2GY7B

Angiopoietin-2/tie2 complex crystal structure
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
423
structure length
423
Chain Sequence
AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIPRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of the Tie2 receptor ectodomain and the angiopoietin-2-Tie2 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Angiopoietin-2
total genus 77
structure length 423
sequence length 423
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10430 Ig_Tie2_1 Tie-2 Ig-like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gy7B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gy7B04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gy7B02
2.170.300.10 Mainly Beta Beta Complex Tie2 ligand-binding domain fold Tie2 ligand-binding domain superfamily 2gy7B03
1A21A 4J1UA 2YBRA 4OZ4B 4M6NL 5ESQA 2EC9U 3BGAA 4FZ8H 3REVB 4KK9C 4AEHH 2XTJC 4KMQA 4UINH 3PJSB 3BPLB 1CFTB 3VXOB 4BKLB 5CEZL 2BJMH 4GBXD 4M6ML 4R0LA 1DBBH 4PR5B 3O6FB 4WW2B 3HTLX 5HHPB 1NCAH 3BD4A 2DMCA 4K3DH 4LNRA 3HMXA 3CX5J 3MLYH 5D1QC 1S7RA 4XP5H 3U9PL 4M7LL 1QBMH 1NUGA 5E4EB 3WXVL 3DYOA 3MJ8A 1KYOJ 3PWJB 4JZOA 5EU6E 3NFNB 1CTNA 1HH9B 4YHLL 1GOHA 1VESA 1CXHA 1MCIA 3KLDA 4PLOB 2F74B 1ADQL 4HGWB 1A6TA 2V9TA 3DJ9A 5EULV 4NC0B 3D5OF 3UDWC 3O8XA 4MNQD 4PJAF 1YEIH 5I30L 3IVKA 5CMAB 1W0VA 5JOFB 2G9HB 3W9EA 2FH6A 1I85A 3BN9D 1LP9E 5F9WC 2DTSA 1FGNH 4X99B 4I77H 2WANA 3OG6B 4NO0A 3O3AA 4Z78B 1UH3A 3DX8A 3LEYH 3QI9C 3GIZH 1LD9A 1S7UA 1ZGLP 3FHAA 2ATPB 3CC5A 1V05A 4B5EA 4LLVB 3IFOA 5TE4L 2O61A 4U1NA 5I19L 3ZHKA 1G6VK 3F7PC 4HK3N 3MRJA 3U2SA 1MAMH 3I75A 4TTDD 5I1IH 1MH5A 4G9DA 2D0GA 4H0IA 5J6HB 1YEFH 5EN2A 4NO2A 1I3UA 3OSKA 5A3ID 2AGJH 5CAYB 3HPJB 2A83B 1EO7A 4OUUA 3RJDA 2WZPD 3BYYA 3D25A 2VXQH 3RGVC 1Q0XL 4LSPL 3C5SB 5DT1L 3JWDH 2Z91A 4U1KA 3U6RA 3VRIB 3KPLB 1S9XB 5IJKA 4HWBA 3QCTL 1OW0C 4KAQL 2DOCA 3QCUH 1NC2B 1IM3B 1DFBH 2IALA 5J1AB 4CMMB 2YBRB 3BP5A 4ZXBC 1TETL 4L4VB 3LV3A 3QUMH 4JFPB 1F5WA 4K7PH 5E2TL 5HYJB 3P4LA 5D5MA 3IJSB 3HRZA 4M4PA 4PY8I 1NGQL 3G5YA 1FDLH 4QOKD 3MXWL 1AXSA 5BRZA 2H3NA 1SYVB 4N0FA 5FYJU 4HSQA 3IAPA 4WUUE 1BQSA 1T0PB 4DAGH 1HH6A 4TUOA 1C12A 1DSFL 4RGNC 3BT2H 4U3HA 1RFDH 1KN2L 2BY0A 3T1FA 3E2HC 3V8OA 1NGZA 1FHGA 1NKRA 5DLML 1SMOA 4JZOB 4HXAL 4V2BA 3AM8C 5DGRA 4WI7A 1I7ZA 3VW3H 4XH2B 4QT5A 5IBTL 2KH2B 3MNVA 1MCOH 4LHUB 1LK2B 4XP5L 3U9PH 5D93C 1CK0L 3IJHA 5DO2D 4QHKI 1OQXA 4XNMA 1YEEH 2CDEA 4UT9H 4IOFC 4P5TA 4LVNC 1P7QB 1MEXL 4RGOL 4U1SA 4OF0A 3L3KB 4LF3A 1FLRL 1MHEA 4ZMAT 5ICZA 4Z7UF 4I5BB 4S11A 1E4WH 3WO4B 5KOVC 4P99A 3OX8A 5C07E 4GW5B 3QDME 3ARBD 2M8XA 3DUUA 1ND0B 3ULVD 1B6UA 3LKRB 5E1HB 5C0NC 4WWKC 4QCIA 3TYGH 4M1GL 1BM3L 1HHHB 1IVLA 5LKNA 5M95B 3GSUA 4QYOB 4XPBH 1TQCB 1NDMB 2DLTA 4PY7A 3B4NA 4ZYKB 1AQDB 2XWTA 5GGQL 3S98A 3WFEL 3TA3A 4LLYA 5HYJE 4KKAD 1FC2D 1IAKB 4PRPD 2Z92A 1GC1H 3JV6B 1FZKB 1JRHI 4JFFB 1KTRL 4KWUA 5BZDB 3OAZH 3LY6A 3UTSE 4DN4L 4J2XA 3ZSSA 3CZFA 1OAUL 3MRCA 2FJGA 5EUOF 1RMFH 4PJFF 4WU7A 1IEAA 2HLFC 3RJQB 3RU8L 1FSKB 4U6VL 3FRPG 3C8KB 1T5WA 4PS4L 1ITCA 4XNQA 2QTEA 1G9NC 4FA8A 3QUXD 4DOHB 4OGYH 1SQ2N 2CUMA 4LSQH 1OSZA 3HI1A 4NCDA 3F7YA 4RRPG 1YPZE 4YZFE 4HC1A 4CVZB 3THMH 2AV1A 1NPUA 4P2QA 4L4TA 4U7KA 7FABH 5MENA 1YEFL 3TIDB 3FQUB 4IOSD 4OIBA 1ETZA 2BERA 2VZ3A 1JJUA 2SEBB 1NFDA 3HI5H 5CCKH 4MHHG 4UV4L 5KW9L 4GKZB 4LFHG 3WEXB 2YSSA 1RVFH 2MKLC 1MELA 3FTGB 3W9DA 4YHNB 3BN3B 3S96B 4XWOC 3TN0A 5KS9B 1HILA 4F8QA 1RU9H 2LE9A 1WC7A 4G9FE 4RGNB 1V7MH 3TT3L 1NC2D 2ADGA 1RJZB 2NY4C 1JMXA 1FN4B 4KTEH 3O3DA 3VRLE 4XCEA 4Z7VF 5DJCA 3NACH 3LRGA 1IAOA 3SJVA 1KB5H 1T04A 5TFSL 4EN3C 4LPCA 1MVFA 2V2XB 1U42A 5B39A 1R3JB 2YN3A 5IFAH 1OQOA 4G8GB 1KN2H 1LE5B 4PV9B 2VQUA 2AABL 1WUNT 4DGIL 2P7TB 1HSAB 3AREC 2X4SB 4IOFD 2XKNA 2AEQL 3D1MC 5FO9A 4PBWD 4KZDL 1I1FB 3QDJB 1KXQE 2D03H 1N64L 3CXHJ 2CLZB 5TDPB 1T80A 3GSVA 3V5DB 5LGJB 3AU1A 5JR1H 1XF3B 3O6FD 1P9MA 1CE1H 2IFFL 5DK0B 3HAEB 3QUMA 1JI1A 1PX3A 3UTZA 4ZPVB 4K3DL 4UNVA 1F4AA 1T0MB 2NNAB 3NPSC 3UPAA 5FO8A 4OCSL 3D2UD 2XWJB 4NUJA 3UC0H 4LARL 3BKMH 5DUPH 1T22A 5FGBC 1QBAA 1JGDB 5D7JD 1YEEL 4PG9B 4HW6A 2A77H 2BHYA 3CX5K 5I0ZA 3N9GL 4P57A 5C0BB 5C0EA 4X9IA 2VDOH 4HIEA 4NJ9L 4XVSL 3CVHA 5C0JB 5E2UH 2H6PA 3RTQC 5GRJH 4XHQA 5D96B 3TCLA 5D2LB 3IDJB 2GHWB 4F7PB 4MNQB 1REIA 3NCJH 5JIPA 4EEEA 4TN9A 5IB5B 5JIKA 1FBIL 1KELL 2DBLH 3MOBH 3ARFD 1QTYT 5LGKA 2XPGB 4Y2OA 2BDNL 3OF6D 1A22B 1MREL 5CEYB 3SDCB 5IR1B 3IRZA 1MPAL 5F6IC 3GIZL 3PHQB 4Q0XL 5T5FL 4Y2DD 2JCCB 1H8NA 4AG4L 3QQ3A 4XNYH 1UQSA 4L3EB 4TTDC 3Q6GL 1J1PL 1FGVL 3CCHB 4PJ5E 4P4RA 1YUHB 1HCFX 4HC1L 3DBXA 5JW3L 5FCSH 3I6KA 4WDIB 4ZOAA 4YAQA 2VIRB 4LDEB 1OM3L 2Q7YA 4U31A 3WIHH 5CCKL 3RWJA 3C2AH 3QI9D 4MD4B 5EUKB 2NY6C 5IBUB 2WIIA 1CDIA 1N8ZA 1W8NA 2HRLA 1X9QA 4P4KC 1QPPA 4JKPH 4L8SC 3ULVL 3RRQA 4ZUTA 2EDBA 4E0RA 1T2JA 3NOIA 3AAZA 43C9B 3IDMA 4NJAH 5D70H 2XA8H 4P3CL 1E28B 3DURA 4CVUA 5A2LH 4HHAA 2GAZB 4JVPA 5KSBA 5K9JH 4W6WB 4BH8A 4KDTA 3NFPA 5EOQH 5D96C 4AQ1B 5DA4A 3SBWC 1I8LC 3LPFA 1AGEA 2OBGA 2GKIA 3RL1A 2DQCH 2IAMB 4WFFD 5TQ0H 4UOJA 1CGSH 5I76A 3LB6D 1TZHB 