 3I75B 4G7YH 4Z7WB 4PP2A 3DSNA 4X80H 5LXGL 3M17B 4JKWA 3L7EA 4U33A 1ZT1B 1KJMA 4JPKL 4NO5A 3FO9A 3DV6A 2XKNA 4CU8A 2DQDL 5IFAH 4PJIE 1RQ5A 2UVFA 5CJOL 2JKXA 3S37X 5BMFL 2VDNH 1MJ7H 4P4RB 5KTEH 3B5GA 4F7MB 3O9WD 4NQVA 4UNUA 1XIWA 1IMHC 1QG3A 2KH2B 3X13A 3T65B 2UZXB 5TQ2H 4GLRI 2CUIA 5AAWA 4P49A 1F4YL 4WTZG 3O3AA 1IFHH 3HC0A 5DJ2B 1MCWW 1XAUA 2G60H 1A8JH 1G7PB 5SX5H 2JJTC 1B0RA 5LBSL 1B4JL 4PY8J 1R5WA 4XNQB 4N0UB 3VH8A 3HAEH 4PJ5A 5IM7A 1E4JA 2JJWA 1CGSL 1T5XA 4M7KH 4WW2A 5C2BH 1PZUB 3C5JB 4JN1H 5J6GA 4WHCA 2Z93B 4MZ3A 1JGDB 1C1EH 4QXGH 2EE3A 2O26U 3RP1A 4JPWL 5CLWA 1MFAL 2FEDC 3UBXI 4X7SL 4ZFOA 1RHHB 1UWEH 1RZJC 3AM8A 5HVHC 3IAPA 4JFZH 1CQKA 4D9LL 1A3QA 2ED9A 1RIUH 1WIUA 3K2UL 2BOCB 5M7QA 3WEXB 3NCBB 1A3RL 2QQKL 3GSNA 1T0MB 1S7SA 3NA4A 2BCKB 2R2HB 5CILH 4PV9A 5DD1H 2AJYH 3VW3H 1JPTH 3OZ9L 4WWKC 3Q1SH 2QTEA 4NPYB 3MRHA 1UZ8B 5D72L 1PKQA 2XY1A 4FOMA 4YBQC 4LSVL 3GO1H 1HNGA 4JO1L 4NNXA 1FFPB 1WBYB 1AQDB 1JFQH 3PXHA 2O93L 3QPQC 3VWJC 4OF3A 1XF4A 5BJTA 4HCRL 4DFHA 5A2FA 5FCUH 4OLYH 5FYJU 2D03H 3GK8L 2KZWA 2GFBB 3OAZK 3QEQB 4YIQA 3K1KC 2YPLA 4MD5B 4YDLB 4KMTL 4XWOD 2NXZB 3U1SL 1SJEB 3W5MA 4LIQE 3R0MA 5HYQB 5J4MA 3REVA 1ZVSB 4L1HA 3T3PF 4DKEL 2NY3D 5ITFB 4I18B 3DUSB 5CSZB 5IMKB 2V7HB 4L8CA 2FX7L 5IGXL 3V4VL 3IU3B 3WIHA 5HDBE 5DJXA 3EYVB 1KN4L 3ZTJH 4FMKA 4PGCB 3TBSB 2IBGA 4LPXA 4H88L 3VXUB 3GSNB 2W65B 3BJLA 5DDHB 3MRNB 4NHCH 1J0KA 1C5DB 3UX9B 4WVRA 1R3LB 3QWOB 4X7TB 1A5FL 5IQ7H 2ZUWA 3NCJL 5CD5C 3VMNA 3C5ZD 4M43L 5HGHB 1V7ML 5DJYB 1MJUL 2DJUA 1I8MA 1H3PH 1HSAB 2BVYA 1T5WA 3O6FC 4QRPA 5EC2A 4IMKC 2N56A 4OZGE 4P5TD 5HHNA 1W0VA 4J3SA 5JOPE 4XGZA 4JCMA 3WV0A 4HF5L 4P5MA 4XZUB 4YFLF 3RVUC 3WKNA 1MQKH 4DFIA 2OTUB 3Q5OA 4PB0L 2X1OA 4QWWC 3RU8H 5F44A 2P5ED 4LQFH 2GSIB 1BBJA 5F3BA 3O3DB 3OKKB 2Z91A 3T2QA 4ETQB 1NCUA 4IOSD 4JO3L 4K2UL 1QFUL 1BAFH 3SDCB 4Z7OF 2V7HA 3DVGA 4PJFB 1P4BL 1RZIB 1VDGA 3PL6B 1E4XI 3QNYA 4UT7H 3DO3A 4JO3H 2VDLL 1NC2B 4LKXA 3WJLC 4K3EL 5GRZA 1VACA 3PQYA 3HRPA 3LPGA 1LO0H 4K7PX 4HLZH 4CVZB 1P6FA 5F6IC 2D7OA 1UA6L 3LCYA 4PB0H 4PJ7E 3RWJB 4APQA 1X3DA 2IBZY 3DUHA 2HKHL 3C09B 4LLYB 3SGJC 4J12A 2AV7A 2VLRA 4MDJA 4UOW1 2QKIA 4GXUN 1V3JA 1Y6MR 3ZDYF 3X3FL 4PJ8B 4MAYB 4NC2B 4Y16B 3ZKQD 5HD8D 3QRFM 4MQ7B 1LEIB 4WWKB 3JWOL 2J2ZA 3RY6C 1FNAA 1I3RB 2W92A 3T04D 3QQ9D 4WU5A 5F6IB 2P5WA 1RAMA 8CGTA 1QA9A 1W72H 4Y4HC 2F54E 4XGZB 5K9JL 5DLML 2NY7L 4XP1H 3HZMB 4Q9RL 5I6XB 1XCQA 4HJ0D 1WF5A 5DF0A 4S1RH 1A5FH 1GGIH 1P9MA 1AP2B 1GHFL 3CFDA 3MJ7B 2DYPA 3NIDE 1YC8A 1OGAB 4H0IA 4M8VA 2DBLH 3MRCA 2A6KB 2BJML 4ODHL 1FZKB 3EFFB 4ZXBC 4QGTA 1UKTA 2F53D 3UPCA 3W5NA 2YSSB 1OP3K 3A6BH 2AK1L 1QEWB 3BPOC 2HT2D 4PJFA 1JYNA 3IDGA 5DEFA 3GJEA 5EUOE 3LN9A 3MV8A 1X9QA 3BP5A 3S9DB 4U1IA 4FZEH 1WIOA 1FLTX 5J11C 2K7PA 4TUOA 2FCBA 2GJ6D 4APQB 5F7EH 4UDTA 3ARXA 4B7IA 2EO9A 2CDFA 2IANE 5EULV 3BZFB 3RBGA 5EUKB 1T1XA 5HVWA 1NBQA 3OV6A 2G5BB 4J3XA 2D9CA 3ZDXE 5E08L 1UYWH 3ZKND 1G9NC 4D3CL 1NAMB 2WK2A 4TNWK 5DYOA 4WDIB 2J4WL 3ZKMC 1ZTXH 4EDXB 4K8RH 3H9SA 3DTXA 1G7MA 1IM9D 4JRYE 2OX5A 1KCSL 3W0WA 3FJTA 1KENH 5T1LA 4GKSA 3MFFA 2VC2L 3MV11 1JPTL 5CGMA 2CKNA 1LO5A 1WICA 1CYGA 1EBAA 4RNRA 5FOBA 1BD2B 4GW4A 4OLVL 3RNQB 2CXGA 3PWVA 2QADC 5CIPH 2QQKH 5JW4M 3GJFH 5I1DB 5FOJA 2EYTB 1FNGA 1CK0L 4HFUH 4U1MB 2D4FA 2FD6H 3QI9A 4S1DD 3D5OF 5H37G 3TJEH 1A2YB 2NXYB 4NM4H 3MXWH 4OZ4B 1TVHB 4ODWB 5E4EB 4EKXA 3LS4L 3TIEB 1C1EL 3ARFC 3O8XA 1MRDH 2P8LA 5IBUG 4JN1L 3FAXA 3F12A 3VCLA 3TVMC 1B4JH 1KB9J 1BMGA 4G9FD 5I8OH 3IFNL 3QO0B 4JREB 5GJSL 1EJ6A 3ILPB 