2GY7B

Angiopoietin-2/tie2 complex crystal structure
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
423
structure length
423
Chain Sequence
AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIPRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Angiopoietin-2
publication title Crystal structures of the Tie2 receptor ectodomain and the angiopoietin-2-Tie2 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 77
structure length 423
sequence length 423
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10430 Ig_Tie2_1 Tie-2 Ig-like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gy7B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gy7B04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gy7B02
2.170.300.10 Mainly Beta Beta Complex Tie2 ligand-binding domain fold Tie2 ligand-binding domain superfamily 2gy7B03
2GSGB 2ICCA 5D70H 1CFBA 3D69A 3VG9B 2Q7NA 4JY4B 1I3RB 2EDQA 2VQ1A 3EYFB 1H5BA 3OHXB 4MAYC 5D1ZA 3RGVD 1G9NH 2FO4B 5CILL 5KOMC 3U1SH 4URTB 1MUJA 1QFUH 4ZAKD 5ANMA 3MLRH 2EDNA 2P5WD 2V9TA 2PYFA 5C09E 5J89A 1UQSB 3QIUA 4HJGA 5J8OA 5T3XE 5INDA 3OTTA 5F7EL 4Z7WF 4OGAD 2DICA 3IDJB 5J12C 2BERA 4XMKH 4YO0A 3Q5TA 4GXUN 4ODUA 2FH6A 1MOEA 3DXAE 4XC1L 4YXLL 4CRPA 1HQ4A 3PV6B 2B39A 1A21A 3VFTA 3WIIH 4PRBB 4UV4L 5B21A 1DQQB 2NY3C 3SDDB 3UBXA 3WD5H 3D18A 4WV1A 3TH2T 3K7UA 4NQCE 1TETL 1JHKL 2NXYD 1OPGH 1N7MH 4OZFG 5FYKL 5I8KH 2IPUK 2RGSA 3O6FB 3P11H 4XC3L 4LQFL 1A64A 1QRNA 3MXVL 4Q0XH 3ZKQD 4AEHH 4N0UA 3QUMB 4UT7H 4YBLC 4I13B 1BBJA 1RK1B 1NCBL 1A02N 5JIPA 5B8CB 3PE9A 4P48A 3TV3H 4QRQA 3G6JB 1VESA 4L4TA 5DSCA 3E6HA 1RV6X 5DHVB 5DA4A 5IW6A 4ZUSA 4JFDD 2DQUH 4FXGA 4CN6A 5I8CA 1DQLL 1NEZG 2VXVH 2HJKB 1HN1A 2YZ8A 1BLNB 5D8JH 4ZOEA 4EVNB 1CIUA 3CUPB 3MRFA 4RFEA 3IJYB 1I8MA 4F7TB 2WP3T 3I50H 3T0WA 4U1JB 3ZO0A 5JOFA 1MAML 4DGYH 4KKBC 1KCRH 1OGAA 4O5LL 5E95B 3EDJA 1MRCH 3G9AB 1K4CA 2KDGA 5FM5O 4S1SL 3SKMB 1EEZB 5E99L 1SJEA 4Z7WA 1I3GL 3N1MC 2R4RH 4JRXB 2C3GA 2ZUVA 3X3GL 4D9QD 1VFBB 2PNDA 5I8EB 4MA1C 5CEZE 3WLBA 1XGPA 3QIBB 4JN2A 4P5KB 