1K4CB 3PNWB 3L3DA 3O6MH 5ANMB 4X6BA 1QHOA 3VFMA 1C08A 3VI3E 4V1DA 4DAGL 1FIGL 5CFHA 4ZTPL 1ZSDA 4D2NA 3HE7D 2Y5TA 1E6JL 1KPUA 1NGPL 2JK5B 1NGPH 5HGDA 4OIIH 1WGOA 1BFOB 1JN6B 1YDPB 2X5PA 4FQCH 4K3JL 3L3OB 3MYJA 4YHML 1A3QA 4AYFA 1K2DA 2DQFB 5C3LD 5HHXL 5D7SH 1C5DA 4Z0XB 5GS1B 1KXTB 5F9AC 4P2CG 1NEZA 2H2PC 1AQKL 5EC1B 1YEJH 1MHPH 3FKUS 1DUYB 3TNNB 3WXVH 2BC4B 5B39G 1S7WA 1W72A 4OZIE 3IKCB 3L9RB 2ZUWA 4NN7B 4PJCB 3HMXL 4NHCH 4P3WA 4KZEH 1OW0A 2EYSA 1E4WL 2R29H 4Y5VB 2MCG1 4R90H 2R1WA 2R4SL 2UVFA 4QRQA 1HHKA 5DK3A 5T5NF 4ONOA 1CFNA 3I9GH 1UEYA 1V3MA 3VFOB 2ITDB 2NLJA 3CVHL 3NZ8B 4P0DA 1U0QA 2I07B 1A6ZB 5DUMH 2BJML 3QXTA 4HQQH 4TUKH 2ATKA 5C0CE 3MRPA 1DBJH 5ID0B 3UYRL 4JRYA 2X9XA 2Z31C 5E03A 1KEML 1I3GH 2JB6A 5DJDA 4ALAH 3QNYA 5JW4N 1BVKB 2YMXH 5HDBE 1FP5A 3QIUA 5CLWA 5DHVB 1JRHH 2P44B 5ADOH 4PYGA 5DGQA 2DQUL 1IL1A 4QOKE 2DKUA 2YPLD 4CUCA 5IFJA 1EGJH 3DIFA 2VLJB 1LWRA 4M1CC 1IKFL 1F45A 3V6ZA 4X83A 1S9VB 3F7VA 3BWAA 4S1RL 5K59E 2FR4B 5IBUG 1FG2A 3TVMC 2J2ZA 3GMMA 4RAVB 1UM5H 3RZCB 3RVTD 3DOSA 1GGCH 2PW2B 1GZQB 5JHLL 4KJPD 3OR6A 1MI5A 2DDQH 1AI1H 1RIVH 1KOAA 4BFBD 3BH9B 4XVTH 2HN7A 3VCLB 3V52H 2IBZY 2X4UA 1H8OA 1MCFA 4IRJD 5DSCA 1RIUL 4YQXL 5CGYD 3TNMB 4Y8DC 2RB8A 4CN4A 3H6JA 4WWKA 3LS4L 1QFWI 5GS0D 2ICEA 1G6RL 2DQGH 3H3PL 1XF4B 1KIUA 1RI8A 5BXFA 4OQTA 4LEXL 3RWCA 5JW4Q 1QRKA 2J8UA 4DVRH 4I0PB 1LP9F 4P2RB 3P9LB 4JKWA 1NGWA 3CH1A 2APWA 1RFDL 4C83A 2BVYA 4QXUH 4JRYD 4NC2B 5GZND 4Y16B 3WNPA 3LD8C 4Z7WB 2Y7QB 2ZCLL 1OCWH 5I0DA 1PEZA 3SY0B 5JMRA 1OP5H 1KXVC 3LKNA 3QDGD 2CO6B 4KZDH 5B8CC 1FNFA 3MV8B 4XBGA 1E6JH 1A0QL 3BJLA 1E4KC 1P7KA 2BY1A 4PTUA 5IMLB 1NC4D 4XXCC 1ZHNA 5CEZE 2CH8A 3STLA 4UQ3B 5IG7B 2JJUA 4U7SA 2DQDL 1T7VA 3NCEB 3MRIA 4C56E 3GSNH 3ARBB 3UTTA 2V2XA 3QUZB 2F5BL 2X4OB 4D3CL 4ZAKD 3GEWB 3O2VH 3PJSA 1VKXA 2AJ3B 2MOVA 1EFQA 1QR1A 4KK8C 3QQ9C 2DLFH 3I85A 1G7HB 2Y06H 2QSTA 5HHPA 5D8JH 5GPRA 4P23B 2J6EH 1GVIA 3BGFC 3DMMD 5LGJA 1NFDB 3HAEG 5JOPD 5KBNC 1W0YT 4N8CL 5DRXA 3MJ9H 3OAUL 1KELH 3VWKD 3RVUD 1J0IA 5I8CB 3IDIB 1JYNA 1YZZA 5DR5L 4ZUVA 3SDYH 2FYYA 5GISL 4NZUL 1XIWA 4V2CB 2PETA 3I3DA 1Q9LA 3S97C 1MCWW 3LEYL 4EBQL 3TO4C 2GI7A 2XZCL 3MBEB 1N6QL 1U3HB 5MP6L 2Y25A 3VGHA 2Q1EA 1KNOB 1INQA 1M7DB 3G6DH 2HMID 3AMLA 4PGDA 1IGIL 4X7TA 3CFDA 4ZPTB 4E9LA 4KQ4L 2UWEE 4K9EC 1JF5A 1XF2A 3L5XL 5FK9A 3TN0C 3UCRA 1J5OH 4JVWA 5EORL 2BSSA 4R2GC 5MHSD 2F19L 3AXLA 2I5YH 2E8ZA 2B7DT 3VD9A 1H0DB 4A6YA 1QRNA 1ZXQA 3MLRH 3GMQA 1XF3A 1NCNA 5TQ2H 5AZEL 5FFLA 4YUEL 5IMOB 5JDSB 3WJJA 3C60C 3PWPA 3KPRA 4J6RH 4YXLH 4IRJB 3WUWG 1X5AA 4MDIB 2XFXB 2R0KL 1QLRB 1OAXH 3LMJL 5AYQA 4N8VA 3D39B 3QUYD 1B0GB 5IFAL 5CP7B 4Z7NE 2Q20A 2NR6C 2AJZA 1RD6A 4JANB 3BI9X 5DUBA 1DJSA 4C59B 2WWKO 4F7EB 5I9QC 4JZJA 4LPYA 5SWZB 2J1KA 3KPOA 3T2PA 4PB0H 1QPXA 35C8H 2ICWA 4NNYB 3FQXB 3C60D 5KVDL 4XHJC 2R69H 3NCYS 3OKDA 2JCCF 3MREB 1F90H 3FO2B 3HPLB 5J1AA 3RKDC 5D7LB 3BX7C 2Y72A 1AP2A 2VITB 4HD9A 1BZ7A 4LGRB 1RHHB 2F8OA 2BRRH 1Z9MA 4UT6L 1JK8A 4NKOB 2EE3A 1EMTL 1ES0A 1ORQA 4QHNB 3VD3A 3G08B 1XT5A 4H88L 5D2NE 1MIEL 3O9WD 1T83A 3MRMA 4HIXH 1A7BA 3JXAA 3ORJA 4OF6A 2H26B 4FABL 4Z7QF 1B2WL 5ETUB 3W39B 2HMIC 43CAA 1U2CA 2F53D 4JN2B 4YFLF 5SWSE 5I76B 1JV5A 4KJWD 4JQIH 5CJBA 4ODWA 5F7KC 1FAIL 4X6BB 3GBNL 4Y4HA 1NFIB 1NCTA 1G7MA 2VDPL 3UO1H 4DCQB 3IDNA 4UT7H 3GGWB 4LSTL 5I66B 1OY3B 1GYAA 1OLZA 3UTQB 1RZ8B 2LFGA 3B3IA 4XMPH 3GSOA 1CLOH 4H1LH 3WKML 5GIRB 4LMQI 2P5EA 5MEQA 4JHBA 4JO4H 4I1NB 1CE6A 3DMMC 4Z7UA 5EZLA 3RWHB 3NGBC 4NJ9H 5E9DD 5EU6B 4KY1H 5HGBB 1NFDF 1U95A 3QPXH 5DQ9B 3QXUA 4UIKL 3QEQB 3GSNA 3OX8B 4U6XA 3QA3B 3F58H 4DW2L 1TCMA 4PJCA 4Q9BA 5I75C 4ZAKC 1HZHL 1A6VH 4RFOL 3ZKND 4FQLH 4TPRL 4TPRH 4LOUD 2NY3B 1VFBA 1RUPL 4MXQC 4S2SB 4JKKA 1CLZL 4L3CA 2FDBP 3VGEA 1U91A 1D9KD 5FYLH 5C92A 3OKMA 1HHGA 2AP2A 4MA7L 3U7WL 1XGQA 3C5JB 5J11C 4RMVA 2EZ0D 3KJ4B 3JVGC 1Z9OA 5C0CA 2EICA 5F9DC 1T21B 2VWEE 2ADFH 4PRDB 5T3ZL 4F7CA 3OB0K 4YIQB 5L6YL 4DEPB 4PJBB 1N59A 2J88H 2O5ZH 2X9YA 4HIEB 3OKOA 4U0QB 2BNRE 3FO0L 4Y5VC 5J12B 1QLFA 3PDOB 5DJ8B 1URLA 4LVHC 2ICWJ 4OQTH 5IBLD 2NY5H 1F11A 1QEWB 3MLZL 3BAEH 5FGSA 1AC0A 5IFJB 3G5XB 3CFEB 1XEDA 2VE6A 4O2EB 4NSKA 5HD8D 1T6VN 3E3QE 2VXSH 3WJLA 3TBVA 1DN2A 2N7AA 4KI1A 4L29A 2ZUQC 3GSQA 4QRRD 3QCVL 4NNXA 5EU5A 5GS0C 4OZGB 3IF1B 1UZ6E 3MJ8B 2X6MA 1MQKH 3BPOB 1J05A 4PJIE 3QNZA 5DJ0B 1DE4A 4HK0A 5D7LE 3IS1X 2W9DL 4YHNA 2B2XH 5I75B 1G1YA 1GSMA 3K4ZA 1XF1A 5EA0L 3TH2T 3I6LE 3WFHA 1Q94A 1OARH 3MLWH 4ZO8A 1G7PA 4KJPC 1IGCH 1KG0A 2AW2A 1S8DA 5IW1A 1ZLVH 1MCRA 1GAFH 5E1AB 2A6JA 2ORBL 2XTJE 1TVBB 4PJ9B 5JOFA 1M7IB 1ZT4A 5TDNA 2C3VA 5J11B 2ENYA 3GHBH 5SX5K 5JHDD 1U92A 1LNUB 2BOBB 1MJUL 2BNQB 1IAII 4QRTA 4ZTPH 5IOPB 5C6TL 3SE4C 2PNDA 2VSDA 3E8UL 1G7IB 1E28A 3DURB 1W72L 3OKEB 5EO1A 3MJ6A 3SE3C 4XPAL 3GSNB 3G6JA 3MUJA 1M7XA 3QISA 5DF0A 4DUXA 4HUVA 3SJVE 2FSEB 3GMMB 4LDLB 1CGWA 4J8RB 1OT1A 3PP4H 2ARJB 1Z0NA 1U6AH 2Q86A 2X89A 1EXUA 1P4BL 3LKNB 3FMGL 3S36H 4ONHA 4APQA 5TE7H 3QEUA 3JSSA 2ATPA 5D71L 1Z0MA 2G75A 1IC4L 3WNLA 1DN0B 3LOWA 1EZVY 1UJ3A 1QBML 5H35B 1N6UA 2XWTB 4TNWF 5IB2A 2VLRD 4N8CH 5I6XC 1U9KA 1RZKL 3RBSA 3U2SB 