3FOLA 2QADB 2YK1L 4HWEL 2DQHH 1ZT1A 4HFWB 43C9A 5D2NC 5TQ2L 1RUML 4PYGA 3J8F7 3BVNA 1V05A 2VSDA 1XGRA 5E5MB 1U8KA 1CZ8L 4XVTL 5F88B 4LSSL 2FIKB 3E8UH 2CO6B 3P3YA 4K3GA 4OKVA 3RUGF 5HY9A 5T1KB 2IC2A 1YN6B 3L3DA 1NCDH 5ICYB 2VXVL 2DQDH 3JV4A 5CUSH 1RV6X 2N1KA 3IKKA 4LEOB 3FZUC 2ADIA 4L8SC 3RDTA 2ARWA 2R1WA 5D7JD 5J57B 5IMMB 1MIMH 3RNQA 5TF1H 2IAMA 5LCVL 3HZVA 5I1DA 4G6JH 4WW2F 1KJ3H 1AY1H 4ZOAA 3VXUD 1F8TL 3KPOB 1H3VA 1I1AA 3O2WL 5D7IB 5F8QC 3EOBA 3QDMA 5C09A 5T5FL 3VFNB 4X6EB 4MYWB 4B5EA 2D4DA 2P44B 4BK4A 3MLWL 3MRLA 3QNXA 3DX6A 3LHPL 4P2RB 5DJZB 3QDJE 4CVUA 3AGVA 2C1OB 2XQYG 4ZFFA 3L1OH 4R90H 2IG2H 1AE6L 1FFOB 5HYSA 5C9JA 1EGJH 4LMQE 1JPGB 3NCEB 3FOLB 5DD5H 1MWAA 2PKDA 4OZFH 3NACL 5E9DE 1IQWH 2R4SH 3CVIL 4Y2DD 2FWOB 5EU4B 4X6CA 4NNYB 3DNKA 4OZFB 1XGRB 3G5ZB 4DEPB 2JJVA 1FZMA 3VGHA 2ZKHH 1LEKB 1MWAH 2EYSB 4OI9A 4NRZB 4Z78B 4N90E 4MXWH 4JQIH 5GXBB 1YN6A 4ZAKB 2EECA 1J8HB 5CWSB 3VXQB 4ZD3H 4NPYA 1RVFH 5ISZA 4GG6F 4FXKB 5IFJA 1CLZH 4UT9L 5CBAA 1OPGH 4U6XB 4JDVB 3QRGL 1S9XA 4P46B 2GJ6A 1S78C 5KS9A 3LQAH 4KDWA 1U8QA 3AB0B 4LNRB 1VEOA 3QFJB 2IALA 4E41B 3DURA 3OHXA 3MRIA 3MRKB 1ZA6A 3RTQA 1AD9A 4DEPC 1NEZG 1UJ3C 5FYKD 4PJDB 3VI4E 3MBXH 5GGUB 2V2TB 3K3QA 1BZ9A 1UWGL 3ETBF 2BFVL 1YC7A 3ZHLA 5BV7L 4YHIB 2HTLD 4JM2F 3FFCB 2CMRH 2W0LA 2WIMA 1SJEA 1RU9L 4O2CB 1UVQB 3MRJB 4GKZA 3MYZA 4H1LA 5CZVH 5KVGH 4L1DA 4HWBA 3N50A 5ITFA 1XGQB 3MLRL 1OM3L 2CSPA 4PTUB 3MJ6A 1MRCH 3DBXA 2X5PA 5ID0A 1XGPB 3OKDB 2FSEB 1M05B 1PJ9A 3RQ3A 3MLRH 1F90L 1N7ML 1YEKL 1ETZB 4WY7L 1UM4H 3BE1H 3AU1B 2R8SL 1EO5A 1KYOK 3UTTE 1T7XA 3VFUA 3IXTA 3VFMA 3TO4A 3W81A 5I8CB 1GGCH 4OLWH 2CMRL 1WZ1L 3ZO0A 2WMPA 4PJFE 1A6VH 1U42A 2BNQD 4LPUA 2H32A 5C7XH 1LE5A 3EOTH 5HVHB 3TN0B 1TVBB 3PGCB 3OTTA 1UEMA 4PG2A 3LKSB 4GMSH 2FATL 3WFHA 3U6RA 2DIBA 4U0RB 3KPPA 2BC4A 3OHXB 5FM5M 2H6PB 3EDKA 4RWYH 3TESA 5C08A 3FRUA 3H9YA 1HWGB 3C2AH 1PG7X 3FQRA 4YDKH 3PNWA 5TDPA 4HV8A 3ZKXC 4MXWL 4G80A 3T77A 2PO6B 2R0KH 1WQVT 5T3ZL 3WL9B 4X5XB 4HKZA 1JK8A 3D85A 5GRUH 4Y8AA 1SYVB 1BBJB 2VKWA 2VLJA 3C8HA 5E8NB 5F3BB 5IB2A 4FQQB 4Q9QH 5J12C 2VN4A 4MZ2A 5J1TC 2P7TB 1WISA 1UC6A 4ODSH 5B8CB 2J8UF 1T04B 1DN0A 4KKBC 5BO1H 2DS4A 2XZAH 4WEMB 2A6DB 2HJKA 2VLLB 3QWRD 4H8WH 2ZOLA 1MCWM 1FNLA 2R29H 4JRXA 3OBAA 1I9JH 1T22A 3OR7B 5MHSE 1DQLH 5CFHA 3VI3F 1FZOB 4F7CB 2YRZA 3P0VL 3BPNC 3BZEB 3IS1X 2UV3A 1NGWA 4CRPA 2A83B 2YOCA 4JFDD 1OP3H 3IDYC 1MFBL 3UJTH 1K6QH 1YEEH 5GGVY 2EZ0D 5J0BA 5FHBH 4LF3A 3SE8H 1J87A 5H94B 5CUSL 2H2SC 2E8YA 3FQWB 2PYEA 1D5MB 3FQRB 3SPVB 3MROA 3BESR 5B3JE 4LCIH 1KCRH 1VENA 4O2EB 3ARBD 4FQCH 4PV8A 3PGFH 4OF6A 4MJ6B 1Q9WB 1VFBA 1A6TB 5I0DA 2DQGH 4G9FA 1OB1B 2DQHL 3MRGB 3S96B 2J8HA 4QRRD 3AY4A 4HUVB 4NC1C 4KVCL 4PGEA 4OKDA 1CXHA 1NMBH 2E7BA 4PGDA 5DJAA 2OBGA 2ZCKH 3PXJA 5EUOA 1CTNA 4KPHH 4Z7OE 4U1SB 3BQUC 4BH7A 5JOPD 1WBZA 1H15B 4OLEA 5EO0B 4X9IA 3VXRE 2OTWA 4TUKL 2JIXD 3O2DL 3SE3C 4ZUUA 1AGBA 3HE6B 4ONFH 4PB9L 3FO1B 1LK2A 4XX1E 1AQKH 4F33B 5BVPL 4ZUSA 1UWXH 3L6FB 5C0CA 2H2SD 1AXSA 2EC9T 5GRXG 1PY4A 3BO8A 4ZXBB 5EUKA 1FAIH 1AO7B 4N0YH 2EXYD 5CBEB 5TE4H 4N0UE 1MCNA 2C7UB 5GHWL 5GZOD 3F5WB 1KIRB 5A40E 1C12B 4XPAL 4OLVH 5HDBF 5FB8A 3ILQD 3U2SB 2NZIA 3LD8C 1JRHI 3KPSE 3H0TB 2ADJB 3EYSL 3KNBA 4HAFA 2I60L 4YBQD 1JNNL 3U4EB 5IB4A 2DJSA 3MBEA 4FXLA 1IGCH 1NUNB 1OGTB 1ZOXA 3TVMB 5DD0H 5ADOL 1SM3H 2F53E 3TO4D 3R06B 4WWKD 4G9FB 4XMLH 4G8GD 3MOBL 2X9XA 4YEEA 3KPRD 1KJ2B 5JOFA 1NGQL 1NL0H 7FABL 3ES6A 2DBJA 3IF1A 5FO7A 4J4PA 5E08H 4JAMB 4RFEB 1QBBA 1E4WL 4MD4A 5MENA 4MNQE 2QHLA 