3MTRA 1BWMA 4NZTH 1A6TA 2N4IA 3D39B 1JYVA 3SN6N 4Y1AD 4Q6YA 1OW0A 5EUKA 4ERSH 3V9FA 1IM9D 2VLRA 3VH8G 1DE4B 4NZRL 4ONFL 3QCVH 3LV3A 1A7NL 1G7IA 3MBXL 5IBUB 1ZVHA 4KKAC 2VXSH 4GKSA 3OPZH 4KJQD 3N9GH 2A0LD 4X9GA 4I1NB 1WISA 5D7LB 3T0AA 3FQNB 1H15A 2XQBL 1CK0L 1QQDB 1UJTA 1P6AB 1GH7A 1I9RH 5D1QD 3V95A 5DJDB 3PNWA 1JNLL 3RU8L 4LLUA 2DM4A 5K93A 35C8L 2R2BA 1K6QH 1JPTH 43C9A 3C2AL 1R3JA 1X7QA 2Z4QA 3TA3D 3EOAB 4XCCH 1RD6A 4LNVA 1SY6L 1NCTA 3MMEA 1W72L 3IDUA 4X7FC 4MXVE 1NUNB 4OT1H 4YHLL 1YYLH 1U8JB 2YK1H 5AWNH 1LO5B 1D5ZA 3BUTA 3LEXB 3BQUC 5KTEH 2BVOB 1YY9C 3HG1B 5A16B 3DHMA 4UILH 1U92B 4P5MB 3TH3T 3PWUA 3CSGA 4XHJD 3U6RB 4KUZL 3ECBB 3B43A 1FFQA 4JANA 2W0FA 1W72A 3WKML 4G6AD 4ALAH 4GRWF 1N0XL 3U46A 1NQBA 3UDWC 1Z5LB 1FPTH 4WFFD 5IROA 4JFHD 1AO7E 5EOCJ 3QUZB 2AXGA 4LRIC 5E94B 1OAQL 2E7LC 4LLWB 4OCMC 1Q9KB 1TLKA 1C08A 1S7UB 3EDKA 1NGPL 2ZZUT 4GAYA 4LSQH 3CDYA 5DQDH 3GMNB 4LVHC 5FYJU 3TH4T 3ILPA 1V7ML 1RZ7H 3HI6L 1U8PB 1PZUB 2C3WA 3RTQC 4JM2B 3M07A 2DBLH 4MGXA 4HC1H 1MI5E 1FZOB 1UH2A 1MIML 4KK9C 4U6YB 4UTBH 3ZDZE 1KJMA 3FQUB 5C0GB 2D03H 1F6AB 1NCWH 2VAJA 3T3PE 2ZCHH 1T2XA 5CZVL 4GRMA 1J18A 4I0KA 2W0KA 5I1GH 2EXWC 1EAPB 1OTUD 2X4RA 1NDGB 4ODTH 3MYJA 2XRAH 1PW3A 4LGPB 1LO2H 4WW1A 1GGBL 1YJDL 4X6DA 2Y72A 4K3JH 2WWMD 4IOIB 3PWVB 1IC5H 3TIEB 5F7NC 1B90A 1IGCL 4XNMA 1IGYB 3OQ3B 3T04D 3W2DH 1MFNA 1P2CB 3AY4C 4X8XA 5L9DL 2ENYA 2P8MA 2BOBB 3MV8D 5I16A 5IR1A 1E27A 4MJIA 4YIQA 1UWXK 3S3JA 5KSBB 2DLGA 3DX7B 5SWZA 2DQFB 3QUKB 5HVFB 2HH0H 3HHRB 3PUCA 2DQTL 1DLFL 4WO4B 1DLHA 2ZSVA 4HZLA 4TSBH 1U8KB 3MV9A 1UXWB 4OFKA 3C8KA 4XXCC 5AUMB 2UWEA 3BP6B 5C1MB 3NIGE 4LPTA 4QYOA 4MCYA 3CVIH 1WZLA 3O4LB 1I1AD 4L9LA 5F97E 1TNMA 5C09D 2NLJB 5T3XD 3BGMA 3AB0B 1YECH 4EUPH 5F7MC 3VRIA 1NCUA 2QTEA 3O6KH 4KJPD 1H9VA 4L4VB 3VXUA 4NO0D 1UB6B 3IS0X 3CU1A 2XKSA 5MP6H 2EXYD 4KPHH 4JQXA 3Q1SH 1QBMH 3BO8A 3WS6C 2DQDL 2CIKB 4JFFD 5I66A 4P57A 5KSAC 4RFNB 1VGKB 1U95B 3RUGB 1GC1L 3W5NA 1FNLA 1SBBA 4YHIA 5EO1B 3KPRA 3L7FB 4HPYH 4NQCD 1VFOA 3DV6B 4FFVD 4JO1L 1P9MC 5HHVH 1ZANL 1LEKB 5D7JA 