3G5VB 3Q6FB 5I1DA 5KG9B 4CU8A 4F7TB 3WLBB 5C08A 1U8JA 3D69A 3FN0H 3F7RA 2OTPA 5MERA 2R2HB 4MQXC 1SHMA 3LN5A 2QHRL 2M1KA 3JV6A 2ZKHL 2R56L 1OGAB 2BMKB 4PP2B 5D2LF 2C4XA 4IMKA 3TGXA 2NXYB 3QIBC 3ROOA 2AJVH 2D2OA 5CILL 1FG9C 5IVOA 4KPHH 5CZVH 3C6LD 5SX5H 4MA8H 4OTXH 4EOWL 4FFWC 3NCMA 3S3PA 1HWGB 2Y6SD 3AM8A 2VXUH 3KPTA 2KL6A 2EKJA 3IDUA 2AXJA 1QFOA 2YXFA 3OHXA 2YRLA 2IPKB 1AJ7L 4JJHA 2V5YA 5C0IA 3HE7C 2QQKL 5BRZB 5F9JA 4CJ1A 3MV01 5AZEH 5GS0H 1J7VR 5C07D 2I9TB 1I8KB 3N1FC 1KTDA 5E4IA 2C3GA 4PP1D 1ACZA 4YXKH 1RJZA 5T3ZE 2B8OT 2IQ9H 4G5ZL 4BUGA 1T1WB 5KSUA 1EBAA 2HG5A 1FL5B 1RVFL 2Q7NA 2EDDA 1HYRC 4ZFGL 1CFVH 4UI2A 4XAWH 3G6JE 4O51A 5F6HI 1N8ZB 3T08A 2E9BA 4PJXE 4ZSOE 4ELMB 2GJZA 5TF1L 3V5HA 3ZKMD 4QLRA 5CUSL 3VGDA 4X4MA 1DZBA 3RZCC 2A6KA 2YPVH 3MV7E 4TOYL 4DGYH 3QXAB 1PYWB 1WAAA 4ODTL 3WL9B 3KJ6H 2P1YA 3OKLA 3KYAA 1NCUA 2P5WE 3DV4B 4PJ5D 3S5LG 1IJ9A 5JXEA 2WAHA 3BUYB 3ET9F 2B2XL 5EU3A 4MDIA 2W9DH 5DHYB 4QRUA 3ZKSD 2GTZB 4YHIB 4M6OH 1IGJA 4HJJL 5E56A 3QDJD 3BHBA 6FABH 3QEUB 1CIUA 4APQD 4HBCH 3QFJA 2YD4A 4KV5F 5DD6A 3MRRA 3QUMB 4U3XA 4LHUG 4OCRH 5EFIA 1LO0L 4LVOC 2O5XL 2ZCHL 1AD0B 3H9YA 4XPTL 3V0WH 1JMZA 2EDHA 2EZ0C 4GKSA 1I3VA 1KC5L 1JTTA 4WNQB 1CZ8L 4ZS6D 1B90A 3S35L 4IJ3C 2ZSWA 4LRNH 3BP5B 4MXQD 2VXVL 2PYEA 4PP2A 1BAFH 4LOUC 3B5TA 4PJFB 3CVHB 1FLTX 3CNKA 3CMOL 2IADA 4JZJC 3PWNB 4DZBA 1QBLH 4PLNC 2WBKA 2OR8A 4B53A 4M62H 4DFIA 1J8KA 4UIKH 3MRDB 4MCYA 1DBAL 2VLRA 4NRZB 5TGBA 2RJMA 1TITA 4PJHE 3RWEA 3D39A 5D7JC 2DRUA 4PFEA 3V6OA 5HI5D 4GQPH 2DWDA 2I9LA 1JTOA 4MQTB 1XCQA 3V4PL 3HG1D 5HVWA 3MRNB 3IFNH 3GIVA 4P5KB 4MMXC 5FYLL 1CD0A 1Z9LA 2C4FU 3OXSA 1OP3K 1H5BC 3QNYB 4LQFL 1MRFL 1UQSB 4G8GD 4M48L 1AXTL 1OWRM 1CE6B 3U9UB 1YNTB 4U1MA 1YEKL 2NW2A 4CN6A 1OAQH 4DQOL 5JDJA 3ARZA 4GW4B 1I75A 2X1XR 5I2IA 3ELAT 1LO5A 3ARED 3O3AB 5IB4B 4J3UA 32C2A 3IDMB 3T4YB 2F8XC 1T3FB 3A0OA 3LQMA 3ZLQC 1NH6A 2O26U 4LSSH 2Z8VC 3T0WA 1B0WA 3L3KA 3JWNC 5DK2B 5TQ2L 4N1HB 2DKSA 2VOTA 1HKLL 3QG7H 1UVQB 3U0WL 4C54A 5HY9B 4YXLL 3IXTA 4OLZL 3LDBC 3EYUH 4Q2ZB 4XWOD 3GSVB 2A9MH 2P8MA 3H2WA 2PYFA 5T1KB 4DZ8B 1AO7D 2AXHA 3C5ZD 2AEWA 3ZT7A 1XH3A 3QCUL 3B8SA 3BESR 3FT3B 4X7TB 2DL9A 1R24A 1R3KA 3QO0B 1RUQL 3H42L 3D3VE 3MV9A 3LKQA 4RA3A 2H2SC 3DVGB 4ZOEA 3LEXA 5FF6A 5BS0A 1WIUA 5D7IB 2Q3ZA 4J7RA 1VA9A 6CGTA 4Q6YA 5ALCL 4JGUA 4CMHC 5GZOC 1AGFA 3GMLB 4XP1H 3PDGA 3Q3GA 2VMFA 2XV6B 4Y16A 1T4KA 4HPYH 3FO1A 4ESKA 1SEQH 4H1LA 4WHDA 5C0AD 2H2SD 4Y4HD 4YXHL 1MJJA 3MQIA 4RIRB 1J05B 4TUJA 1EEYA 1KTLB 3HNTH 1QSFD 4FQ2H 4LCWB 2OR9H 4YGVA 1V3KA 5J9PA 4NT6B 1CGXA 3VFPA 1TLKA 3ILPA 3BP6A 4PRHA 3TN0B 1ODAA 3VFTA 1QBLL 5K9QG 3S88H 4R3SA 5E8DL 1NCWH 1YNKL 3FCTB 5ENWB 4UT7L 3T1WA 4YDIL 2GFBB 2VXVH 3G6AA 4XBPB 3GSXB 3EYVA 4RWYH 2FJFB 4TVSa 2C3VB 1QEWA 1X6LA 4JPVL 1OLLA 3CVIL 4G43A 2X1QA 2ZPKH 4JDTH 1RUAH 4Y1AE 5CBEA 1JBJA 4M93C 3O3DB 3KWWB 2JJTA 4HG4J 3QWRD 2VWEC 2W65B 3SDXF 4HPOL 4HUNB 3OGCB 1TJGH 5DS8A 1QRNE 2G2RB 3KLAB 1BD2D 4HMCA 3BZFB 1RZ7L 1HINH 2FO4B 4MNGE 3WXWH 2ZP0T 2B20A 1HHHA 1UWEH 1UWEL 2XKNB 2XZCH 4KKLC 4UUJB 1ZA6B 3EW3B 4HX1A 2VLME 3JUYA 5L9DL 4YC2B 3RX8A 5ISZE 4FTVD 4PLKD 4MD5A 1UACL 1N26A 5FYJE 2Z92B 5SWZE 3GRWH 2FHBA 1SJEA 3BVNB 4L8SB 3TFKC 2A73A 3QIWD 5HI5C 2VDRH 5B8CA 1NDGA 2H1PH 4GRMB 2A83A 1AGBB 1LK3L 2E3VA 4H20H 4MNHA 5F7FA 3QUXA 1R0AH 4JPWL 3MX0A 3IS0X 1OL0A 1F3DJ 3ROLB 3BIBX 1PG7X 2HRPH 5MEOB 4NO3B 2AK4A 5GRXG 3FQTB 4I2XE 1C1EH 2ED8A 5C6PB 1F3JA 5FF6B 4UU9B 1BHGA 5T3XL 2NX5D 4LCCA 4PUBH 1P6FA 1HKLH 3IJSA 2O61B 3LKSA 5I1LA 1Q9KB 1HHKB 2D31A 3HFML 1JNHA 3AC0A 1U8PB 3LRSB 2G75B 1DUYA 3TNNA 3EYQD 4RFNB 1AO7A 5H2BB 4OD2B 4WO4B 2NY6B 4NGHH 5FUOH 4JFDB 3IJYB 3ZKQD 1JCKA 2NYYD 4M6MH 1XGYL 3VXPA 2AI0L 3TM6A 3RKPA 3DVFA 1NL0L 4QY8B 5CSGA 1FO0H 3NA4A 4NQEE 2QQLH 15C8H 2E9IA 3FQNB 1CLCA 4PJXF 3VRIA 3W0WA 1SEQL 1IGCL 4IRJC 4F15C 1LEKB 4OBRA 5F9OH 1DQMH 1ZHNB 4D0CB 5DC9B 3L7EB 3MV7A 3IDXH 2D7PA 25C8H 3RVTC 1T66D 4NKDA 3WO3B 4LCIH 4NYLA 1PQZA 5GRWA 2P5WA 2FATH 3TVMD 3SDXB 2YUVA 1VGKB 2ZG1A 1DP0A 4U1HA 3H3BC 3CSPA 5DJXB 4M43L 3RZCD 1JE6A 1KCSH 4PRIE 3FFCA 4F33A 4OJFH 3GKWH 3BISA 2Q8BL 5EZOH 5MI0B 3VRLF 3UPRB 4X99A 3DX6A 3SO3B 1A47A 3HMXH 2CLRB 3QDAA 5IHLB 1YECL 3SKNA 3DECA 3IDIA 2CLVA 4IOIA 1S7SB 2R4SH 5BV7B 1S7QA 4KI5E 1IM9B 1U8LB 5D2NA 5I8CA 5F6HJ 3FRUB 3ARVA 5BRZD 5J57B 2K7QA 3DMMA 3DO7B 4CKVX 5ALBH 5GXBB 3I02B 3QUZC 3BSZH 3QAZB 4L4TE 1UJTA 3IJHB 5ERWB 2OL3L 1AGDA 4JQXA 3C6SB 4HBQA 2RCSH 4AQOA 2E5EA 3WFEH 5HVGB 1AR2A 3REWA 4PREA 1JWSA 3W0WD 4XCYB 1L7TH 4DTGL 2Z91B 3C09C 1IGIH 4YHKL 2ZUVA 3RGVA 4IRSA 4Y5YB 2Y6SC 3M8OH 4KK9D 4X4ME 3SEPA 4G6JH 1MAML 1RUKH 1I7UA 1C5CH 4OF5A 1J0ZA 1F97A 4MNGB 2HWZH 5J13B 1NCDL 3RWGB 1RV6X 1Q9KA 2NLJB 4K07A 4B7LA 4U2ZA 5ACZB 3LMJH 1FZMB 5K59F 3QSKB 2DWDB 1MCPH 2IH1A 1DTUA 1CXIA 3HZVA 3T0BA 5EOCL 1KLGB 2DQJL 3FB7B 4H8WL 1BOYA 1CR9L 3QFDA 3TEUA 5F88B 3B9EA 4G3YH 4D8PB 1CVSC 1H15B 1BJ1J 4GQ9L 4HWZA 4NKQB 1IEAB 1CFSB 1HHIA 4X4ZA 5F1OB 4Z18A 4ORGA 4YUEH 4WI8A 3WIFB 1T04B 1TENA 4BQ6A 4MD4A 2X1PA 4YX2H 4G6FD 1MLBB 4YLQT 1W0WA 1QKZL 5IWLC 3HC3H 4JO2H 2DMKA 2VR5A 1T3FA 1FFPB 5FM4A 2XWBA 3BWAB 3GB7B 