1T66C 1ZVYA 3PHOA 3PABA 1I1FB 4KK5C 3LEVL 3MZTA 2PTTA 4UDUB 3O8XB 4D0CB 1S9YB 3D18B 5IW1B 1HCVA 2AJSH 3CDCA 3JSSA 4TULH 1A7NH 5CD3B 3KGRA 4R4ND 1ZT4B 1FCCA 4W4OC 1MJJA 1KIQB 3BISA 4ZUTA 3QUXC 3NFNA 3I6KA 4ODBD 4BZ2L 5FYJH 4PY8I 3LRSB 4Z0XB 1C16A 5C0BE 3MCLH 5CSBA 3O4OB 4GMTH 4ZTOL 1VADB 1HHGA 4APQD 2IGFL 2XKUA 3IJYB 2DDQH 1K4CA 2G5RA 4GW1B 4F9PA 4N1HB 1CGTA 4IRSC 2XTJD 3RAJH 1GGIL 3O6FB 4HG4K 1MIEL 4DVRH 4G8IA 5DLMH 1JF1B 2Z31C 1BX2B 4NIKB 3WUWB 4LEOA 5IHZA 1CLYH 1XGYL 2Q1EA 4RMRA 5MEPB 4CVXA 1D5XA 1P69B 1A1MB 1TLKA 5K93A 5IMMA 3JWOH 1CDYA 4CDGC 1AI1H 1OF2A 3RWEB 4TUJA 3VH8G 4AIZA 3GHBH 3ZYJA 3Q2CA 1IGIH 4PJEA 5BS0A 3QDGB 3E6HA 1DBML 5AYUH 3SEPA 3KHOA 5D7IA 4PLOB 4RISL 1YJDC 3AREB 4PRPD 3RGVD 4DUVA 1X5XA 4PJFF 5DO2D 4LCCB 4PRPE 1L9MA 3FCTB 3ISWA 1IC7L 1LO0L 3O6ML 4QHNB 4JZJA 3BPCB 4P5KA 2WWMD 4PP2B 4G8FA 4WJ5B 4ZFZB 1L7IH 2VDLH 4ZFFB 1N59B 1YEFL 1BIIA 1KJMB 3LOWA 5D71H 3QG6A 5KSAA 1BAFL 5GZND 2MCPL 3FO9B 4R26H 4MDIA 3U83A 4QF1B 3RVVC 4X6CB 3V5DA 1EEZB 2J5LC 4RDQG 4YDVA 3L7FA 3CC5B 3T8XA 2IAMD 4LPCA 4YHOH 1EEYA 1MQKL 3HI6L 5IV2A 4OCLC 3U4AA 1DLHB 3Q6FB 2XQBH 3VJ6B 4ENED 4EVNB 2ESVE 3O2VH 3HC0B 3IS0X 1S7XA 2OCFD 3QA3B 1FL6B 3V5KB 2LVCA 1FJ1B 4JZOA 2VB5A 1A1OB 3HAEB 1ED3B 1EEQA 2EC8A 3QO1A 5I1CL 5DQDL 4E0RA 2NY2C 2V2WA 1GPOL 2EYRB 4U1NB 3V6FB 5I71B 2HG5A 5IEKB 3NVQA 3UO1H 1UQSA 3NCJH 2XN9A 1ZA3B 3O9WB 3TZVA 1SVZA 2VISA 4QRQB 3LKPA 2HFEB 1VFAA 3LV3B 5EPMB 5JXEA 3DXAB 3V0VA 4G8FB 1JGVH 1KEML 4HXBH 1G9NH 3WUWG 4YZFF 4PBXA 3PJSA 3SGEH 1Z6JT 3O11B 4NCC2 1T0MA 4WV1C 2VZ1A 1PSKH 2VR4A 3O6KL 4KHXH 2AJZA 2VXSH 4MB5A 2GK0B 3FRPA 4XBGB 5SWZA 2AEWA 5CJQL 3PF2A 1OAZH 5C8JB 3BIAX 2DQIH 4OBRA 4W70A 1CS6A 4Y1AE 3SDYL 5FF6A 4ELMF 3OKMA 2ZG3A 3HUJB 2R1XA 4H26A 2B0SH 3SKJH 3AC0A 4U1KA 3ZKXB 1NBYA 1JZ3A 1FVCB 2D03L 2F9BT 1IC5H 3IRZA 4Q0XH 5DHVB 4OLYL 4PJIA 3GBLA 3ZSTA 5I1KH 4PRHA 1MCOL 4YC2C 3MJ9A 2YR3A 1OTUD 3RWCA 4NP4L 3MOQA 3GO1L 4R4FL 5CZKA 3ZDXF 1JGEA 4XC1L 1HCFX 1AGDB 3NZ8B 3OKNB 4LHUD 4O02L 2BSTB 3KLAA 1RZGB 4ZAKD 1BBDH 1EDQA 4O4YL 5TDPB 3FKUS 2ATKA 3GJFK 5HJ3B 3LIZL 3RDTD 4Z8FH 4NZTH 5KSVA 1G7JB 4RAVA 4LHJB 4XAKE 5I76A 3VRJA 2WBJD 2E9WA 3TBSA 4M5YH 4K8RC 2FR4B 2W0PA 5CHNB 4JE4B 2W65A 1OT1A 5BCAA 3QIUB 3DLQR 4QEGA 2ICWJ 1IAIL 1C5DA 4R9HA 4X7SH 5C6TH 2HP4A 2IPTL 4BFIA 1M4KA 1ITBB 2HVKB 4QXTB 2VL4A 3TJHC 4NQUA 4XCYA 1XZ0B 3WE6A 5F9DC 4HLZG 3QXAA 5DFTA 4M7KL 4U3XA 1BD2E 1KTLB 4BUHA 3UTZB 1BGXL 3QIUC 1WEJH 4M6AA 4MB4A 3JXAA 4Y2OA 2PO6C 3VXSD 4OIBA 2QQLH 3P4OA 2WWMC 2VZVA 4ZOBA 1FFQA 3P9LB 1VA9A 2LVEA 4M48H 4TTGA 5T3XL 4Y5VA 4OCWL 4NC1E 3UTTD 4NUJA 5BZDA 5GJTL 4JHWH 4DZBB 2PTUA 3CX5J 1D6VL 2R4RL 4PJCB 5CJOH 3MROB 5EU5B 4O2EA 3TT1L 3GRWL 2AEPL 2BVTA 2HMID 4Y4FC 1JVKA 5GS0L 4MJ5A 1A6TA 1HYSC 1G7JA 3INUH 5CSZA 4PJXA 5LXGH 1NC2A 3RNKB 2W9LA 3C60A 5DK0A 3I3EA 4WW1B 3BUTA 5B3NA 4UIKH 3MA9L 3RY6A 3IAQA 2VQUA 3OKYA 2RQ8A 2Y36L 4KUZL 3V2AR 5D9SA 1B2WH 4ZYKB 4Y4KA 2EDBA 1U91B 1ZANL 4L3EB 5BS0E 3STZB 4MQSB 1MHHA 3HNVL 5DJYA 4L8DB 4OM1L 4UINL 1A14L 1U58B 5KANI 2BRQA 3FT3A 5C0FA 2H1PL 4NM8L 5HHOE 3TNNA 4FQ1L 3T0EA 3PIQA 3EZ8A 1PLGH 1DFBL 5IHBA 2JLLA 3MJ7A 3SE9H 4OZGA 2WUBH 3CFEA 2VAAA 1CXIA 1S3KL 3WDJA 5INCA 4AY0A 4GAGH 3HR5B 1YUHA 2W07A 2X10A 4P2QD 1GGBL 2EH7H 4U7KA 4WWID 1A0QL 3IDXH 1FFRA 1MRFL 4LKCB 1CE1L 1TJHH 3V6ZB 4IM8A 1FYTB 1OL0A 3DGGB 4XNZC 4Y5VC 3TA3D 5C0EA 4K3DH 3BP5B 4ONGL 5CJ8A 1OSPH 3PHSA 2ICCA 1OTTD 3HZYA 4HD9A 5FUCC 5TE7H 2VQTA 3AM8C 3VXMB 3G6JF 4JKMA 5TH2A 2GTWA 3DMMC 1M7DA 1T7ZA 2MKLC 4U6YB 4DK3A 3DRTA 