3SE3A 3DMMA 2I60L 1F97A 2AJXL 3P0YH 3QFJB 4Z7VE 4NDMB 4QCIA 5EFIB 4TULL 3OB0H 1QSEE 3DUUB 4U6VL 1BEYL 1FIEA 1K2DA 5CHNA 4M1GH 1XCQB 5DT1H 3HE7B 1QLRA 1NMBH 2CIIB 4PJ9A 5TPWH 3MODL 1UWGL 4M3JA 5CJ5A 5E2WL 2NXZB 4M7ZC 2VZOA 5IP4A 2MCPH 2HN7B 1JN6A 2MNUA 4MA8H 4M5ZH 2JIXD 4MX7A 3T2NL 1G9MH 4TTGA 5LKNA 3H3KA 1IKNC 3QEGH 4YGVA 5J6GA 4MWFB 3KPOB 3B2VL 4Y8DC 1AGCA 4MB3A 1H3TA 3NGBC 3HB3D 3GMRB 4YDJA 3UTPE 5EZOH 3CC5A 1AD0B 2BCKA 1CICA 3FRUA 3WIHL 2D0GA 4LSSL 3OR6A 3LDBC 4AQSA 4GBXC 3BRDA 1J1PL 1Z9LA 3E2HB 4OFDA 4RISL 3IYLW 2HLFD 3DECA 4G43B 4PJ8D 5E2JA 3V0VB 1X9QA 4OCYH 4RZCB 5DLML 2YD3A 5LWYL 2X1XR 4PREB 2VDKL 3AXLB 4U1IA 3MRKB 4YNYA 5JDSB 3S35X 2FX7H 3FCTA 3WCYA 5HPMA 4MMZC 1U93B 1H3GA 4TSCH 3IFLL 2XOTA 1YQVL 1QKZL 4M03A 1FFRA 3ES6A 3OKKB 1JWSA 2FRGP 1IGFL 4JZJC 4GS7B 3G08A 2G5BA 3V6ZA 1IBGH 4L1DA 2YPLD 3K8KA 1FZJA 4MB4A 4M7JL 4NO5B 5LGHL 2EYSB 3MO1A 4OAWA 2J6EL 1FLRL 1F4WL 5D2NC 5F1KC 3OXSB 3VFRA 3EHBC 3JTTB 1AJ7H 4UQ3B 3ROLB 1RIUH 2P5EB 4GRLB 1S3KH 3V5KA 4CL7A 4L8SB 3LCYA 1A1NB 5CJXA 3EYUL 4NNXB 1RZKH 4C4KO 5BZWA 4YK4B 3S36X 4X7DC 5IMLB 3WNKA 1Q9WB 4K3DH 5GISL 4RRPG 4YEEA 5FYLE 3EZJB 1AY1L 4G9FA 2VE6B 4L8DB 5ILTL 4L8BB 2HJLB 4QRPA 4LOUD 2XZAH 4XNYL 2H32B 2NZIA 5CUSH 4Z7OE 4B5EA 1HI6B 1VACA 1J8HD 3GBMH 1FYHB 1CG9A 5IKCB 3I6GA 2Y6SC 1WICA 2EEDA 4QTIL 4JQIL 5DWUL 2A6KB 1ZGLA 1BIIA 2BX5A 1AO7B 1MLBA 2HVJA 1MI5D 3EFFB 1GGYA 4X4YA 3N1GC 1VFAB 1E6JL 2DRUA 4EEEA 3HPLB 1CLOH 4Z6AT 3STZA 1MWAB 3SGDI 1A4KB 4PJGA 3W39A 4E42A 1MFAL 3DNKA 4M8QB 3MACL 3WJLC 2CLZB 3SQOH 4FTVE 3T08A 4QWWD 1FG2A 4BJLA 5JTWA 5EBGA 1DN0B 3TBVB 1TJHH 4UUJA 3IU4L 3QUMH 1KOAA 2V7HB 2HRPH 5JQ6L 1MELA 3V7MA 3HC4H 4ZPTB 4UQ2B 2BDNH 5HI3C 4JAMB 4QRUA 1XZ0B 4RWHA 3I9GH 5ESVB 4NKIL 1E4XH 1RMFL 3FOLA 4R90H 2MKWA 5DHVH 3T1WA 1U36A 1G0YR 1JZ6A 4WW2B 2XWBB 1KLFA 4OD2A 4LCWA 4G80A 5JXAL 2OQJB 5F9OL 1E4KA 1CXLA 4K8RD 5TFSH 4XB8A 2WLZA 2R39A 4LNRA 3OAUH 1T7ZA 4Z0XB 4I0PB 1BPVA 1A7QH 5DRNA 2AAVA 3D87B 3HMWH 4OCNC 3U9UB 1IAKB 5BZDA 4LLYA 3LSOA 2XPGA 3HCVB 1T89A 3TO2A 3HI1A 5KSVB 2OZ4H 1NKRA 3QCTL 