1KIQA 1AKJB 5D9SB 5HBBA 5EWIH 5IVZA 3MXWH 3FT4A 3W9EB 1BP3B 2CLZA 1BFVH 2BXZA 1I1RA 4D9LL 4L4VE 3RNQB 5DEGB 3HG1E 2PYEE 5T1DH 2PTVA 5FO9B 4GW1A 4M6OL 3BKYL 5DI8B 3BKJH 3VXMD 2GQHA 4JLRB 1FG2B 3I2CL 1U8HA 3L6FB 3OXSB 5B4MD 4M61A 1MAKA 3H9HA 3CAFA 5F9OL 2R0LH 2A0LC 4JCMA 4XCEB 4FG6C 1DVFA 3RA7H 1AFVH 1ZT7A 5INDB 1FLRH 2AK1H 3QEGH 3MO1A 2DLFL 5ERWA 5ESAA 5FYLD 1UXSA 5DD0H 3TO2A 5BXFB 1CICA 2NYYC 3G6JF 2X4RA 3T0VA 4UMGA 2F5BH 3TH3T 1FVCB 5FHBL 2ERJC 4JREC 4Z6AT 3LN4B 3S5LA 2ZSVB 3VI3F 3E0GA 3ULUE 1P7QD 4EI5A 1RUAL 4OZIB 1YC8A 3TO4A 1FYTA 4PGBB 3BQUD 4NUGH 2MSPA 5D71H 1U3HC 5IR1A 1YJDC 3O2DA 3PHQA 3F6LA 3PGFH 1U8OB 4WRLA 4CVZA 3V5KA 3DYMA 1HHGB 3BPCB 3P0YH 4HMEA 4I0PC 1H9VA 1RIHH 5I73C 5DQJA 1MCSA 4WUKL 4R26H 2VN4A 2VL5A 1T7YA 2DJ4A 3ECBA 4NZTL 3GNML 2BY2A 2HVKA 1EHLL 3EYFA 1ONQB 4UILH 4TUOB 2FWOB 1JGEA 4WCYL 1LE9A 4BYHA 3SJVD 4AIXA 4XPGH 1ITBB 2EEDA 4MJ4A 1AXTH 1JNLL 5EO9B 4P4RB 1E27B 3VG9B 4NNPH 4JZJB 5HDOA 4NKOA 1YMHB 5GJTL 3DRTB 4NQDB 1WBXB 1RUKL 3C2SA 4LGPB 4LCUA 5DJ8A 4LQFH 3ZKXC 4WFHE 1FYTE 3BWUC 3DIFB 5E99L 4XPHL 4PJDB 1OGAE 5AD0B 1BZ7B 2VABB 3S34L 3SDCA 3VMPA 2VE6B 2AXFB 1MCNA 2EYTB 2NY2C 1RIUH 4JB9H 3VA6A 1IC1A 2R0ZL 4S1SL 4EN3D 5L7XL 1SYVA 1Y18A 4OSUL 1QKZH 2J6EA 5KAQF 4FQ1L 3BAEL 4IJ3B 4QNPF 4X7DC 1OWWA 4QCIB 1DE4B 3MLUH 4MJID 1NLDH 4ZUVB 5E95B 5I15L 3RY6C 4HZLA 4J3TA 1MCKA 3VMOA 4EI5C 2QADC 1Q72L 4L3EE 3EO1B 1P9MC 2C7UA 1TQBB 3CLEL 5K9QI 1UWGL 4XH2A 2VXTH 3BIKA 1RK1A 2UZYB 2XZQH 3I3BA 2X4RB 4O2FB 4YHPA 4XNMB 3ISWA 5CD5C 4HHAB 1AE6L 1GRWA 5FGRA 3GHBL 1CF8H 4JG1L 4KMLB 4MSWB 2QADB 3MLWL 2ZSVA 5CWSB 3ZTJG 5FK9B 3VD4A 5JW5A 5IVXB 1T7WA 1KYOK 3QEQA 5ID1B 1YEHH 1YEHL 4H1LG 4XZUA 5F7MC 4M7LT 4PJEF 4QRQB 3O6LL 2FBOJ 3OBAA 4JY5H 3PHSA 4ISVA 1CU4H 4HWNA 4N8VB 5CBAB 5LWYH 4JDVB 3HLAB 1D6VH 4JHAH 1ZVHA 3VE0A 1K4DB 2QR0A 4RISH 2BVTA 3RUGB 2I07A 2AJXL 3OKMB 5C08B 3BPNC 1PKQA 4W70A 3WO4C 4BQBA 4C58B 3C5ZC 4NQTA 5AZ2H 2J3SA 4KZEL 4FMFA 3DSFL 1KCUH 3IFLL 1YY8B 2J8HA 3OXRA 4L8DB 4WGWB 4Q97A 5ALBL 5M94B 3MLTB 3CMOH 4OZFG 2Y23A 5BW7C 1RMFL 3P77B 2X4TB 4LSTH 5F7HA 3CLFL 3VXOA 1QR1B 5I1JL 1T89C 1EEZA 5IQ7L 1IAOB 4P59L 3MRGB 4OLYL 3PWUA 2IANE 3SGJC 3HR5B 1K8IA 5CD5D 5BOZG 1LQSR 3TN0D 1GJIA 1G7JB 3RWEB 1F4WL 3HMWH 3U30B 1I8MA 3BYTA 3ARTA 4OLUL 4BM7A 5CEXB 4QWWC 3MCLL 2CKBL 1Q9LB 5ADOL 1NCDH 1Y18B 4RA0C 4MA7H 1G7PB 4EI5D 2EDXA 4X6DF 5DSCB 2CIIB 1J11A 1NBQA 3MJ9A 4M48H 2BVQB 1D5XB 2CDGB 5IIEB 4NPYA 3VRJA 4F2MA 4Y7MA 2ARJQ 3MBXH 3MRKB 3E6HA 1A5FH 4RGND 3MLPA 2BNQA 3RVUC 4JY6B 3VWKC 4PJ8B 1Q0XH 1A1MA 4O5LL 5TF1H 3L1OH 1VFUA 2VLJD 3TNMA 4PJGA 1E4XH 5HXMA 1E0OB 1HXYA 3GFUA 1MCQA 2VLRE 1D5ZB 1HK6A 3RWCB 2VKXA 4GAFB 1K5NA 3TJEL 4Z7UB 2P47B 4NQCB 4O2FA 1MFAL 4TVPD 4KK8D 5EZLB 3RWHA 3ARDD 3QXAA 3EFDH 5F6IB 4Y4FD 5DFWH 3VXMA 4E41D 5KZCD 1FNEB 3MLVH 5KVFH 1DUZA 3KPSB 5JIHA 2NXZC 5CKAA 2M2DA 2VAAA 4OZFH 1KT2B 5HHQB 4GW5A 1AQKH 5FIEA 3O4LA 4CJ0A 5JXED 1XR8A 2DL2A 4LPVA 3MLUL 1OAZL 3KGRA 2X4UB 4FQXB 1OPGH 4MA1B 1N7ML 1HIML 2IFGA 1XGYH 4NKIL 2XIDA 4K3JH 1WSST 5LCVL 5ITBL 1NGXA 1ZWIB 3MRHA 5DMGC 2Z35A 1J12A 4L1DA 1H3GA 4H5SB 4HS3B 2VXTL 3WUWB 4HIXL 4CADB 4I0PD 1S9KC 4HXBL 4G7VH 1HCVA 5DHXB 3NA9L 3VWJB 1OCWL 3V7AE 1B0RB 4GKSB 3C5ZB 1FL6B 2FX7H 5CZXC 4Y88A 3I6GB 3I6KB 2BHZA 1A02N 2ZSWB 4PJIB 1A7QL 3DWTA 2OX5A 3PABA 5HHOE 1H8SA 1CD1A 3ARUA 5HVFB 5GGRB 4XP6H 1NC4A 3BGMA 3IF1A 3TA3D 2DD8H 4OKVB 4PJ9C 3RUGF 3PWNA 4HKXB 5FYLE 4DZBB 3VXUB 2W07A 3P3YA 4TUJB 3U0PA 2IPTH 2WM0A 3INUH 1YNLH 5I8OL 3RI5F 1KENH 3MODH 5KSBB 5MENB 3U30C 1EVTC 4RAVA 3RZCA 1MI5E 4LVOB 3VXRE 5TPWH 2GEEA 4RMWA 4U1IB 4Y19E 3HE6B 4JFEA 5E8EB 3WJJC 5F7WC 4PJGE 3VGAC 2HKFL 3RL1B 3R8QA 2OL3A 5E1AA 4BSVB 1UCTA 2FJFA 2A6DB 5EB9A 5E5UB 4AEIL 4EI6B 5FECB 3A67H 5I1CL 3D0VB 2PTTA 5IVNA 2FBJH 4M5ZH 1Q9OB 5BVPH 1T1ZA 2FGWH 4U1SB 2K1MA 1FL5A 3QDGE 2FEEL 1SJXA 2R4RL 4M7KH 2R4RH 2P8LB 4M7KL 1SY6L 3LQZA 4M03A 3WDJA 4OCYH 2V6HA 4JFQA 4ZO7A 3UTTD 1YMMB 4XXDA 2ADFL 4R9HA 1T20A 2J8UE 5B39B 4P2RE 3W82A 1M6OB 5C07B 2PUQT 2EIEA 4QRUB 1V3JA 4NOFA 4HKBA 5IOPA 1C8PA 4APQB 5JTWA 3O6KH 4IS6A 2CK0H 2Z8WC 2GAZA 3HS0A 3WL9A 4FFYL 2BC4A 4JJ5A 2NX5E 4UTAL 5DD6B 4HX1B 3QYCA 3ES6A 3S37H 4O58H 2EYRB 3NTCL 4FQXA 2QBWA 3C87A 1KJMB 4HIHB 1QACA 3G5VA 2IPUG 3NN8B 2E7BA 1RUMH 2D4FA 4UQ2B 4HIJB 3HI5L 2P5WD 5E8OA 5T33H 5IJVA 5GS3A 4LEXH 2KZ1B 5BOPA 1CICB 3LN5B 4MWFA 1WBYB 5FB8A 4HCRA 3HUJE 1BD2E 5JLZB 2NZIA 4ETYA 3FO2A 4LAQL 1A4KB 1ZANL 1RZIB 2X4NA 1ZT1A 4BK4A 1E6OH 1B0RA 1YYML 3V6FB 5BV7C 1U8QB 1H0DA 2V2WB 4PJAB 3BKJL 4D9QD 3TBVB 1OGAA 3D2UB 2YZ8A 1N64H 4G7YL 4N5ED 3PV7A 4JO1L 3ZMRA 2B5IB 5DRNA 1UB6B 2C5DC 3H42H 4QOKB 5F7DB 5JPNB 3X12B 4FQCL 4ZFFB 3SDDC 2XPGA 3SKOB 2JKXA 2I9TA 4X9GA 1UH4A 5C08E 2Y1VA 4G42A 1G9ML 1CFNB 1F4YL 4TQEH 4M43H 3RGHA 4EUPB 4WI9A 1MWAH 1JPFA 5GS2H 4ZDHB 1QSZA 3Q1SH 3GSOB 1PD6A 4PRID 2A6JB 3GJFK 3HHRB 3LSOB 1JZ4A 3CDGB 2D3VA 3LHPH 1KEMH 2VZSA 4FHBD 1KB5A 3ULUH 4YK4B 2HT4C 3PIQA 4NQVB 4NYLB 3HAEH 4YPGA 1A6AB 1X5KA 1AO7E 4PGDB 3SHSA 5E0QA 3HZKB 4L3AA 2CKNA 1BGXH 4L5FL 3I9GL 3VG0H 4RFEA 2OL3H 5E8NB 1EPFA 2J8UB 4R6UA 1OD7A 5TE6H 1T66C 2A1WH 4I3SL 4S2SA 