1FQ9C 1ES0A 2PTTB 4LRNH 5GS1B 4R0LB 2RCSL 4IDJH 3OPZH 4NQCD 35C8L 1MI5B 4LU5L 4WDIA 2DIJA 3RX8A 2DI9A 4X6DA 3B9KD 4FP8L 4FQXC 4OB5H 1T2QH 4LSDA 4Q74A 1G7MB 1AFVH 2PN5A 1G7HB 3L5WA 1LP9A 4ZSOB 4MLIA 4JFEB 5EU7C 3FQXB 2WZPD 2WSKA 2NY5H 1FV1A 2ZUQB 3DETC 3PWLA 4KK9C 1FBIL 1ZSDA 4PGJA 5DJ6B 2JB6A 1AH1A 3QUKA 3UBXG 4ZFOL 4LPYA 2OL3B 2AK4D 4WIQA 3CMOH 5GIRA 3WO4B 4XVSH 3BQUD 2NY4B 4NBYB 3GBMH 3B43A 3HNSL 4BH8A 3D9AH 3CFKA 2FECL 5JR1L 1BFSA 3WUWA 3NH7L 2JK5A 3KPRE 2VH5H 1CG9A 2PR4L 5DR5H 3T0XA 3T09A 1QEWA 5DT1L 4FQXD 3L3JA 4AH2B 1DANU 4NGHH 1CBVL 4XPHH 1QQDA 8FABB 5J6GB 5C0DB 4U0QB 4LNVA 3OG6B 1N6QH 4PRHE 5L9DL 1EXUA 1NUGA 3GMPB 5D1XC 4KAQL 5EBMB 5A3ID 4NJ9H 4OQTH 5SX4I 1BM3L 3WFDL 4P2OA 4R7NA 4FQIH 3WHXB 3GMRB 4K7FB 4PJIF 5ACMA 1XR8A 4LLUB 3THML 3C8KB 5DZOA 4HH9B 5IMOB 1ODAA 1OAQH 4LLDA 3QPQD 2IQAB 1DBJH 5KAQG 1E4XL 3SQOL 3FQXA 4OQ1A 5E6ZA 3O8XC 5DMKB 3KLHC 1EEZA 3HPJB 4XP9L 1NGXA 1NFDE 1F4WL 4C54A 3ULVF 3KDMA 4CL7A 4BA8A 1T80A 4OCXH 3LH2H 4QOKE 2ICWB 2EDKA 4LRIC 4OFIA 4QT5A 3T65A 1F6AB 4Y1AB 4EJ1C 3RA7H 1AHWA 3V8OA 1CDUA 1YNKH 1BIHA 3MNWA 4YHNB 4L4TA 5HYIA 3BW9B 3KLSA 1MREL 3NAAH 2P8PB 2ZOKB 1EPFA 4N0FA 4AH2A 3HE7C 3RJDA 1WBXA 3U4BH 1S8DB 1YECL 2R2BA 4PJ7A 5DZNA 2K7QA 1A6WL 1T5XB 1KGCE 4F9LA 1IAOB 5D7JB 4U1GC 4U1JA 4XNYL 4HSQA 4PBWD 1IT9H 4UUJB 2AJVH 3QXDB 4Z7WE 3R1GL 5EPMA 3WKML 2ADFL 3GKWL 2AKRA 4IRSD 1URLA 1JPGA 5I2IB 1DBBL 1WFTA 2NW2B 3QIBA 3C6LD 4HH9A 4APQC 1N0XH 3UTPD 1MEXH 1NPUA 1SJXA 1S5IH 4NNYA 4CU7A 4F58H 3HC3L 2YKLL 2I25N 4FQHB 3QQ4A 3LZFL 5SWZB 4L3CB 1P7KA 3ZZ1A 4WFFE 4FRWA 3N85H 1D9KB 4P2OC 1F2QA 1QNZH 3HE6C 2V2XB 5DSCB 1MAJA 4P57B 3EO9H 4R4NC 2EDJA 3ARGA 3X12A 1N2RB 2BRRH 2ZUXA 5L7XH 3QUYA 2BVQB 4XH2A 4N8VA 4GRWH 3DURB 3MRIB 3VG9B 5GGTA 1A7OL 4E41D 3BIKB 3I6GB 2DQTH 1OP5K 5E1HB 2LTQC 5CEZH 2PCPB 5TE6H 1HZHH 5IBUB 3M1BA 4NQEE 4I0PD 3QG7L 4WCYH 4N5UA 3KPOA 5IBLC 4KRNA 5DZLA 4JFEE 3FB7B 3BEVB 3MC0A 4OIIH 3W0WE 1ZHKA 2NY5C 4TRPH 1KPRB 1J8HD 4H25A 1QLEH 1HHKB 3LSOA 2DQCH 3TO4C 3MV01 4JFQB 4PRIA 4U1LA 2CGRH 2R0ZL 2FLBT 2WANA 1YYLL 1U8PB 3VG0H 5E24E 3MRRB 1DVFC 3DBXB 4KU1A 4M6ML 5JPMA 3NCFB 4AL8L 3MV7D 3KXFB 2JB5L 1R3HB 3FN0L 3I75A 5DUML 5F71A 4PRID 3PDDA 1BVKB 5T1LD 1TZHB 4OM0L 4F8TA 5CCKH 1IGML 2CD0A 1LO4L 4JVUA 3VGAB 1FL3B 1HI6B 5FUOH 4BKLA 5T1DH 2VLKD 4JM2B 2W59A 2HFFB 2QKIB 2H8PB 3IU4H 4DN3L 2P5WD 1RIHL 2YD8A 4P57A 4QRRB 3U7WH 2WQRA 5JPNA 1BQUA 4FS0A 3W9EA 3P0YH 1I7RA 4PJHB 3HLAA 1GAFL 1T1WB 4LSPH 3U30B 3MRKA 4ZFGH 2EE6A 1G7IA 1KN2L 1X4ZA 4JFFB 3GI8H 4LEXL 3PWPA 1UXSA 3ARGC 1U8JA 2FHCA 3DX8B 2BNQB 4XZUA 5J7CC 4OF8A 1VCAA 2A6KA 1A6ZA 1LP9F 5HI4D 3C5JA 3MCKB 4FABH 5K59F 3VXUE 5I74C 1CGYA 43CAA 2DMKA 5FCSH 2DLGA 3CU7A 4J7RA 5I9QB 3X17A 4KK6D 1ZKAA 2Z4QA 1T4KA 2OQJB 3S88H 2BX5A 3FT2A 5EOQH 1SEBA 2AI0H 3OJMB 1GJIA 5ID0B 2X4RA 1CICB 1BVLA 4KTDH 2A9NH 2YPVH 4FNLH 1DBAH 4GRLC 4B50A 3EZJB 4OZHB 4ZOEA 2V5SA 4DTGH 3MTRA 3OXRB 1U91A 1UCBH 1CFNB 1D3CA 1HXMB 4I18C 1ZWIB 4KJYA 5FFLA 3G08B 3O3BA 1FGNL 3WFCL 3CLFH 4X6CF 4V2CB 2FBOJ 4EN3C 2EDXA 2Z35B 1CDGA 4H0GA 4RAUA 5I75B 4NHUA 1FVEA 1N4XL 4TSCH 3NGBC 1Y18B 3GM0A 3W0WB 2IANB 1NAKL 4P23B 4A2LA 5IFHH 3E6FB 2H6PA 2PYFA 4IS6A 4L8SA 1H3WM 3FFCD 3KYKL 4PGBB 5EUOF 1H3XA 2H2PC 3RY4A 4G42A 1HQ4B 3RHWK 1NDMA 4KXZH 5HPOA 4MAYD 4UTAH 1VGKA 5M94B 4M93B 1MNUL 4L29B 2VDRL 4YE4H 2EDWA 3G6JB 3R8QA 4ELME 1I1AC 3EOAA 4G6FB 3RVVD 3BGMB 5T33L 1MPAL 4HJJH 5D7LD 1QSZA 3NIFF 1E27B 2XY2A 3Q5YA 4QKXB 2A74B 3V7AE 2AQ3A 3S88L 1X4YA 3BP6B 1JI1A 3F58L 2F5AL 5DEGB 5DWUH 4Q7DA 