5IWLC 3GUTA 1IGML 5EU4B 5BV7B 3PHOB 1BBDL 3MBEB 1NCAH 1LO4H 1FVEB 5TDPA 5FYJL 4PJCF 5EU5A 2B0SL 4JJ5B 4S1RH 3MLUL 2IAND 2VLKD 3LKRA 3RL2B 1PEZA 5HYJE 4HKXB 4NN7C 3UTTA 4D8PB 1U3HA 3BVNB 5SV3A 3WHXA 4HJ0D 2HVKB 2PO6D 3EO0A 4RFOL 4R7DB 3MRLB 4LHUG 4ZSOE 1KJ3H 1MJ7L 2PYEA 2LAGB 2HRLA 4KU1A 1BAFL 4KVNH 2PTTB 5DDHA 3MJ8A 1QSED 5F9JB 1D5IL 1WTLA 5GJSL 5DRXA 3T1FA 5I74C 2R1WB 1S7TB 4MSWA 4N0YH 3BZ4A 2G60L 2RBLA 4M4RA 2CXKA 3CDGB 4NCDA 1QBAA 1HHGB 4JREB 2BXZA 5KVDL 2PKDA 4KDVA 4Y4HD 1UVQA 2Z8VC 4ZFFB 3RBGA 3QI9D 1JWMB 4QF1B 5GGSB 2R0LL 4IRSB 4PJFB 1CBVH 4LSPL 5FV2A 3OKOB 1YN6A 4LLDB 1FN4B 5F89B 5ESAA 4HH8A 3FB5B 2ZG3A 5CZXD 1OY3B 4XH2B 3QIWC 3ULVC 3PL6D 1A9BB 4JRYD 2BOCB 1CL7I 5BS0E 4UIKH 1N59B 4LDLB 3HUJA 1T4KA 2KUTA 4LSRL 4NKMB 4YHML 2J5LB 5K9QI 3KXFE 5IB1B 3MRHB 4NKDB 4X5XB 3DURA 2VSDA 5TF0A 4X9HA 3UTPD 1MAJA 1KPVA 5ADOH 3ESUF 3F58L 1KEML 3ARGA 2X4OB 4PJCA 1GGCL 3L3OB 1GL4B 4UT9L 3BAEH 3VI3F 3C5JA 4C56D 3NCYP 1LP9A 4BSWA 4ETQA 4RIRA 3DGGA 4P2QB 5C0DA 5LQBH 3B9KA 4JFQA 1RHFA 4R0LB 4IS6A 4MA3B 5D70L 1ED3A 5CKGA 5D5MF 3QPQC 3ARVA 2EDFA 4HMEA 1G9NL 4XPBH 3MJ7B 1AGEB 5K9JH 2DKUA 5HVWA 2NY0D 3U1SL 5GS0D 1QFUL 4RSVA 5DTFA 5CS7A 3MLRL 4NFDA 1XF4B 3MROA 1I1FB 4LKXB 3O41A 1Y6KR 3IVKA 2ICEA 4ZDHA 1NC2B 4WFHE 1PY4A 1FZMB 5DK2B 1T1WA 1NUFA 4XMKL 5C0NC 3M17A 1OD9A 3V5HA 4PJ5E 4UT6H 4ZUWB 2E9JA 3PQYB 4HS6A 4U2ZA 3RDTC 3QQ9C 1IQDB 4MZ3A 2HLAA 4HWZA 3ARFD 3X12A 3QG7H 5F7UA 4JGMA 1CXHA 3PDOA 1CFQA 3WIIL 5SWSA 1CU4H 2D7PA 1RJLA 2J8OA 2J8UF 4YX2H 4G8FB 1PEWA 2AJZA 1OPGL 2FX8H 4B7LA 1N7ML 5I8KL 4AM0A 3P11L 1WWCA 4K9EC 5DMYA 4OCWH 3P4OA 3QO1B 4F15B 4Q0XL 3H3PH 4AEHL 3H9ZA 4QLRA 4DGIH 3QP3A 4UT7L 1XGUA 3TJEH 4G8GA 1MFBH 4KHTH 3NFPA 4AENB 3QNYA 4RAVB 5T33H 4JO4H 3FQTA 4NNYB 1XR9B 3TV3L 4P46D 3OKLB 4RDQG 4APQB 2DQUL 4PJBF 3C9NA 3VD7A 2X9WA 2VXVL 4KY1H 4WJ5A 5D8JL 2CK0H 2EYTB 4LVNB 2X70A 2VERN 3V52H 4N90E 1KLGB 1ORSA 1A6ZA 1MNUH 1JNHB 3I50L 4MAYD 3DO7B 4WUUA 4PLKC 2DN7A 4DGYL 1KCRL 1KTRL 4NQXB 1PG7W 2E9BA 3ZHDA 1BQHA 1XGQB 1AR1D 3CFIC 1MRCL 3W0WA 4F7CB 1JL8A 2XTJC 