2HTKC 4PRBA 4OLWH 1GPOH 1C5BL 4JLRA 5FDYA 1Q1JL 4FXKA 4JGMA 1C7SA 5EZJB 4IDJH 2L7JA 3VDCA 2VDLL 4P9HC 5IFHH 2MCPL 4OLUH 5J8OA 4Z8FL 3MO1B 5BS0D 4JZNB 1XGQB 3C5JA 5J6HA 4HIJA 4H20L 4HJGB 4S1RH 3BDYH 4GMSL 4M1DL 4M1DH 4JG0H 4JREB 5DMGD 3VD5A 2DWEA 3FN9A 1YYLL 4OCYL 1BJ1H 3IXAA 3P9MA 4JPKL 1VERA 2NW3B 5KSBE 3TPUB 5KVGL 1ZMYA 3T2NH 1D3CA 3QUXB 1OAYL 1V7ML 2NQCA 3G6DL 4UZGA 5ID1A 2QJDA 3SGKA 2V2WA 1K2DB 3V95A 2C3HA 2P48B 2GSGA 1DLHB 2UY7A 3VXSA 1CGTA 2G60L 5F8QC 4H25A 3DROA 5J56B 4Z7VB 1C1EL 4N0CD 1EEYB 1KTLA 2VR4A 4JO3L 3ARGD 4HUUB 1KBGH 4NNXB 5DRNB 4MJ2A 3P40A 2WBJB 3SGDH 5IP4A 2IH1B 4Y4FB 3CX2A 4XRCB 4HG4K 1JNJA 3OKNA 4I9WE 5C0CB 4X6CF 3P30H 2J5LC 3KPSD 4PD4J 2CIIA 3QIWC 2EKSB 5TGBB 4HS8H 4LRIC 2JELL 3VG9C 3S6CA 5BJTB 1WJ3A 3WLWD 4HWZB 1JV5B 2VXSL 5I15H 1UKTA 4BZ1L 2CMRH 4YHOL 4F9LC 3EYUL 2HT2D 5IWLA 3O6FC 3QRFM 1D7FA 1FAIH 3FN3A 3JWOC 2NW2B 4FFZL 2FH8A 1NSNL 1A6TB 1U8MB 4EDWL 4FP8H 3B3IB 1PQZB 5C9JA 5BCAA 1S9YA 3SQOL 4D0DB 4WEUD 5GGRY 1DEEA 1BVLA 2Z0BA 2GJ6B 4FQ2L 3BE1L 4LCYA 3CLEH 2FB4L 4NKDB 3D9AH 4JY4A 3L3IB 1QQDB 3IU4H 4XNXL 1MWAB 1FAKT 1MHHA 5T1KD 1UM4L 4C55A 1NEZG 2ORBH 1A7OH 2H8PB 2ESVD 1DBBL 4N9GA 4EDXB 1IM9A 4HJ0D 5DEZA 1ZTXL 2ARJA 2NY4D 2GJJA 4K3GA 3ZHLA 3SOBL 5FOJA 5AEAA 2WUBH 4N8PA 1NAMB 1MCEA 4L3CB 1OTSD 3B9KB 4HFWA 3S88L 5JHDB 1QSEA 5I74B 3VCLA 3MUGB 3AMKA 2A77L 1MEXH 1ZA3A 2ZKHH 1U92B 1ZS8A 4DTGH 3NIGF 2BVOA 3NIFE 1FIEA 1CQKA 1RIHL 3KPMB 4MA8L 4OTXL 3CVIH 2GCYA 4PJ7E 1WWBX 4HK3J 1UGNA 2FHFA 4AMKH 4X5WB 2X7LB 4YWGH 1N5YL 4BH7B 3CUPB 5F3BA 4PY8J 3ULSB 3JVGA 4N0UA 3I50H 1FFNA 4XPGL 3QUXC 2NY5L 4HWUA 3VXUA 4GAJH 4ZFOA 3RU8H 2IPUK 3FONA 1TJHH 4UDTB 4F58L 1IRAY 4QY8A 5F9JB 2CKBH 3MCLH 1GC1L 3FQUA 3BDYL 4X5LA 4EQ3A 2ADIA 3QJHB 2P42B 3TLRA 1F4WH 4Z77A 2XQYK 3CFJB 4OM0H 5J1TC 2VLKB 1QO3A 2VH5H 3C08L 2HJLB 1C12B 4YGVB 4FZEH 3LQAL 4R8WL 1Z6JT 2QADD 1F6AB 4LCCC 5E6IA 1FRGL 4U2YA 5DUBB 1KEGL 4GLRH 3SGEH 2B4CL 4DVBA 2W59A 4LDOB 4WWKD 4GAYB 4OLZH 5EA0H 4G6KL 5BZWA 1T1WA 5KSUB 3C60B 1U8IB 4XCCH 5D72H 5CJ8A 1UADC 5LG1A 1YPZA 3H3PH 2W65A 1R5WA 2C9AA 4J3SA 1DQJB 2PR4H 2NTSP 1MFAH 4OZFB 4HKXA 2Z8SA 1IGMH 2GJ6A 3GI9H 1QP1A 1RJLA 3QUKA 5J89A 3MC0A 3GMNB 5IQ9B 3NCFB 4S1QH 5FYJH 3OKEA 3SKUD 3IXTB 3VFGH 3BEVB 1CFVL 1ZA6A 3B9VA 3MROA 1WQVT 4X80L 3H9SD 2H8PA 2AJSL 2BNUA 3DXAA 2WLYA 1T1XA 5DZNA 5I71B 3FT2B 4OCNC 5KJRH 1O5DT 1M71A 4WHTB 2A6DA 3D18B 1BEYH 1TVHA 5L2KA 4NWTL 3WNKA 2BNRD 3QB7C 3RWFA 3EAKA 1ZT7B 3NIDE 2VISA 3MACH 5FA4B 3BT2L 4JFOA 3HKFA 2VQ1A 4NC1C 5H35A 3STBA 1DANU 3QNXB 1WIOA 1TIUA 4BELD 1CGUA 4XBEH 4XBEL 4WGVB 5HGAB 4HLJA 1T21A 4OJFL 5CD3B 2XY1A 2W1NA 4MJIB 1CS6A 1TZGL 3RI5K 2GJ6E 4U7MA 3P9LA 5TH2A 5HHMD 4MNHB 1DDHA 3O4LE 3WS6A 2DKMA 3PDOA 4RAUA 4EI5B 4ZFZB 4ALAL 1TQCC 4EVNB 1JL8A 1U3HD 1KPVA 1TQBC 4JQXC 3WFCL 1A14L 4HFUH 4L4JA 1HQ4B 4CRPA 1CU4L 4LLUB 4Y5YA 5DRWA 5DURB 4BZ2H 4M7JH 4G9FB 1DEDA 4NZUH 4QXTA 1D5BA 5DMKB 3S9DB 4RISL 3QBTB 3DVNA 1IE5A 2E7LA 1MVUA 5HHOA 4M8VA 4KI5F 4J23A 4NZJA 1H15A 3VXSE 4XGZA 5CGYC 2GFBA 4XVUD 3MXVL 5DJZB 4P5MA 3ARBA 4YDKH 4RFNC 4FG6D 3BP7B 5EBMB 4GH7B 2NY7L 1F4HA 2XA3A 2ZNWA 2YA2A 1P4LA 3RPIB 4U6VH 3HC4H 5TE4H 4DVBB 3OKKB 1J88A 5GRUL 3AGVA 3CPLB 1CFSA 5C08D 4V1DD 2IADB 1YYLH 4KROD 4WU5B 2Y9RT 2YWZA 4WW1A 3QPQC 4TSBH 5C2BH 4XI5C 3NCCB 4PV9A 4YDJA 2XKSA 5ESVB 3T4AA 4G8EB 5I16B 3ZKMC 2A38A 2BCKA 1EAPB 5BQ7B 1BBJA 2P7TA 2EO9A 4DEPC 4Z7OF 2VRAA 1FNSH 5KN5A 1UCBH 1IC5H 1MJ8L 4TSCH 1XIWB 4ZS7H 3FT4B 3MRNA 2DYPB 5IJKC 1I9JH 3NTCH 4ZDHA 2O93L 3VA2C 1G9NL 2CDGA 1FORL 4P23D 1NGYB 3DETD 5K9JL 2R0ZH 4W4OC 35C8L 5FYJL 3SO3C 5ANME 4ZPVA 4GKOA 5DFVC 3ALPA 3N50A 1G7MB 2IEPA 1R6VA 4NQXB 1ZE3C 3REWB 3R06B 4GW4A 4OLXH 2FL5A 3U4EA 4LAQH 3EDJA 5DC0A 2HH0H 3KJ4C 1VEMA 4PD4K 5GIRA 1IEBA 3FJTA 2R9HD 5D1ZD 2R2HA 1FFOA 1JPGA 1R3HA 1MFEL 3PE9A 1BFSA 1O7VA 2Y4SA 3VXMB 2XTJD 4PREB 5A16B 5DD3H 5IMOA 5C1MB 2IG2H 3C6LC 5E24E 1MWAL 4MSWA 2EH8L 3QDJE 3QIBD 1XR8B 4XB7A 3MYZA 3ES6B 1SMAA 2P49B 2IFFH 1BQHB 1FV1B 1KJMA 1ZHKA 1BIIB 4XX1G 1BZ9B 4N9OB 2R9HC 1S7VB 5DMIL 1NBZB 1EJOH 1L6XA 3GO1H 1H3XA 3WUZA 4ONGH 5EN2B 4ONGL 4A6YL 5ACMA 4O4YH 4ISVB 2IGFH 5A2KH 1QNZH 4XPAH 1BQHG 2FGZA 1BMGA 5FCUH 3GI8H 1QD0A 3VE0B 1YQ2A 4X7EC 2BVUA 1FE8H 3LQAC 5B38A 1ADQH 1S9WB 4X6CB 3CZJA 4P23C 4PYHA 4ODVL 4MAYA 4QRRE 1RHHA 2KBGA 3OKOB 2B4CC 5DFTA 4GAGL 5CLTA 2YMXL 5I1AB 1NMBH 1X4YA 3PP4L 4YR6A 4F57L 2DLEA 4L3ED 4Y2DA 5GISH 3CDFA 1FZJB 3INUL 3BKML 5DUPL 4EJ1C 2H26A 1GC1C 2D7TH 1X5IA 5ICYA 4L9LB 1MY5A 1HDMB 2MPAL 3MR9A 2MPAH 4R96B 2DTMH 4X4XB 4CVXA 4JO4L 5DVOA 2NY6D 4ODHH 5DJ2B 4MXWL 3MGTA 1U93B 1KJVA 3RY5A 2GITA 1EAJA 1HOCA 5BJTA 4R7NB 4B41A 3IAGC 4PJDF 3IDNB 4AL8L 1UH2A 3VI4E 1ZGLM 1OGTB 4XNUL 2GTZA 4LBEB 3NBNA 1KJ2L 2P8PB 1OAYH 4MB5A 1KCLA 3X17A 1ZA3B 5ESAB 3ALXA 3GJEA 4WCYH 4OQTL 1C08B 3L5IA 1QHPA 1D5XA 5EC2B 4OM0L 5KOMC 3OB0H 1L7IL 1WBZA 4IMLA 4LSUL 4NN5B 2GCYB 1BVLB 4TSBL 3HI6H 3VGGA 3FO0H 2FL5B 3Q5OA 3PWVA 4GRMA 4Y1AB 3LN4A 3EYOB 2G9HA 4S10A 4NN6C 3W5MA 3MA7B 4HUMB 3U7WH 2ADJB 2D4DA 3A6CL 2CUIA 3U0TA 4XVJH 1R3HB 2AQ3A 4QRTB 4KHTH 5HD8C 1MCPL 1G9EA 1M05B 2A74B 4QHMB 5TFSH 4OB5L 4NHUB 3V0VA 