2ICEB 2PUQT 1UG9A 4PRDA 1WFUA 1U8LB 3LAFA 4UILL 3UTSA 4TUOB 3WNPA 5IVNA 5GGTL 1INDH 4P3DA 5E8PA 3DI3B 4QHKJ 1LK3L 1QBLH 5GS1A 4X7TA 3ARDD 1SBSH 3V4PH 4PLJC 1MELA 2ITDA 3H9ZA 3ILPA 1OY3B 4CN4A 3RZCB 4KY1H 1U8NA 1I3GL 3SO3B 4X8JB 2ZCLH 2OM5A 4KRLB 1G7HA 3L5WB 3W11D 3WN5A 2AS5M 3PWPD 1QR1A 4UBDD 2BNQE 2PW1B 3QFDB 5D2LE 4M6NL 3GMLB 4Y4FD 5EO1B 4M02A 3BEWB 3L3DB 5MHSD 5ICYA 3SDDC 5I1LB 3F7YB 3QDJD 3DVNB 1WTLA 2I9TA 3RWIA 2WP3O 4YNYB 1TQCB 3Q3GA 4HIEA 1DQMH 4LARH 4RNRB 2HTLC 3C6LB 3WD5H 2XA3A 3PWVB 2CDGB 5DUMH 3IF1B 5JA8B 2EXWD 2QHRL 3RVWD 4YDIL 2JJSA 2AK4E 4PGDB 3QHFL 5HHOD 1CFVH 4IHOA 3UTTA 1NKOA 2E7LC 4NQTA 4U1SA 2YZ1A 2PNDA 4HZLB 3RL2A 3LB6D 3U36A 2IPKB 1MLBB 4R97B 1B0GB 3MLZL 5EWIH 3PQYB 4G9DB 4N68A 1T2XA 4IIQC 4CNIB 4OIAA 5I1GH 1CVRA 5E03A 4YQXH 2ZUTA 2JCCF 4O2FA 1JN6B 2NXYD 1RZ7L 2QSCH 4Z0XA 3QDMD 5C09D 4PJ9C 3VGFA 4I2XB 5CKGA 1RURH 4YEFA 2ERJB 3D39B 5CEZL 5CIPB 4MQXC 1R5VB 5K33A 2J7LA 5L6YH 3FTGA 2Q6WA 1KIRA 1A3LL 2EIBA 4X5WB 1IL1A 1IGFL 4NT6B 1N0LA 1NUFA 1G1YA 3U2SA 2DMCA 5K9KA 1I9IL 1U8KB 1A6UL 5DMKA 5L7XL 3IETB 3ULVL 4JDVA 3L9RA 5EDXA 5FM4A 5IT2L 4IOFD 1P7QB 1F58H 1YYML 4N9OB 1WLHA 5CLTA 5CZXD 5HYSG 1U36A 1JNHA 4P4KD 3MLSL 3MRCB 3HC3H 3RWEA 5ESQB 2OSLA 1TCRB 4FFWD 2MQ0A 3DO7A 4L4TB 3T2NH 2F53A 4XNUH 4J3WA 4Y8DC 3QUMH 4WGVB 3M8OH 4RFEA 2YD9A 3WLBA 3IKCA 1J86A 3DARA 3VMOA 5JIIA 2W9DH 4X0KB 4YXKH 3U7YH 3MRLB 3QNXB 3QNZA 3S97C 4Z7WA 3ZDYE 4J1UB 1BIIB 1I1RA 3TFKD 2Y06L 5D1QA 2YPLE 3TNMB 1QD0A 2HJLA 5J1AB 3NMEA 4TSAL 2APBA 1MJJB 2HVJB 3H3PH 3SOBH 4OCYH 3OAYK 2J6EA 4XCCH 3HPLA 1EHAA 1DUZB 5E2WL 3M17A 5IB1A 1KB5H 1GXEA 2CKBL 2FWOA 1OVZA 3PDOA 2PYEE 4NKOA 1OAUL 1WTGT 1AGFB 2BNRD 3ARBC 4KI5F 5KN5A 1CD0A 2DQEH 2IMMA 5F7FA 1N8ZA 3DETD 2Z9TA 4NRZA 2CJUH 2R39A 1EV2E 5LGHL 3RY5A 1S7XB 3OAZH 1CXFA 5IK3A 1TTFA 3V9FA 2P4AB 5DA0B 1JNHB 2YUWA 1DEDA 2FEEI 4G6ML 1D5XB 3ULUH 3BD4A 1ADQA 2HFGH 5L2JA 1DBJL 5KSAC 4TSBH 1GIGL 5EG6C 4O9HH 3Q48A 3DSFH 4DN4L 2FEEL 3DMMD 3I50H 4O5LH 1QZ1A 4OZ4A 1FVDA 5GPRA 3ALXA 4FQ2L 5H2BA 1JK8B 3D85B 3U0PA 3BWAB 5F72S 1I85C 4OLUH 4O5LL 3I50L 1EFXD 5KJRL 5E8NA 1R3IH 5JDJA 3ARQA 3KPSD 3TYFB 1PEWA 1QFOA 1RUQL 4RMVA 2MTPA 2D3VA 2HFGL 2YWZA 2WIIB 1L7TL 1PBYA 5HHMD 1XGUA 4JREC 5CEYB 1Z5LA 3WEXA 3J7HA 2VOTA 3AXLA 3HB3C 3I02B 3DX9B 4XPBL 4BKLB 1KJ2L 3D1MC 4HWBH 1ZS8A 4NFDA 5EU7E 2X4QB 4KKLD 4FG6D 1KB5A 1ZLUK 3WS3B 1L0YA 1NGWB 2C3WA 4I0PA 1BQLL 5FO9A 2B4CH 3MREA 1G6RA 4H20L 4UIMB 4AQOA 4E41E 4XMKL 5E2WH 1JWUA 5CZXC 2GSGB 1JPST 4G5ZL 4KI5E 4JRXD 1JGEB 2VLRE 1CI5A 3ZL4L 3LN4B 4YUEH 4C56B 2OR9L 5C0BA 1WBYA 4FP8H 4P59L 1QKZH 4Z76B 4OUUA 5HGDA 35C8H 1K4DA 1IBGH 4YHML 5EOCH 1T1ZA 4ZXBD 1J10A 4P5TB 3EYOA 3GSNH 1FRGH 3DUSA 4HKZB 1RZ8B 5HHQB 3DX6B 4TQEH 4S2SA 2XPGA 1YNLH 3SKMB 5F8RC 5D7KE 1L7TH 5HGBB 3QIUA 5C0JB 4TN9A 3AMLA 5IJVB 1RUQH 5LJYH 3O11A 5IMKA 4I1NB 2O5ZH 5E94A 3MLSH 1MJ8H 1CE1H 4XP6H 3EYVA 3TCXA 4N8PA 5MI0B 5KJRH 3UTOA 5FKAB 1KLGB 2BY2A 4DVBB 5IT2H 4J6RL 1EUTA 2ZOLB 5IOPA 2YC1B 2JELH 1MY7A 1RZJL 3WS3A 2BP3A 3BKYL 1T5WB 5EC2B 5EZOH 2X70B 4QRPE 3VXSB 4NM8H 4M1CD 1W72A 3BH9A 1GIGH 2FX9H 4OSUL 3ZYOA 3BPOB 1I8MB 4OV5A 2FJGA 4JR9H 2FRGP 1I1YB 5FGCE 5TQ0L 1Z0MA 1XFPA 5DMGC 4AMKL 1RJLB 1DSFH 4Z7UA 1LE9A 4LF3B 1NJ9B 3QUZA 3D25A 1HE7A 2R0LH 5BRZE 1RJCA 1QSFE 3IDMA 1BZ9B 1K3IA 2BERA 4F7PB 5I1HL 3NZHH 3GMOB 3QT2A 1I7TA 5BW7C 4GUPA 3MXVL 3E3QE 5E0QA 3MA9H 5KVDL 2A2QT 1Y0LB 3D3VB 3S6CA 4YHYB 4YDIH 5E6YA 4MA3B 4FFZL 3QIWA 2RGSA 4JAMA 4TSAH 1NFDB 3INUL 3DVGB 4Y16C 1YJDH 2B20A 4JZJC 5CP3A 4C55A 1A6PA 