3ILQD 3OSKA 1JWUA 4V2CB 2R4RL 2ZCKH 1WC7B 5F8RC 4RQQB 1DEEA 1JNNH 4ZS6C 3RPKA 4NZTL 1NDMB 2DYPA 3GM8A 1IGJA 4GW4B 3BD5A 4H8WH 3LRSA 4AT6A 4ERSL 2JE8A 2EDXA 4FTVB 4UDUB 4EN3B 4CW1A 4U0RC 1QRKA 2JJTA 2EDDA 2P8LA 3QCVL 3EUUA 2J8UA 4AJ0A 3O8XC 2VXSL 3OPZL 1UB5A 4HS8H 3N9GL 3HN3A 5EIIA 3BP5A 4HX1A 4KROC 4LPCA 3MLPA 1R3LB 1MCCA 1BQSA 1AGBA 3LZFH 1AIFB 5FKPA 1EHLH 3D3VA 1I85A 2XXMB 1I9RL 1RPQA 4Y16D 5DRZA 4WFGE 1CDIA 1FJ1B 1ZS8B 2VIRB 5D7IF 2AK4D 2VLJE 1K6QL 3KNBB 1JPTL 3GSWB 2XWTA 1A6PA 5F88B 4HIJA 3MOBH 3QZWG 4XCCL 3TNMB 4ELME 3T77A 1KTDB 1V3JA 5K33A 2OK0H 4KVCH 4OT1L 1YYLL 2YK1L 5AWNL 1U8OB 5KTEL 3VFVA 5HYJD 4UILL 3KPPA 2FECI 1YUHB 4X7TB 4YAQA 4OTXH 1KBGH 3S4SA 1DSFH 4H26A 1NSNH 4ALAL 1JYNA 1AXTH 5CCKH 5CEZH 2Z35A 4X9IA 3FONA 4YBLB 4PJXE 3VE0A 1FPTL 5DZOA 1KCSH 1PYWB 4X4ZA 5C0EA 4UZGA 5CMAB 5CBAA 3P4LA 3QQ3B 2G75B 5DHXB 1R3IL 5IMOA 4Z7UE 2XACC 3WFCH 3BISA 5F1IB 1I7TB 2Y5EA 4LSQL 5DQDL 1KN2H 2Q7YB 2FYYB 3IS1X 4ODBD 4F37F 5GS1A 4Y19A 3SDXA 5I1JH 4LKCB 1RZ7L 1P7QB 1MFCH 4HH9A 1DVFA 1J0YA 3PGCB 2P24A 1G7JB 3DYPA 2DBLL 3IXTA 1AQDA 1KB5A 4HC1L 5DJCB 3UTSD 1NGXA 3VFOA 4UTBL 3QXDB 1C5BH 1J87A 2FECL 3LN4A 1B0GA 2D03L 4TVPE 5FF6B 4F2MB 1NCWL 3SKOB 4BZYA 1HH6B 2ZCHL 4MA1B 5C0BD 3ESVF 4M9PA 5I1GL 3KXFD 5DMKA 2MWCA 2ED8A 4ODTL 5F7DB 2XKUA 2XRAL 1LEGB 1LO2L 1ZVSA 4NNPH 4OZIF 4K3JL 1M7IA 4AQOA 1IC5L 4IEFB 5ID0A 2H2PC 4Z7QF 2H32H 5EBMA 3VFWB 3O3DB 1EJ6A 3W2DL 3UJIH 1INQB 5BS0B 1NL0H 5D2NE 4N8VB 3SPVB 1OP5H 3BQUD 2PXYC 3KYOA 1INEH 3G9VA 1UH4A 4E0RA 2XV6B 5L7XH 1PG7H 5FDYA 2HH0L 3FHQA 4PPTA 1QEWA 3CH1B 3TN0C 3BMWA 3EOBB 4TSBL 1XF3B 5KS9E 3V6BR 4ZQKB 1I7RA 1KTKE 3WO3B 1FGVH 3ARBB 1L7IH 4N1EA 4XVTL 2HYMA 5I1LA 2GI7A 4N9GA 4KK6D 5EORH 4KKCD 4PS4H 4O2EA 3S5LB 1E28A 5K9KA 3TWCH 3UTOA 1AXSA 1YECL 5J4MA 4I2XA 4BQ6A 4WFHD 5ITFA 1CFTA 3O6KL 1JK8B 2HT3D 4ODWB 4PJAE 5MP6L 4XI5D 5HHMD 2A74A 3CCHB 2JCCA 1BD2A 3RIFF 3QH3A 4KPHL 5B3JF 2DF3A 5JXEA 3Q1SL 1QBML 5JPNA 3OV6A 4YLQT 4J4PD 1FHGA 4X8JA 1YJDC 5E2UH 2FIKA 3B8YA 3O45A 12E8H 5C2BH 3FRPA 1U2HA 2BSRA 3BKMH 4X6BB 2YBRB 3G04B 