1D5IH 3MBXL 3LKRA 3U48A 1ACYL 3CGTA 3TBWA 2D31B 2RFXB 1JZ7A 3RTQD 4YK4C 1BX2B 2IBGA 4JM4H 4PB0L 1CVRA 1DBKL 3V4UH 3NN8A 5EOQL 3UZVB 1SJEB 3BVNA 4L8SA 3VFGL 1G6RH 2HJLA 4MHHI 2BVPA 3NAAH 4GG6A 3EFDL 1UA6H 1FZOA 1SJHA 1SVZA 3O9WB 3ILPB 3TFKD 2CDFA 1UB5B 5DD1L 4N0YL 5F7EL 4DKFL 4PIRF 5E2JA 3RWDB 5HYIA 4XP1L 4PLKC 3VW3L 1WBXA 1D9KC 2B1HL 4LHJB 4NO5B 1NMAL 1FL3B 1LDPH 1NFDE 4XBPA 1EERB 3C8DA 4J3WA 3QUZA 1YY8A 1VCAA 3ZKNC 5DZLA 3CFKB 1DQML 5ISZD 4KUZL 1TNNA 4L4VA 4GRWB 5D7SL 1CF8L 2YPKA 4NFBA 4ZD3H 1K3ZA 1WWCA 3QIUC 4QHUA 4OZGA 5LJYH 5CJXA 5IB4A 3QXDA 4A6YH 5F7NC 2Q76B 4P2YA 4GUPB 1QSED 4FABH 3EHBD 1J1OL 2ZCKH 5A43C 4P49A 3Q48A 4P2QD 5E5RB 4KC3B 1N2RB 5GGTA 1QO3B 4XXCA 1Q94B 1YPZF 3EKCA 3RX5A 1BIHA 4WENB 4XTRD 4L8BB 4QF1B 2XNAA 5LQBL 3NFNA 5IV2A 4LRNL 5F96L 5BV7H 1HWHB 1A1OA 2V2TA 4OD1H 1QVOB 4OLWL 3QEHB 3KVQA 1VHPA 1YECH 2AEPL 5C9JB 4RAHA 5DHVH 3RIFK 1JNLH 4Z95H 2DIBA 3MNWB 2UZIL 3FOMA 2X2YA 4WWKB 1YJDH 4ODXA 3DRQB 1XF4A 3O9WC 5E2WL 5B22A 1DBAH 1QQDA 1RURH 1JWSB 4Y4HC 1EHLH 2ADJA 4NO0B 3ZE0F 2H41A 5SV4A 2FX9L 1RZKH 1IMHC 3GSRA 3VFRA 5FGBA 4FQIH 3T4YA 4M7ZC 1UZ8B 1ZEAH 4NHUA 4UB0L 1UZ6F 3LPWA 4KQ3L 4LLVA 4R2GB 5E6YA 3MFGB 4C56B 1R5VA 4LVNB 2C1PA 4IBLT 3IDGA 3UYPA 5I74C 2P43B 4XHJD 1ZWIA 5HI3C 4J3VA 2XT1B 4MDJA 4XZUB 3BQUA 3KPRB 4MQSB 1UCBL 3M45A 4YHIA 2W91A 1PKQB 1YQVH 2NPLX 4G9FD 3QG6B 5ITFA 1QLEH 4KKAC 3QUYC 3CSGA 4UAOC 2VZUA 4JDVA 1FZOB 1SJHB 2RR3A 5FB8B 2X41A 1C16A 1HI6B 4JPWH 4KGLA 5HYFA 5HYEA 3CZFB 4R3SB 5HYSG 3RGVB 2OZ4L 2ZUQB 1EEUA 2ICWB 3ZYIA 2EE2A 5C0ND 4CNIA 1MSPA 2X4NB 5DDHA 3ULVC 4NIKB 2AJSH 3DV6B 3W11C 1K9TA 3TT3H 4XNZC 4BQ8A 3PXHA 2AXFA 4OIIL 2DQIL 4OSUH 4DKFH 4KRPB 5JPMA 4PJBF 4BZ1H 4G6ML 1EAPA 3SN6N 2KPNA 2ZZUT 3KWWA 4DGYL 2OXHA 2VZOA 4X8JB 1H3PL 1CYGA 4XC1L 3P73A 3QUYA 2WWMD 2OCFD 4XP9H 1UM6H 1UM6L 1EMTH 4BSJA 3IT8D 3O3UN 2OJEA 3BZEA 2BZDA 3SCMB 1CDUA 5F88A 4M6NH 3BXNB 3T1FB 4DKAA 3PGCB 3RL2A 3ULUL 2ESVE 1OP5K 4NRYB 2HT2C 3FMGH 4UUJA 2ADGB 4ODTH 1EA9C 2ICCA 5A1AA 4YDVA 1AHWB 4ZQKB 2FECL 4QT5B 2EDTA 1T0NA 3DMMB 4CU7A 4RWYL 1NMCC 5FCUL 1A6AA 2JB5H 1S9YB 2BXYA 3FAWA 2X4QB 3MRQA 1WVZA 1FE8L 4UV7H 4X7SL 4PRPB 5FO7A 5C0DA 1F6LL 2Q8AL 4PJ8A 4AENA 4XMPL 1AY1H 4GRLB 4TSAH 3ROLA 2QLVB 5GGTH 1MFNA 3TO4B 1A9BA 5DEGA 1JNNH 3QH3A 1YEIL 1KFAL 3WFZA 4ELKB 4H0GA 4N0CC 3BEVA 4I48A 4MMZC 3QA3A 4ZXBD 4O9HL 5FM5O 2HT3D 2IQAB 4KPHL 3AU1B 4EOWH 3V5KB 3M17A 1NCWL 1YNKH 3UJTL 3UP1A 5H94B 2OXGA 1J0HA 5D6CA 3TBTB 4KVCL 1FNEA 4XCNA 1FBIH 1CT8B 4KRPC 4Q74A 2UZXB 3AREB 3KS0J 4HFWB 4GRWE 3MV8D 4Z0BH 5F8RC 3RGVD 4E42A 1JPST 1KPRB 2VL5B 1TZIA 3AVEA 5I1KH 5A3IC 4PG9A 4WV1C 3QPXL 2R2EB 1HXMB 1V7NL 2WIMA 1PY4A 1N0XH 4JRXE 5LVEA 2OMNA 4R4BA 3SCMC 3HPJA 4APQC 2X4TA 5C0AE 4XC3L 4G6AD 4X9FA 4XPHH 3T77B 4I3RH 1I1AC 4X5WA 4FQPA 4WEBH 4PJIA 4WIQA 4YQXH 2YPLB 3ZYOA 4ENEC 2OI9B 4NO3A 4JM2D 3HPLA 2OTUA 2OP4L 2CQVA 3ULVF 3DX9A 3RHWK 2VZVA 5D1ZB 1FL6A 1HQRB 2YD7A 2PO6A 4JR9H 1ZK9A 1U8OA 4PGCB 1FFPA 1ES0B 1ORQB 3EOBA 4IRZL 2AQ2A 1CR9H 2E6PA 5D1XB 3TIDA 4ONFH 4M93B 3NPZB 1X5XA 1KV3A 3QRGL 2R2BA 2DQJH 5FM5M 5FHAH 4XGZB 4X6DB 1ONQA 2NY1C 3CFCL 1HH9A 1TCRA 4HEPG 4OLEA 1I85C 4RMRA 1PSKL 3KYOB 4QRSA 1TNMA 5IKCA 1DQQA 4JFXB 3V4VL 4FQQB 2GTWB 4Q9RL 2F53E 1U8HB 3L6FA 3QUML 3P0GB 4PP1C 3DGGA 4U1IA 1WLHA 1YEDB 4JFFD 4F3FA 2JJWA 2ZJSL 4DKEL 3LRHA 2BNQE 5D1QD 1E6OL 4TYUA 3CDYA 4I13B 2AEIT 3BIKB 4ACPA 4OLVL 4G43B 3C6SA 1M6OA 4M1CD 2WQ8A 1NSNH 4GBXC 2CO7B 2J8OA 2YK1H 2JJSA 5EOTB 1T03H 3MGTB 5LAXB 4PTTA 3IFOB 1VDGA 1ADQA 3KYKL 5IBTH 3V7MA 4NHCL 6FABL 3DX8B 2Q86B 4HUWA 5T1KA 4DZ8A 4MXVE 1MH5B 4G9DB 5DK0A 4WO4D 2VLLB 3B2UD 1S7SA 1NAMA 4WW2F 4GBXB 3KXFD 3P4OA 5FA3A 4MQXD 2Z31D 5ELIA 1EDQA 4OFKA 5GJSH 2QL1A 4F37F 4CADA 5EC2A 5IB1B 4LSRH 3MV9B 2KQMA 2OMBA 5MEPA 4AIZB 4N0UE 4X6FB 2HLAA 1EO8L 4DGVL 5HHVL 5HHVH 2Q8AH 3ULUC 2VKWA 5I1JH 3WBDA 2RCSL 1AGDB 1IC7L 5DVNA 1VPOL 3H7BA 2XYCA 3HA0A 3MRLB 2ZUSA 1DLHA 3Q5TA 5HPMA 3VXNB 1IFHH 4FFVC 4QXGL 3ARQA 3PABB 4MNQA 1WZLA 3P77A 4YDKL 5E8DH 3RTQB 4IRSB 5I1GH 5K9KB 4XNUH 4O2EA 1JVKA 4EN3A 1FVDB 1N5AA 5C0BE 4ZUUA 4HIIA 3QR2A 2DM4A 4AM0A 1CFQB 4MXWH 3KPRE 1EGJL 3MV8A 4XBGB 1ZLSL 2X44D 1KB9K 5I1KL 1I3RA 4OD2A 1JPFB 3SDCC 1CLZH 4Z77B 1H3WM 4ZXBB 3QNZB 5D6DA 4MJ6A 5DJ0A 3O4LD 2EDOA 1ZVSA 2W0FB 1T2QH 5GSRB 2ZG2A 4CDHA 3LB6C 4JFHD 4M9PA 4HUXB 5E99H 3OR7B 1ZV5A 1F6AA 4FFYH 1QR4A 3I6LD 1FGVH 1KG0B 1NGZB 2E7HA 3LQAH 2FECI 1RZJH 2MKWA 1WC7B 1UT9A 5F72S 1R5WB 3DRQA 1DL7H 2YPKB 3MOQA 1FN4A 3U1SH 4JFEE 4PPTA 4S0SD 4JG0L 1CG9A 1MFBL 3O45B 1G7HA 2VH5L 2GJZB 5CUSH 4ONFL 2VL4A 3SDXA 5CHNA 3TA3C 2VDML 3B8YA 3ZDZE 4OCWL 3Q5YA 1A7RL 1NLDL 2HVJA 3RIFF 3V52L 4LF3B 4EIZC 4BSWA 4L4TD 2X05A 1X4ZA 5SWSB 3NACL 3FB8B 3MCKA 4MDJB 4QF1A 4HAGA 1QSVA 1T1XB 2ZCLH 3TT1L 2CLRA 3BH9A 4GW1B 4MA3B 1FVEB 1TETH 4P3DB 1NGXB 1G9MH 1X5FA 1TZHA 4K3EL 2XG4A 3H0TB 3UBXI 5IM7B 5FA3B 5D2NB 4RZCA 8FABA 5L7XH 1PKOA 3C5SA 3X14B 3RDTD 5FXCH 3UX9B 3RWFB 1U58B 1PG7H 2RHEA 4XPFH 1MJ7L 4OFVA 5E9DB 5C7XH 3GDBA 5EU6D 2X7LA 5CZKA 1WICA 5CSZB 5TJWK 3O3BA 2E27H 5T1MA 1NAML 3TESA 1I9IL 3LKSB 3SDXE 1NEZB 3ARFC 3VXSB 3T0EB 4EIGB 3DROB 3SDDA 