2NY4D 4YXKL 4NO3A 3E3QC 1SJHB 2AXGB 3IDJA 5ACZA 4G8GA 3MRFA 4PJCF 2KZ1B 2R4RH 4ZUUB 3UTSD 1HH9B 3G5YB 1LK2B 3S3PA 4PJ8A 4JHWL 1TNNA 4O58L 1XGTA 3CJJA 2EDOA 1X5LA 3P0GB 4HGWB 5HI5D 3ZSSA 4HIJA 3FT3B 3T4YA 2WUCH 5C0FB 3DRQA 1M6OB 5C07A 4UAOB 4KVNH 4XC3L 2LV4A 3BGAA 4JFXB 2F15A 4P2RD 2HTKD 4EOWH 3P9LA 5EZLA 5KVMC 4GRMB 3T1FB 1AGEB 3WN5B 1IEAB 5JNYA 1NLDH 2YPKA 5CMAB 3WLWC 5C0GA 2B1HH 4Y4KC 2BXYA 4KKAC 1F58L 1NC4A 2FGZA 1Q38A 1V5JA 1KB9K 2DQUH 5JW5A 1LDPL 1R3KA 2WINB 2LE9A 3W82A 9CGTA 4EN3D 1IGFH 4LLMA 5CJBA 5DEZA 5DWUL 1GH7A 1CD9B 1RURL 4ZQKB 3GSVA 5JLZB 1BFVL 4URTB 3GIZH 5HGAB 2QSCL 1NMCB 1V3LA 1NBVL 1MPAH 3K8LA 4EDWH 1TITA 3GJEB 1Q0YH 1BEYL 1XCTA 3LIZH 2A0LC 1UEYA 4GJTB 4LAQL 1MNUH 2WBJB 1SJHA 4O4YH 2C3VB 2FH6A 2VO5A 2EIDA 5ISZD 1BECA 2VUYA 1NAMA 4XNMA 1ZMYA 5D70H 1J1OL 2VLMD 2XOTA 5IFHL 4L8DA 1S7TA 3UROR 1HDMA 3DRQB 1N4XH 4H5SA 1MCOH 4I2XA 4QRTB 5GGQL 4HMDA 1UCTA 4I9WD 1AR1C 5KVFL 4W81A 4WEUD 1FGNH 3WFCH 4FN0A 2EIEA 3TIDA 4PJBE 4M7JH 4ELKB 2B0SL 4YDLC 3X13B 3T0EE 2O61B 2ZCHL 1BD2A 2QADD 4GW4B 5INCB 5E9DB 4BJLA 1YQVL 4Y19A 2HT3D 1VEMA 2VE6B 4MB3A 1PSKL 4ZO6A 3RIAF 3HI1B 3HI5H 3BH8B 3BUYA 1IAII 4L8BA 1UZ6F 3ECBB 4I3RH 2VZ3A 1T7VA 3TIEA 1CDJA 4CMMB 5ILTH 4WW2B 2UWEF 3TZVB 4FABL 1FNEA 1OWRM 4LMQI 3VXPA 1BQHG 4GW5A 4K7PL 4PJHF 1INDL 4RFNB 3FMGL 4LAJH 1KCVL 1WGOA 3ESUF 2P5WE 3UO1L 3HNTL 3JTTA 3ZE1E 4E5XA 5J56B 5ILTL 1BZ7B 4CUCA 3IDNA 4ZUWA 2J8UE 1M71A 3V6OE 1QP1A 3CGTA 4LDEB 4GAJL 3VD5A 3LKNB 5KS9F 3RVTD 4HJJL 3FHQA 4X5LA 3VFRA 1MFEH 3BN9D 2CRIA 3G04A 3DYPA 3VE0A 4YDVB 1ORSA 2PW2B 2X4UA 2HRLA 3VWKB 1IAMA 5LKNA 5DC0A 4D0BA 1GC1H 1DUYB 4X99A 1CU4L 1LO4H 1UZ6E 3DV4B 1QFWM 4YXLH 1X5FA 2R1WB 1GGYA 1CG9B 4NN7C 1BWMA 1S7VB 4WFEE 1JNLL 3TV3H 1WJ3A 3QEUA 4BSWB 4Y4FA 5JOFB 3VDCA 4MD5A 3EAKA 1TTUA 1AKJA 2BSRA 2CGRL 1UCBL 3LKOB 1XH3A 4DK6A 4WTZA 4WFHD 1UQSB 2APWA 4M6OH 2NY1D 3LQMA 3MV9E 3ULUD 2ZJSL 1BEYH 3GMRA 3RFZC 5GISH 2E3VA 4FNLL 3ULUE 4KTDL 1NEZB 3SDXB 4WCYL 4HHAB 3L3IA 2UWEB 2IQAA 3B6SB 5E2UH 4F7TB 5JHDD 5JORB 5J9PA 3GMQB 1FSKC 4RQQA 3I6KB 4NO5B 2K9UA 3V0WL 5CEYA 3ARFA 2NY6C 5BS0D 1INQB 3QJHA 4MVBD 4JFYA 1MVFA 2IGFH 3RVUD 4BQ9A 3N85L 1NCAH 4JG1H 4R2GD 4FG6C 4ZS7H 2DICA 5EBGA 3NOIA 4ONHB 4X98B 4QT5B 1KN2H 4F58L 3L3OA 4HUXB 1FORL 5FYJL 3ARED 3ZE0F 2GJ6B 4UQ3A 4XC3H 3BRFA 4ZO9A 3PDGA 3LN4A 1I8IA 5FV2A 1G7LA 2XA8L 4PGZA 1IGTA 2WQ8A 1CD1B 4P2CG 3B8YA 2HJFB 1DEEA 1FG2B 4PJCA 2FH8A 4PJEB 2RR3A 3ME0A 1RZGA 2FNBA 3OXSA 1MSPA 4QOKD 2RAMA 3RKDD 1A9BB 4JLRB 1IAOA 4K23H 4RGMC 1B4RA 4UUJA 3SDAA 2FECI 3QXDA 2OXHA 1KACB 2KDGA 1HHJA 4J8RB 3ULVE 4XP5H 4PY7B 3WMSA 1JHKH 1YNKL 3AU1A 3MOBH 4MJID 5IJVA 1VACB 2O5YL 1YY8A 3MXVH 1CD8A 1XGPA 1JBJA 4EQ3A 3RWJA 4AQ1B 4LVOC 5DD0L 3WS6C 3B5TA 5DK2B 5KSAD 1YYLH 2UYLB 1G84A 1IGCL 2R0ZH 2D7PA 4RGMB 4XWGH 1A47A 1P4IL 4WUKH 2R0LL 3DV6B 3ROLA 5D7SH 3WE6B 1C7SA 4FFVD 1N2RA 1HHIA 4TRPL 3PP3H 5KW9H 3HG1B 2NY3C 3ZE2F 1OAYH 2VL5B 3VRIA 4AMKH 4LL9A 2YD5A 3H8NA 3SQOH 4ONHA 4X98A 1E4XH 1CF8H 2YBRA 3PWJA 5A2JH 5GHWH 1H0DB 2IFFL 5DJ0B 1OAQL 1A7OH 4IRJB 3VFVB 1FJ1A 4JZOB 1J1PH 4OZGB 1H5BB 5EZOL 3THMH 2AVGA 2GFBA 3NPZB 4RCAA 1NUDA 1WCBA 4KK9D 1DDHA 4LVEA 5B38B 1NCWH 2JELL 2CLZB 2VLKA 4QTHA 1S9VB 1Q9KA 4XCFL 3NTCL 3CVHH 1VPOH 2XN9B 5F7YC 4G80B 2I5YL 3QCVL 3SGJA 4I18A 5KBNC 1REIA 1BPVA 4I5BA 4YBLB 1T21A 1MJ8L 3S35X 3OKEA 1F11A 4PJBA 4NKDA 1NMBL 1F5WA 5DT1H 1T04A 5DFVC 3KWWA 2QR0A 4DQOH 4M5ZH 1DBBH 2VH5L 3CZFA 5TDNA 1YNLL 3C60B 5DK0B 2GTWB 4M1DL 3U79A 5JW4Q 3MJ8B 1KNOB 1OD9A 5IBLD 1IM9A 3LKRA 4GT7A 