4HPYL 3GJFB 2VXUH 2NY2D 1WVZA 3OB8A 5JW5B 3VD4A 5HHVL 1IC7H 3O11A 3JVGA 4LVHB 5HGBB 1J1XH 2GUOA 4OI9A 4R97C 4OFVA 3SJVA 1MHEB 3P0YL 4PJ5B 2DMBA 2HJFB 3RTQB 2ADGA 1KUMA 1TTFA 3SDAA 4C54A 5IMKB 4J3SA 2VISA 2FR4B 4JFEE 4M1GL 2VO5A 4W4NA 5BV7H 1QBBA 1HYRC 4MNGB 5DT1L 1CWVA 1NMBL 1T04B 3I3DA 4ZXBA 2BNQA 1I9JH 5TPWL 3UTZB 3WUWG 3EGSA 1X5IA 1Q72H 3N1PC 4PJ7B 5CSZB 2BMKB 3UX9B 3T4AA 3RGHA 2BSSA 4Y2DA 3TBWB 2CD0A 3IDGA 2G2RB 2MCPL 4GOSA 2EC9T 4RGND 2OL3A 1TQCC 3OJDA 4MA8L 4M5ZL 4N90D 5GRXG 3SY0A 5I1DA 1G9ML 2IH1B 5LAXA 1NFDA 4GG6A 4EI5D 5L2KB 3ZYIA 3QEGL 3FQRA 5HHOD 2CLRA 3MNWA 1AHWC 3MRBA 4NOFA 1K8DB 2WBKA 2Q3AA 3AM8A 4O51B 5KANI 1EA9C 5C0IB 2YZ1A 5EZOL 2W60B 4PG9A 4H25A 4FQ1H 1S7WA 5E4EC 3DHJA 3D25A 1CDHA 1EMTH 1HHIB 3NOIA 1NAMB 1W0WB 5DQ9A 4OCYL 4OF3A 5KZCD 4H5SB 3L3JB 1FNGB 5KSAD 4HEME 2FX7L 3FFCE 1BGXH 4M62H 1DBJH 3RGVB 4Y5VA 4TSCL 2AXFB 2C1OB 5MEQB 1F42A 4CVXA 1I1RA 5C8JB 2ARJB 2C3VB 4MCZA 4ELKB 2B1AH 4ZAKB 3L3HB 5C0JA 2AERT 2P5WB 3MA9H 4X6EA 3K2UH 3VGAC 4PJHA 1IBGL 1F3DJ 4M48H 5CEXA 2ZOKA 1ZLVK 4B41A 4D0CB 2H3NB 1EUTA 1LK3H 2IAMA 1KPRA 3QG6A 1SYVA 3IDYC 5EU6A 1DBKH 5BMFH 3MV7D 3QWOA 3N06B 3WFHA 2C4FT 2NY6C 1AJ7L 3PXHA 3P9MB 4Z76B 1RIUL 1S3KL 3NZHH 1JGEB 3P4MB 4YHPB 4JPKH 3QXAA 3AMKA 1AQKH 5E6IB 2A6DA 1RZKL 3ULVE 2AQ3A 1NMCB 3BI9X 2VLJB 1LE9B 2NXYB 4K94H 1ZTXH 2ESVE 3G6JF 5DVLA 5JA9A 1A2YB 2BC4A 4K3DL 3GZKA 1IGTA 4OLXH 1S9KC 1BFSA 4WU7B 3KDMA 2DI8A 5HYSA 2GJJA 4RAUA 4Z78B 2WK2A 3JWDH 5D1XC 3E6FB 3FT2B 2FSEB 4M7ZB 1WF5A 1A6WH 4HGKC 2XZAL 1ROWA 5CUSL 1K9TA 4KK8C 3GBML 3IF1A 5C0CA 4X0KA 4U1LA 4PJXB 3GSRA 4CGTA 4XTRD 5IQ9B 3REWA 1T22A 3CDFA 3R4DA 5EO9B 2V2WB 2W65B 1G7LA 4OJFH 4MZ2A 5AYUH 2CLVB 4XX1G 4TVPD 3GHEH 4UMGA 3OAZK 5D71H 2XKNA 4MJ6B 1J0JA 3OGCA 1EUUA 1FV1B 3SQOL 3LPGA 4GBXB 4C83A 1XR8A 3QNXB 1FZKA 3MFFA 1MLCB 1RIVH 3WIFA 4DUXA 1TJHL 5C70A 2YHGA 3FO0H 3QUML 3WNPA 1IC1A 2HRPL 3ZKXC 1MJ8H 2H6PA 2BDNL 4PRDA 2CJUH 1PKQA 1GOHA 4Y1AB 3DYOA 2LVCA 3I9GL 3L5IA 3EHBD 1E4XL 4R90L 2D31A 2ITCB 1RK0B 3ZT7A 5FYLH 4LPUA 3G6AB 3TZVD 3BKYH 3T0EB 1P1ZB 