1QRNB 3T0DA 3WHXB 2F54B 1IAMA 4IM8A 4JGJA 3RY6A 3LH2L 2UWEF 5BO1H 4I8DA 3GSNL 1JZ5A 2D03L 4WO4A 3UAJD 4BH7A 5E2UL 2V5MA 2R39A 4QXTB 1UM4H 4QRRB 1ZHKB 3ARDC 2HA1A 4IRSC 5GGTL 1NKOA 2JIXA 1WFNA 3S3JA 4IHOB 4NN7C 3D9AL 2OJEB 1HH6B 4JE4B 4AM0B 3G9AB 3WEXA 4R90L 1QBBA 2HFGH 2FZ3A 2OK0H 2DI9A 3C6LB 1FJ1A 4M62L 5GRYA 5C2UB 5C0IB 4U6HB 5FYKE 2HP4A 3CDGA 3PF2A 3BP7A 2ADIB 2FIKB 4KVNL 1N6QH 3HB3C 2DQUH 3MLSL 4JPIB 2J5LB 4KJQC 4UNTA 1EHXA 4I77L 4R4NC 1FSKC 1ZEAL 4UB0H 3GJFA 4G8GA 2W38A 1DEEB 3TV3H 4M5YH 4PRPA 2IAND 5KANI 2BK8A 4AEIH 5I1CH 1IGFH 4UIMB 4XMLL 3ZL4H 1V7NH 4K8RC 5FKAB 4QWWD 2F54D 1T20B 2ID5A 5F1IB 3ESVF 4YDJB 2Z31A 2XQBL 2FGWL 4I18B 5ESVA 3LQZB 3VXRB 1VACB 1X4XA 5C8JA 4P9HH 1DQJA 4JQVA 4LIQE 5EBLB 1JF6A 4X4XA 4CVXB 2NY3D 3LKOA 1ZLSH 1EHNA 2J7LA 2HWZL 5K33A 3TBTA 1HN1A 1MCLA 3VXUE 5KN5B 3TH4T 3O3EB 2VAAB 4X98B 1B6DA 5KVEH 1U41A 4HH9B 4YDVB 4ZQKA 3TIEB 3WFBL 1NAKH 4JM2A 3N1QC 5KZCB 4LPTA 2G5BB 4Z7QE 4K23L 4PJXA 2HH0L 5C0BA 3R06A 5GHWH 2NR6D 4WUUB 3X14A 1IC5L 2VC2L 5C0DB 1OTTC 3K2UL 2X09A 4NQUA 5LGHL 4L4VD 3C8KA 3MUZ1 2UYLB 1UXSB 1JWUB 3VXRD 4JO1H 1PFCA 1FORH 4LLUA 1GGIL 1VFAA 4ODSH 4Z7VA 3BO8A 1NGWB 3CH1B 1FFRA 3O6ML 5C0JA 1MHCA 4NWTH 2A9ML 4ZFZA 4LLDA 2RFXA 4HJJH 3REVA 1FNGB 4XP9L 4X80H 2GK0A 5LCVH 1G7JA 3NCBB 1A7NL 2CPCA 2YSSB 2LU3A 4HUKB 1P7KB 4MLIA 4NQCE 2COQA 2ITDA 1MCOL 1RSFA 2ENSA 5SWQA 4NQSA 3TO4D 3SKMB 5DTFB 1SVCP 3GSWA 4HS6B 4HXAH 25C8L 4P5MB 3HC0B 3G5XA 3HZKA 4OCMC 3UO1L 1H5BA 1VKXB 3VXTA 3ARBC 4KFZC 3MJGX 4HQQL 2FRGP 1VADB 2NY2D 4N8VG 4ZFFA 1V5JA 3PL6C 1II4E 5GRVL 4K2UL 3QQ9D 1IL1B 4XPTH 3RPKA 3TZVC 1N2RA 5TE7L 3HMWL 3QAZC 5J7CC 4LLMB 5AWNL 1JZ6A 4LPWA 2MHAA 3QJFA 2P24B 4HFUL 3A6BL 5DJAA 3A6BH 1C7TA 1EUUA 4KTDL 4ODBD 2DYPA 4IMKC 3MUY1 1JF1A 4X0KA 3T3PF 1OAUH 1NBVH 5IW1B 3LEVL 2XKUA 1MI5B 1KCRH 1PGRB 3OJDB 1F4XL 4OD3L 4NOBA 5GGVH 5CJQH 5BZDA 1A3LH 1YJDL 3EIFA 2Z35B 4S1DD 5IJVB 2DTML 1X5GA 2NW3A 5FO7B 3TYFA 5F7YC 3QO0A 1AJ7H 1CGYA 3FB6B 4KHXL 3QT2A 4QTIH 1P5VA 1XIWC 3HZMB 2DWEB 1U95B 1ZLWH 1M1SA 5E5MB 4KQ4H 3WFBH 4LCWD 4LSUH 1RZIA 1L7IH 3WYRA 3EUUA 2B0SH 1P7HL 1WCQA 4Y1AD 3WE6A 4XAWL 1BREA 3V0VB 4I0KA 3F62A 4K7PX 1B4JH 3BQUC 5EIVA 3O6KL 1BIIA 5E9DE 5L9DH 4G5ZH 3H8NA 2WBJA 3K74B 4KHTL 1W8OA 1MCHA 1ETZB 1PZUB 5J0BA 1TPXB 3MCG1 4OF3A 3RAJL 3WKNA 4U3CA 3WHE1 3CFCH 2AJYH 1XGPB 2FWOA 4BUHA 1ZHBB 3WNMA 1XR9A 2CDFB 2YWYA 1AR1D 3BDBA 1WZ1H 4M3KB 5J4MA 5MERB 4ZUSA 1KF9B 1MCBA 2BVPB 5I17B 1FCCA 3KYNB 5D5MF 3DUSB 3SE9L 5T3XH 1BWWA 4NQSB 2C4FT 1OAZH 2G5RA 1T5WB 4OFIA 1GGIH 1P4IL 4EKXA 2EH8H 3G6AB 5GSVA 4Q9RH 5EUKA 3HE7A 5GS1C 4D0CA 4FQ1H 5D1ZA 4MAYB 1S78C 4KK6C 1T1ZB 5B3JE 5D1QA 1IGYA 1WIPA 3FO9B 5DHVA 1JZ8A 2X4PB 2CDEB 1ZANH 1J1OH 3GMRB 2HFEA 4MD0B 4LCYB 3MRMB 1J18A 3HR5A 1YMMA 1MJUH 1IM9D 3O41B 1A6WH 2FLRT 1A9EB 5GGUA 5HTSA 1P2CA 1MAJA 5I16A 3KYOA 4MA3A 4FZ8L 4MAYC 3SKNB 1CICC 2E7MA 2YPLE 5DJ2A 3B9KA 1IBGL 4K9EL 4JCLA 5HJ3B 3WDHA 3ABZA 3DGGB 5EIIA 2PW2A 1D9KB 4XVSH 3SO5A 4HIHA 5C6WH 2J6EL 5D8JL 2IANA 4GKNB 4UQ2A 4CDGC 2PO6D 1X5HA 2FLBT 1U3HA 3KPNA 3D48R 1XGRB 1SM3L 4PJFE 4Y5YC 3L3IA 1M05A 2A74A 2A6KB 3BH8B 4ELME 3BD5A 3SPVA 3NIDF 4I3GA 1S9XA 3T65A 4ODVH 4R26L 4OD3H 2V5SA 3M07A 2PTUA 1IGFL 3KHOA 1K85A 4U1LB 4WVRA 1NMBL 5DHYA 3FONB 3SDAC 1D5BB 5ILTH 4N0UB 4YHYB 3PGFL 4KH2A 2H2PD 1S7VA 3IDGB 2FJHA 2HFFA 1LD9B 3B43A 4U33A 4RGNE 4ODHL 1DN0A 1G6RA 1OF2A 3OL2A 1Q9WB 4P2RD 4GG6B 1FGNL 2DYPD 4K8RL 1VFOA 3KLHC 5T1LB 5HHOD 3PQYD 2JJTC 1NQBA 8FABB 3JTSA 3PWPB 4WFGD 1TTFA 2DQEH 2H1PL 3QDMA 3U1SL 5T3XE 4KI5C 2HLAB 3SGKC 3QUZD 4O5LH 1MNUL 1OB1B 4P2OA 3QI9B 1UACH 3BZ4A 3KYNA 1NAKL 3AY4A 5K9OA 1P53A 1UKQA 3EBAA 3U7YH 1KJ2H 4KAQH 2B0SL 5D7JA 4FQJH 3KHQA 3PWUB 3VXQB 4XWGH 5E00B 5KSAB 4X6CA 4WI4A 1OHQA 3HE7B 4JKMA 3G04A 4Q7DA 4RDQG 3TC9A 4R4FL 3PV6B 5KW9H 2VLJA 3PXJA 4X4YB 2BCKB 5BQ7A 5IB3A 3LS4H 1FVDA 4PJEE 4YR6B 1X7QB 3LKOB 3WIHA 4NKMA 3X3FH 2VZTA 2VO5A 3BE1H 2GSIA 2V7HB 2F53B 1EO5A 4G6MH 5FYKH 3WNOA 3EFFA 1OGTA 1FYTD 4H88H 4IOIB 2XN9B 1ZVSB 2W0FA 5DI8A 1TDQA 1N7MH 3DTXB 4EXKA 4RQQB 2GITB 5JMOC 4RMSA 4M61B 1WISA 2QSQA 4OFYD 4JY6A 3UTTE 3FB5B 3ZDYF 5JQ6L 1MFDH 2VQTA 1KIRB 3P2TA 5JORA 5J6GA 4NBXB 4PRIB 5C6TH 1CICD 2E7LC 2WUCH 4MAYD 4U0RB 4TULL 3H9ZA 4HJGA 3FQRA 1TTUA 3F12A 1CZ8H 3AS1A 4OAWB 4XNZB 5KTEL 1CD8A 3LIZH 32C2B 3J7HA 5AZ2L 5CHNB 2X4SA 5DRZB 3MNWA 4JHZA 3VGBA 3QDMD 3EYQC 2CXGA 1LHZA 2Y36L 4BQ9A 1YN6A 2FATL 4BFIB 4C83B 3O11A 3O2WL 4JHAL 5D6DC 3O6LH 3OJ2C 4YO0A 1S3KL 3OAYK 4P2OC 5CINH 3VWJD 4BFEA 2A1WL 4I3SH 1M71B 1DBJL 4PJ5A 2Q6WA 3B2VH 3OWEA 1HHJA 2DN7A 4OT1H 5IW6A 5C9KA 3U4BH 3FZUC 4L1HA 2EC8A 5CKGA 1R3KB 4P46C 3ECBB 4UQ3A 5IG7A 2R2EA 5DTFA 2EO1A 3UJJH 3VU2A 3RIAF 1KCVL 3DUHA 1SBSH 1NBVL 1UB5A 4F7CB 3NFSH 2VDKL 2R1XB 2ICWI 5I1EH 1GGTA 3CFKA 1P4LB 3RPIA 1X5YA 5DVKA 1MUJA 1F2XK 1P6AB 2N4IA 2ZUXA 5MP6H 5BZWB 1SYSA 1C5BH 3Q3GB 1L7TL 1FZJA 4Q6IC 1MLBA 2ZUTA 4OKDA 1UM5L 3G08A 1R0AL 3LN9A 1R3LA 4EXPX 2EXWC 2QHLA 1R3JA 2WIIB 2VLKD 3ZE0E 4GXVL 4IHOA 2EIZA 3U46A 4OZFA 3VFSA 3GB7A 1JTPA 2J88L 2O5ZL 3WS3B 1U93A 4JFDD 2R2BB 2XTLA 4R97C 5DQDL 2HKHL 2AGJL 5JPNA 3JWOH 4IIQC 4MQ7B 3RL2B 