2P7TA 1OTTC 1FRGL 1FIGH 4FQCL 5IIEB 1KCRL 1YY9D 1CGVA 3P11H 2IQ9H 1NANH 4JM2A 3CMOL 4M3KB 2VXUH 3G9AB 3TBVA 3HUJA 1YQ2A 5FHBL 1NDGB 2MQCA 3S8WA 4HPOL 3HG1A 1H8SA 2X41A 3S98A 3VFWA 4EIGB 3REWA 3OQ3B 3NAAL 1FZOA 5ESVB 2OR9H 5EBLA 3ZL4H 3E6FA 5F9AC 2ICWI 1VFOA 2Q7NA 3TN0D 2P5EB 2NYYC 1JPSL 3K4DA 5DJ6A 1OTSD 1T2QL 2A73B 3QI9D 1JWMB 1RJZB 3TNNB 1BQLH 4GO6B 1F00I 3LH2L 4OCXL 5FYLE 3SDCD 3TBWA 3OPZL 1AO7D 3MPCA 1IGYA 2ZUUA 1HEZA 4LLVB 4KKCC 3P2TA 4PJGF 3QEQA 5DUPH 1ORQB 1T89C 3PUCA 2ZUYA 1Q9KB 2FL5B 5I73C 3D39D 4D9QE 5BO1L 1LO3H 2HLFD 4NO0D 4S0TD 2AQ2A 1X5ZA 3W0WD 1G6RH 1CGXA 1NBZB 3QYCA 3V95A 4F9LC 3S96A 1QSVA 1SEBB 1KIPA 2ZP0T 3O45A 4LLQB 1U92A 3EO1B 5JIKA 1FFNA 1EXUB 1RZKC 4OGAC 5CHNA 2Z92B 3MLVL 1GGBH 3MRPA 4TYUA 2GCYA 1ZHLA 2DB8A 3VMPA 1BM3H 1DLFH 4RIRB 5I6XC 2NYYD 4NJ9L 4LLYA 4QO1A 4FQ2H 4PJEE 1PY9A 4KAQH 5DHYB 1AO7A 1UKQA 3EOYG 4NQED 3C2AL 1MF2L 3FQTB 2NXZD 1DFBH 4OCRL 2B4CC 2C7UA 3O3BB 2GUOA 4Q6IB 3WJJA 3ZT5A 1N3NB 4OV6F 2AXFB 4X6FA 3O8XD 4GMSL 2P5WB 4JFEA 4FFYH 4U6VH 3T1WA 2QLVB 5EZJA 3BMWA 2J88L 3CMGA 2AEQL 1U6AH 1ZSDB 4G8EA 4CVWA 2JB6B 5LGHH 3SY0A 4X83A 2ESVD 1J7VR 2AJ3A 1HQ4A 1T6VN 2QSQA 1YMMA 1FYTE 3BZDA 1HILB 3STBA 4EI6A 3PG2A 3G5XA 4CBPA 1Q9LA 3U9PL 2ZG2A 2DM4A 4OFKA 2FL5A 1C08A 3EOAB 1FBIH 2R8SH 3C5ZB 5IF0B 2NY5L 1YEKH 3MSPA 4ESKA 3TWCL 3TVMA 5JQ6L 4FQLL 1CFSA 5JIHA 1WIPA 4HIHB 4FXGA 5DI8B 3IXAA 3O6FD 4LCUB 3O41A 3HCVA 4PD4J 1F13A 5KVGL 5JDSA 2MJWA 1M7IB 4WW1A 1QQDB 1S9YA 3D18A 4RBPH 2GCYB 5EBMA 4EI5D 1HHHA 3CXHK 1I9EA 1MI5E 4P3DB 5DD6B 1F3JB 3HG1D 3PABB 4R7DB 4JY6B 2XN9E 4RGNC 4XNUL 3T2NL 1D5BA 3NIGE 3JTSA 4I77L 3RDTC 2ADGB 1T3FA 1J5OL 4ISVB 1J0IA 1L6ZA 3G6JE 5E8EA 1PG7L 1FZMB 1KFAH 2WNGA 4LOUD 1A0QH 3IDXL 4YDJA 1ZLWK 3M45A 3T0EB 4EUPB 4QXUH 4LCYB 1QA9B 2BVQA 1HKFA 2AJ3B 1UB5B 2UWEE 4TVPL 5BV7C 1X5HA 1ITCA 2WUBL 5IHZB 2VWEC 1XCQB 1RUKH 1X5KA 5DVKA 3FN3A 5FK9B 5HI3D 4LGRB 3MJGX 2IPTH 1PLGL 4N1CA 4HIEB 4Z7VF 2R4SL 1IAIH 3HS0B 3MRMB 1XF5A 4YFDB 1BVZA 1P84K 2RFXA 2XZCL 3CFBA 4M5YL 2CUMA 1SBBA 4HK0B 1U3HC 4R90L 5EBWB 1TVHA 3WLBB 5JHDB 1OF2B 3ARFD 2AJXL 4MHHG 3QXWA 4QRSA 3FFCA 2R2BB 3L3GA 2IPKA 2AK4A 2OYPA 4X4MA 3HAEG 3MLZH 2LABA 4N0CD 5TH2B 3MFGB 2MWCA 2QEJA 3K74B 5HDLA 4FZ8H 1JF6A 4NFCA 1N59A 1XR9A 3O2WH 3BSZL 3BZFA 2R1YB 3JWDC 1FGVL 4QRPD 4NP4H 4YK4B 4JZJB 1G9MH 5FA3A 4KJPD 4YBHA 5E6IC 3WD5L 3QDJB 4YAQA 4XVUD 4F15C 3R0NA 2GITA 3ARWA 4YHZH 3T3PE 2H8PA 3TT1H 2P42B 4U3CA 2GJZA 3MZGB 1NCDL 1D6VH 3GMMB 3QIWD 1UZ8A 2VQ1B 4KROD 5GJTH 1CZ8H 5D1QC 1QBML 1OAZL 1IQDA 1IVLA 1WAAF 3QUXA 2Z8RA 3N9GH 4OCWH 3ARDA 4ENEC 1XIWB 3CFJB 4KHXL 4EEEA 3ARUA 1T0NB 3BRDA 2CK0H 2FO4A 1I3GH 2BNRB 4X4XB 2BNQA 3ARBA 3S3JA 4G43B 1LK3H 1QBLL 1TQBC 5EIIA 4TPRL 1T83C 1HSBA 1QYGL 3L3GB 3MV9D 5GGTH 1OLZA 3SGKA 4W4NA 2PXYC 5E8DH 1HOCA 1ZVSA 1O7SA 5AWNH 3K2MC 3B9EA 3MGOA 3SKNA 2NX5E 1IC4L 1GPOH 3KYAA 2MQ3A 3EGSB 3TO2B 5DQDH 3FRPG 3TJEL 3BHBB 3D0LB 4LHUB 5E00A 3SHSA 1U3HA 2X4RB 1QBAA 1CICA 3K0WA 5B39G 2FD6L 2HVJA 4Y5XA 5K9OB 4QNPF 5SWZE 4LCWE 2D0GA 5C6PB 1YEJH 3FB8B 4N8VG 1EERB 5DVLA 5FAAA 5T33H 5F7MC 4HFWA 5GSRB 3T4AA 3MACL 4YE4L 5BZWA 4RX4A 3TA3B 1ACYL 3UJIH 3A6CH 2YWYA 3RHWF 3G6AA 3BP4A 4WI2A 2PXYD 4WI4A 1BJ8A 1KENL 2AXHA 4JKLA 2MOVA 2VZSA 4QXWA 4LVNC 4GBXB 4X9FA 3BAEL 3LKQA 4AIOA 5I1IH 2P8MB 3F7RA 4K8RL 1LEGB 4TSCL 5D71L 5L2JB 1ZTXL 3RKPA 4TNVK 5I1KL 2XICA 5ENWB 4ODUA 1MAML 4OBSA 1ZEAH 3EJZC 3G5VB 4JJHA 4R4BA 2IFGA 3L3HB 2DWEB 3SKJL 1MCCA 4RMWA 4EI5B 3HR6A 5JOEA 3KPMB 3MYJB 5HDQH 3ARDC 2YPLB 4YR6A 5FYKL 2XPGB 4KKNA 