2ZP0T 3FFDA 4JZJB 5DR5H 5F44A 4AEIH 5DC4B 2BFVL 4I5BA 4U6XB 1T21A 4YBQC 2EDHA 4ZPVA 1X4XA 4L3CB 3KGRA 4NRYB 2EIEA 3O9WB 5CWSA 2BVQA 5SX4H 3V8OA 1R5VB 1M1SA 2XQYK 5IB2B 4GJTB 2QR0A 5EC2A 5D1QB 5EB9A 4TSAL 1KEGH 1NFIA 1A7QL 4UNTA 5D2NB 4KWUA 2NW3A 3BN3B 2M2DA 2R1YA 4TUOA 1U8NA 1A3LH 2GJ6E 3KG5A 3DO3A 3HMWL 1KIPA 2A73B 3HPJA 3CFBB 3D0LA 1S7VB 4NQDE 4P2OC 1ZGLP 3MRCB 5ISZE 5EZLA 2OZ4L 2VR9A 3IXAB 4PRPE 1HEZB 4YDVB 1R3HB 4WWKD 1GOFA 2AJ3B 1M71A 5JZ7D 1NCAL 1YNTA 4F9LC 4JFDA 1LO4L 4S1RL 2FJGA 1G7HA 4Y4FD 3TBYA 2OZ4A 1RIHH 2B4CC 2G9HB 3MR9B 5EZJA 5EO0B 4XP9H 2HMIC 4U1MA 4ZFOA 2X40A 4A6YB 4HIIA 1RZIB 5DK0B 4KRPC 4LBEB 4JM2F 1NJ9B 1KJ3L 1ZT7A 1VDGA 4NRZA 2EDYA 4J7RA 2RAMA 1AKJD 4KVNL 1QOKA 4I77H 1MVUB 2XTJE 4HULB 2ZNXA 2F19H 4JFED 4N0YL 5F7WC 5HGAA 2YC1A 3U9PH 2D7NA 3DARA 2DKMA 1Z9OA 3LKNB 1IM9A 1INDH 3NABH 3RFZC 4LARH 1CBVL 3IJHB 1IM3A 4M9OA 5DJ6B 5B4MC 3RP1A 2X9YA 4ODHH 5DQJA 1P84K 4QHMB 4WIQA 2IF7A 2GSIA 4XWOC 3BD3A 3T0VA 1A7RL 3VXSB 4HUVA 4UIKL 1HXMB 1VKXA 3C5SB 4MD0B 4HMCA 3TCLA 3GMOB 4NWTH 3D2UD 4OZ4B 1OAUH 4NBXB 4QHKI 5EA0H 5KSBF 4R4ND 3TA3A 2GFBA 2LFGA 4MNQB 5ADOL 3L5WA 3BP7B 1T1ZA 1FCCA 1JGDA 3BPCB 4EDXA 3CZFA 4CDGC 3BAEL 4PJIA 3DSNA 4JG0H 4Y4KC 4NN5B 3CJJA 3WE6A 2RIKA 3MOQA 1WIPA 1YN7A 4Z77A 5LQBL 3FFCD 4R96B 5IW1A 1X5AA 4P5TB 4NBYB 5DEGB 4ISVB 3ME0A 3SHSA 2Z0BA 4KUCD 1F00I 3LEYH 5IV2A 3VWJC 5JW4R 1ZT4A 4OIIH 2R0ZH 4OZFB 1G7QA 4PBVC 4XPBL 3T65A 5K9JL 2F53D 2K3TA 1LGVA 3I85A 3HR5A 1UJ3A 1HSAB 4HGWA 5IT2H 3FT3B 3RUGF 4E5XB 1DANT 4QHLA 3BKJH 2A9NH 4NN7B 3RZCC 4G6FD 4DVBA 3RY6A 3UYRH 1OLLA 4FABH 3E0GA 1IE5A 5I17A 3V4PH 1EXUA 1EO5A 4UT6L 2GAZB 3ISWA 4OGXH 4ZO9A 3D9AH 2IH3A 3QIWD 1M7DA 3QG7L 3KJ4B 3VRJA 4CN4A 4OZHB 1CU4L 3F8UB 5I74B 2ESVD 3IRZA 4YX2L 1WK0A 3HRZB 2X7LA 4X98B 5FEBA 3CU7A 2FX8L 4GUPB 2H45A 4LCCB 4EI6A 5FM5M 3GM0A 4KDWA 1YEDB 3CMOH 4OCWL 2WINA 4DUVA 3EJZC 4DGIL 4DW2H 3TJEL 1MFBL 3BIBX 4KHTL 2YSSB 2ADJB 2QSQA 5ICZA 2OTUA 3AMLA 5T33L 4JO4L 3F12A 3MV8A 1A3RH 1F4XH 1EFXD 3OKDB 4OKVA 4P3DB 2AV7A 5C6TH 3VH8B 2KPNA 4IIQC 5KVFH 4WI8A 3MCG1 