5D1XA 4JRYE 2CRZA 4LBEA 1JWMB 3MROB 1B3JA 5FECA 3MGAA 3NH7H 4G6JL 3OR7A 4F9PA 1DQQB 2XA8L 4P3CH 1DR9A 5D70L 3QFJE 4HZLB 1IZJA 3VFVB 1QSEB 3IETB 4F3FB 5CEZD 3S4SB 4LASL 1HSBB 1IGTA 3QEQE 5L88H 4ETQA 4ZUTB 1WZKA 5IROA 2DI8A 2NCMA 3VFRB 3T0AA 1NL0H 4A6YB 2IQAA 4G6KH 5D1XC 1ULVA 5TH2B 5EU6A 3GBML 4HF5L 1PBYA 4LLMA 2BNRB 1MHEB 1G7LB 3T3ME 3BFOA 5SWSA 4PJBE 5DMIH 3QH3B 4XCNB 2Y7QA 3O81A 2X89D 5J3HC 5LAXA 4K3EH 3S35X 1F4YH 4HH9A 1Q0YL 1Q0YH 2WBJD 2HLFD 4YE4L 1EVUA 1CXEA 1D6EA 3QG6A 4HGKC 5ITFB 4LCWE 1GGYA 4S1QL 3MLVL 2R1WB 5BVJA 3D25B 5BMFL 1EO8H 4ZUSB 2Y5TB 4J3OC 5MEPB 1KENL 4QRPE 3KPQB 3MJ7A 5JHDA 1JYWA 2HVKB 4W81A 4O4YL 3HNTL 3MV9E 2X70A 4IIQB 2XRAH 4PRAB 3IDXL 4POUB 1T2XA 4L3EA 4XP6L 5GRVK 4DUVA 3LEXB 4TTGA 1C5DB 3CU1A 3KR3L 1T1YB 3K7UA 1PW3A 4Z0XA 5FOBB 4N0RA 4Y5XA 3LV3B 4JFPA 3PG2A 2FHCA 1QLFB 3MOAL 3PWLA 3HRZB 4HCRL 2EE9A 5AYUL 5ISZB 3X12A 3FL7A 1LEIB 5B3NA 1YPZB 5F3BB 4WU5A 4L9LA 1G9MC 2LU4A 2X42A 3H9SA 3HI1B 5DRXB 2VLMD 3AAZB 4Y4KC 3IAQA 3EOYG 2W9LA 4Z5RA 3DNKA 3F5WB 4E41A 2XNAB 1TJGL 4MQ7A 4Y4FA 1LGVA 4X5XA 5C0RH 4MJ6B 4F57H 5I19H 4U1JB 1JWMA 4W4NA 4ZODA 2CK0L 2F74A 5ENWA 4GRWF 4PJ8D 4AY0A 1NLBL 5JW3H 1NLBH 5I1EL 1WFOA 4AMKL 5ADPH 4QO1A 1RZKC 3O8XD 2E9WA 2EH7H 3EO0B 5HHME 2NY0B 1H5BB 4LP5A 1BPVA 5L8JB 1JGLH 1EJ6A 3R0NA 5HDBF 3EJZC 3B9KC 3BH8A 2X4PA 4RX4A 4U1GB 4G3YL 1CTOA 2VDMH 2Q7YB 2F5AL 3K8LA 5EOTA 1M7IA 2NY1B 4OCXL 1RZJL 3ZE1E 1WCBA 2YD5A 4J8RA 2FR4A 1E4XL 3DXAD 4JR9L 2K9UA 2Y07L 2FO4A 5I9QB 5GS1A 1BLNA 1EV2E 1G7IA 1IILE 1K6QH 1DQDL 2OP4H 5HYJD 1OF2B 3OR6B 5HYSB 1SEBA 4KJQD 4R7DA 2JELH 4MZ2A 1GGBL 1GGBH 1QG3A 4TNWK 3MBEA 3HNVH 1CN4A 4Z7WA 4PBVC 2YD3A 1KJ2B 5C0AB 2VDQL 4P9MH 4ZNEE 2F54E 4LEOB 1U8JB 3D69B 4FN0A 3T0EE 3AB0C 5C09A 1K4CA 3PNWA 3PP3H 2QR0B 3SDAB 3GSUB 1MVUB 1TTGA 5I8EB 4OLXL 5HHOB 4JO3H 2R2CA 4XC1H 3HZMA 2DQIH 1R5IA 3L3GA 5CSZA 2XOTA 4IRSD 4OI8A 1UWGH 3LKPA 5BS0B 4NWUL 1FL3A 3KPPB 2PXYC 4JFHE 1CXKA 3PGDA 1OP3H 4WEMB 5IK3A 1MHPL 2XN9E 5F44A 4DN3H 4EVNA 4J4PC 4ZUUB 1L9MA 2VDNH 1G6RB 4JQIL 1WAAF 3BN9C 2IH3A 2IAMD 4MGXA 1DSFH 5K9KA 5HI4D 3UTSA 1BFTA 1GOGA 3AUVA 4YXHH 2W60A 4Z5RB 4JFXA 4D9QE 3N1GC 3HCVA 5IV2B 4MXVF 5CIPH 1ZVYA 4M3JA 5LWYL 3ARGB 4KDWA 4D8PA 2EXYD 1AHWA 3MRPB 5GGSB 3JV4B 3Q0HA 4K71C 3DGCR 3MREA 3K1KC 5MI0C 2B39A 3MA9L 4PB9H 4YBLC 1A14H 3VGAB 1LNUA 3DBXB 5ECJE 5TE6L 1ED3A 1BVKA 4I5BA 1VADA 3RVXD 5DQ9A 4ZPTA 2IMNA 3BRFA 3G6JB 2E6QA 5B3JF 1FNAA 4KY1L 2EDKA 3SGDI 2D9CA 1ND0A 2MCPH 4KKCD 3V5HB 4Z78A 1LP9B 2YD9A 3I3EA 4FFWD 4IDJL 3GMNA 2EECA 4KTDH 5IQ9A 3UTPE 1IQWH 2F8VA 3TV3L 2WP3T 2FYYB 1U91B 2D7QA 4JFED 5IW6B 4X98A 3A67L 4UOW0 4OB5H 4D94A 5HJ3A 3ARFA 1T89A 2I26N 1F3RB 1BWMA 2BNUB 3EDFA 5EORH 5EFIB 5FV2A 2WLZA 1F58H 1IAKA 2I5YL 1G7QA 4YC2C 3VFUB 4TRPL 4XVJL 4J4PA 2CR3A 1JHTB 4Y0GA 4OGAC 2DLHA 3AB0B 4MB4A 1QA9A 1YEGH 4XNQB 4NRXA 4PJFA 4XAKE 4XWGL 1SYSB 4JRXD 2OYPA 1MRDH 1YC7A 1ZT1B 5IHUL 1FQ9C 4O2CB 3VFNB 2AXGB 3L3JA 4MJIA 4R4FH 3VDBA 1KACB 4UTAH 1FYTB 3O4OC 1J87A 4GSDL 2LABA 5JHDE 1DQDH 4JDZB 4O58L 3HE6D 2QKIB 4U49A 3MRDA 4MCYB 4HIIB 3SDDB 1E4KA 1KPVB 1U36A 5E4EC 3QCTH 1FNGA 5FYJD 3P73B 1I8IB 5IW3A 4Y2DB 5T1LA 4LLDB 15C8L 3JTSB 3ULUF 1J86A 1EUTA 3P11H 5C7XL 1QYGL 3BMVA 5EBWB 1ZHBA 3KDMB 1HDMA 1BZ9A 4RGMB 3PGCA 2PR4L 2QEJA 4ZFOL 3MGOB 4S0TD 4OZHA 2ERJB 4DGIH 3BZEB 2AABH 3KPOB 5HDQH 3GK8H 4M8QA 1UWXH 1NCCH 4ZSOB 1CFBA 1MFDL 1T0NB 5E8EA 3VXUD 3ZT5A 1NANI 4HV8A 2GW5A 4KRNA 4LLWA 5E00A 5KSAA 1YEJL 4GRWH 1AY1L 4GS7B 4Z76A 3VXRA 5D1QB 4PJDA 4YDIH 4WDIA 4YAQB 43C9A 2ZCHH 2O5XH 3RVVC 3BRGC 2X4OA 1OD9A 4HUVB 3WS3A 1W0VB 2QSCL 3GO1L 1ORSA 3QDJA 2MMXA 3MA7A 1OAKH 3GUTA 3NFPB 4XX1E 3EDEA 4URTB 1BZQK 4GO6B 4XCFL 43CAB 1RZGA 5DR5H 3SDYL 2X1WL 4KROB 2FX7L 5IBLC 1CLYL 5KSAC 4DCQA 1PJ9A 1H3UA 3O3EA 1RQ5A 12E8H 2EXYC 2CRMA 5TPWL 1A7PH 2D7TL 3I02A 1NDMA 5AAMA 3F58L 4DW2H 1J8HE 3MJ9L 3OAUH 4N90D 4QTIL 2XQBH 3ZSTA 4L9DA 4JQVC 5EO0A 1W2KT 2BOBA 1X5ZA 2VXUL 4J3XA 1EH9A 4N1CA 1F42A 4M5YL 3UTOA 1HYSC 3RVWC 4U6XB 2EDYA 2F54A 5GJTH 1L0XA 1ZGLA 1QFWH 3QHZH 4KJYB 5J06A 3FOLB 3MLSH 3L3OA 4YH6A 3OJMB 3C09B 1FFOB 1JPGB 2V7NA 5T1MB 1DCLA 2YS4A 4JM2C 4H1LB 1XCTB 2VITA 2F58H 4RBPK 1QOKA 4AK1A 5CEYA 2PXYD 1L4IA 4ENED 4AQSA 4HC1H 3CJJA 2BSED 3EOTH 5ACZA 2DQHL 2MQ3A 5CGTA 4WTZA 3WCYA 1J5OL 1I3RB 4W6XB 4XNYL 5IB2B 3GKZA 1YQVL 4S1SH 3GSQB 2CXKA 3UZEA 2CGRL 3K0WA 3W5NA 1ZLVK 5FKPA 4OFPA 5GSRA 3KPRD 1MOEA 5ETUA 3BZDA 3W39A 2KQNA 1A5FL 1XR9B 4KRPD 3QIUB 2R1XA 1JGVL 4TNVK 1UC6A 4UIMA 4DVRL 3S8WA 4KMTL 4PGEB 3AROA 5SWQB 2XACC 3DRTA 1MFEH 1KB5B 3QXWA 2V2TB 3CSYA 4NQCD 1R3LB 4HGMA 1I9IH 3O8XB 1U8KB 5SWZD 1BBJB 3U4AA 1MCJA 1RUQH 4H8WC 3GMPA 5T33L 2QQLL 1LE5A 2B1AH 4OCLC 1H3PH 4MAUL 4JY4B 1FNLA 4ZO6A 4CGTA 5FYKU 2NY0C 3NAAL 1LO2L 4Z7VE 3EJZD 4OUOA 1OPGL 4NGHL 3QQ4B 4I48B 5D7KD 2APBA 2F15A 2VLLA 3PP3K 4GOSA 1ZTXH 3TIEA 3RKDD 1XAUA 4PJIF 1A4JA 4M7JL 5EZJA 3EOAA 2C1PB 3Q1SL 5L0QB 1I9EA 3D3VA 2UVEA 2AEQH 4ONHB 4PV8A 4JHWH 4N5UA 1GZQA 1R24B 3EO0A 5B8CB 2C7UB 1RULL 1LO4L 3TP4A 4PY7B 5L2KE 2D7MA 4KU1A 1YDPA 1AE6H 1A1OB 4MD5B 5E5MA 5BS0E 4ZD3L 1XF5A 4U4BA 3BDXA 1EJOL 3DXAE 5D2LE 1XGRA 1WAAE