4DKFH 4FZEL 1DBMH 5AYUL 1JV5A 2YPVL 4TOYH 2F54B 5L2KD 3EGSA 3TO2A 5I8KL 4MJIE 3ZE2E 5TPWH 4DOHB 5ID1A 4PR5A 3BD5A 1PZ5A 5I76B 1JGVL 1U8LA 1MFCH 3VFUB 2WAHA 3BDYH 4YX2H 5FV1L 1X4XA 4XCYB 1WVZA 5EU4A 4NZUL 1GHFH 5HYJA 1F4XL 1R24A 4OF7A 2HVKA 2DDQL 3D69A 1LO2H 4Z0BL 4LEXH 1W72L 1GC1C 4ZTOH 4I0PB 2GAZA 1KTRL 3REWB 2BNRE 4PRPB 4QYOA 3RGVB 3NPSC 3FFDA 1D5ZA 4YGAB 1I3RA 2P5EA 1G9MC 3AY4C 3SDAD 1YEGH 3H0TA 4E41A 3X3FH 4GXUM 3P0YL 4MMZC 4R96A 2VDQH 4XI5D 1JI2A 4MMXC 1KXTB 3M1BB 1A7NL 2A9ML 4P2QB 5FKPA 2CXKA 1OCWL 4HK3J 3O3EB 2AJSL 4YHOL 5AD0B 3IU4L 3RL1A 3SCMD 2Q87A 1EO8H 4P5TA 4N9GA 1JGLL 4PJXB 5FUOL 5F6HI 4XPFH 4R26L 2IH1B 5TDOA 2IPUG 5KSBB 2VDML 2MCPH 3VA2C 3GUTA 1NGQH 1NL0L 2GSIA 4NYLB 1PGRB 1XGQA 4S1SL 1NBZA 1RPQA 1QFUH 4YO0A 2UUDH 5CGTA 1SM3L 4HAGA 1IRAY 1I1FA 3QUZC 1TZHA 5FYJE 4POYA 3OG4B 1IC7H 4CNIA 1A1NA 2A77H 4KWUA 4RGND 4OLZH 2UY7A 3B9KB 3NFPB 1NGYB 3I3BA 3MO1B 3DOSA 4OIIL 2R23A 5JXED 2X1WL 2Z0BA 2VLRB 2O5XL 1U8NB 4JFFD 5TE6L 1N3NA 4HPYL 3C60D 5HHOA 4Y16A 2DQJH 1OW0A 1H3PL 5CMAA 4JDZB 4P9HL 4K94C 5E1AB 1FAIL 1V7MH 4YFEA 2GTZB 3B9KC 1JZ6A 4JFFA 5IQ7L 4PB9H 5AD0A 3RAJL 1A7RH 2VTFA 4XCEB 1QNZL 3TT3L 1RFDH 4XNXL 2VLJD 1Q9LB 1UH4A 2PO6A 4IJ3C 4PJEF 4RX4D 5C0EB 2YKLH 3MCLL 2M26A 5IF0A 1Z3GL 3C6LA 4AIZB 2VERN 1FZKA 2F58H 3EFFA 4GH7B 2F53B 4BZ2H 4JFDA 4BZ1H 2VAJA 4O51B 1I85A 3IFOB 5H8DA 3IJSA 1H15A 1IM3B 5DMGD 3MJ9L 5B8CA 2P43B 1FAKT 4HZLA 3G9VA 1DN0B 4EZMA 1ZAGA 1IGJA 3U1SH 3ZKSD 2EEBA 3WFEL 3CSYA 3OKLA 1S7WA 1MI5A 2CLRB 2C4FT 3QUYD 3TYGL 4UQ2B 4Y7MA 3MX0A 4HKBB 1FH5L 1HINL 2Y07H 3SE8L 3DRTB 3U4BL 2HT2C 6CGTA 3U0TA 4LVOB 3KJ4C 3QUMA 1MREH 4MNQB 4PJAE 2RJMA 4HIJB 3T4YB 4MQXD 5J89A 1YEEL 4MCZA 2F8VA 2FZ3A 5DQJB 5F1IB 4KK8C 2ADGA 3QB7C 7CGTA 4QF1A 3KAAA 4M1CC 1AGFA 1INEH 5C0AD 3TBYB 4LSVH 4I0PC 3L5JA 4JDZA 2YD3A 5FDWB 5EU3A 2NNAB 1DQDL 3HMWH 4JKPH 2Y72A 4HBCL 1JNNH 2VITA 2HLFC 2YUXA 5I19L 4P3CL 3MRQB 4UOW0 5GIRB 2JK5B 5L88H 5D96C 3GBNH 4NDMB 1QVOB 5I1JL 4LLMB 5L0QB 4NWTH 1OW0C 2P24B 2IAMB 4XPAH 4BH8B 4P2OD 2GT9A 3EJYC 4CKVX 3FT4B 2FX8L 3IFPA 3GB7A 1FNGB 4GQ9L 5FM8A 4K71C 4A6YH 1GZQA 1MFAH 1WBZB 4PFEA 2NR6D 2WBJA 3CSYB 3F6IA 2B7DT 5C08E 3TCLA 1N6QL 4LSTL 1KTDB 4M61B 4KZEL 4OZGF 5LBSH 2N4IA 2RIKA 4XPHL 4NGHL 3TNMA 1NEUA 4ODXA 4QRUA 3K46A 1IFHL 4NQCB 1JCKA 2M2DA 2E6QA 2Q8BL 1ULVA 2PR4H 5DR5L 2YUZA 3DMMA 3VFOB 5DS8B 4U0RC 1ORSB 1CLOL 3P73A 3PDOB 3S37H 1QSFA 1CXLA 4ETYA 3O6FA 5KTEL 3JWOC 4GS7B 4KKLC 1A6VL 4ELKA 1PD6A 4MXVF 1WZ1H 1B0WA 5GSVB 2Q7YB 5B39A 4WFGE 2A1WL 4GKOA 4JPKH 4MXQC 1AHWB 1UM4L 3BE1L 4WY7H 1SEQL 4R3SA 3EO0A 2ADIB 1ZA6B 3FQNB 3BT2L 2H41A 3T08A 4MCYB 4HGKC 5D7LE 1UM5H 1RZKH 4JZNA 4AT6A 2IF7A 1T1ZB 1DL7L 2ATKB 1RU9H 4LRNL 5D7JA 1LP9E 2Y23A 4NN6B 2BFVH 4H8WL 2BDNL 2XFXA 4HQQH 2H2PD 3MCG1 4JO4H 3MBXL 5F9JA 3PGDB 2D0FA 4LSUL 1K2DA 3O0RH 1A4JB 3QBTB 4RGOH 5DJZA 2BVUA 4ODSL 1H9VA 4LHUA 5I2IA 3C08L 1EJOL 1ZE3C 2FBJL 4HMCA 4S1QL 5J6HA 4ZNEA 3D39A 1XGUB 2M8XA 3GI9H 4QXTA 2EH7L 3ALPA 3V6OA 2ZNWA 2A0LD 5DS8A 4UT9H 2NW3A 5IVZA 4JFYB 3P73B 3T8XB 2R0KL 4L3CA 5J13C 4BK5A 5IV2B 3WIIH 4YDKL 3WIHH 4AEHL 3QXVA 3OKOA 4L9LB 4WNQB 5HHMB 3ARGB 2EO1A 4WFGD 4D0BB 1J8HA 5TJWK 3CIQA 3MREB 4UIMA 3NACH 3SDAC 5ESAA 1F02I 5D5ME 4HJGB 1I1YA 4OD1L 2E7MA 1KJVB 5IWLA 3KG5A 3LMJH 3B2VH 3T2PA 3KYOA 4U1NA 4PREB 3HMXH 3OXSB 4H25B 2VXTH 2VJXA 5KSUA 4JRYB 5IR1B 1KSRA 3WS6A 5DD3H 1FE8L 3BEVA 3T77B 1XH3B 1N64H 4U6TA 1KXVC 2HTKC 1KCUL 1QO3B 5LWYL 4Y19D 1N7MH 3D2UB 1QFWL 5GS2H 5A16A 4TVPE 4GKZB 1AY1L 3BT2H 4HBQA 5C0JA 4G6JL 4ZNCD </