3UPRB 3GO1H 3BGAA 4QY8A 3OXRB 5MERB 2MHAA 4KY1L 3LB6C 3AAZB 2CK0L 4KHXH 3TGXA 5MEOA 3L7EA 4QHUA 3GJFH 4H0HB 5T1LB 3V52L 5T3XL 1MNUL 3W5MA 1S78C 3PWPE 3QPQD 5GJTH 5A1AA 3OR7A 4IRJB 1MJJA 2IQ9H 3WO4C 3QA3B 1I1AA 1CFSA 3CFKB 5C09A 4HIEA 2CDFB 2HFGH 3QFDA 2ATPA 4Y8AA 4BYHA 3QJFB 1OAKH 4XNQA 2ZCKL 2PCPB 1MVFA 3A6OA 4NO0A 4YWGH 4PG2A 1JNNL 1AP2B 5GGTH 3ROOB 3I02A 3DXAA 5C0ND 4KMQA 4XBPB 1ZHLA 4H8WL 3MUGA 3MX0A 5E6YA 2Y7QB 2Z8RA 5HD8C 3QO0A 4QRSA 5LGKA 4JFFA 3PWLB 4UIMB 4E41B 2X1PA 1FVDB 4UTAH 1WBZA 5ESQA 2YXMA 2BY1A 5EC1B 3RJQB 4XAKD 3VXRD 4PY8I 4NQCA 1WJ3A 5E8OB 5L8LB 4XPGH 4XMLH 2ZUQC 3RVTC 2VZVA 1TZHA 4Y5YA 3LZFL 4ZYKA 1EHLL 3L5HA 4L29B 3RNQB 1I75A 1BJMA 1Q0YH 2EDOA 1VA9A 2CDGB 1F2XK 3HLAB 4PV9B 4X4XA 2X4NB 1KCKA 2HTLD 5C3LD 3PIQA 4NQDD 3C5ZA 5ISZD 4WGVB 1S7QA 3MOBL 5FECB 4PRPD 1U58A 1NAMH 4M61A 1LDPH 1K5NA 2DM7A 4PB9H 3AROA 1AI1H 4KVCL 4RMQA 5F6HI 2XN9B 4BK4A 2OK0L 4MXVF 1N4XH 4JPWH 2L7UA 4Q6IC 4BFBD 5I1AA 3M1BB 2D4FA 4NHUB 4W6WB 4PJEB 4OTXL 1KBGL 2JIXA 1DSFL 2O5ZH 4FG6D 1NSNL 1AXTL 5CCKL 5CEZL 5IEHA 5TE6H 4OQTA 4PLKD 1KGCE 4G6JH 1UZ8A 1VEOA 1KCSL 4KDTA 3MC0A 1KIQA 4UDTA 1FL6A 5FB8A 2DJSA 3JWNC 4L1HA 4NRXA 1WIUA 3ZE1E 1I9IH 4F7EA 1RURH 2E27H 4FFWC 4PUBH 1KIRA 4HLJA 3SE9H 1RAMA 1U8IB 3WFCL 4NKOA 1QRND 1HYSC 3TT3H 4KZDH 1UH3A 3IETB 1KN2L 4BQBA 2E5EA 4ZS6D 1KLUA 4BH7A 4PJ8A 3V7AE 4CDHA 5I1JL 1FC1A 1ONQB 1WLHA 1MFCL 3IKCA 5FYKD 4ODXA 4YJZL 1NGYA 4K71B 3OF6D 1IEHA 5FO7A 1UXSB 3QXWA 3F7RA 1XH3B 1OTTC 1LK2B 1I8IA 2XA3A 3REVA 4P23D 1C5BL 2OR8A 2QEJA 5DMIH 3ZDZF 5I0DA 1VPOH 4JKLA 3T8XA 3L5XH 2E6PA 1KV3A 1CGSL 2W0PA 2DM2A 4OSUH 2O61A 2P46B 1YEIL 3MA7B 4WW2F 3OG4B 5CZKA 3EYVA 4NNPL 2YPLA 1P5UA 4OFYD 2NY1B 2EEAA 3Q3GA 2APXA 3P9LB 1G6RH 1ZWIB 2C1PB 2CKBA 1JHLH 3VRLE 1KYOJ 5E1AB 3O8XB 1T0MA 3UJIL 4N1HB 1BMGA 1NL0L 4KROB 1OB1B 3STLA 4OIBA 1JPSH 1D5BA 1INEL 4LVOB 2VR5A 4YHYB 1DQMH 1AGDA 4QOKE 5L7XL 3MRPB 2HT2C 1FORH 1CE6A 1PG7L 2AV1A 1FL5B 3Q48A 3GSVA 4GKNB 2V2TB 2IBGA 5D7KD 1DQTA 5FGSA 3QDGB 8FABB 4OGZA 5AAMA 3KPMA 3AVEA 3TJHC 1B0RB 1FGVL 3DI3B 5F1SA 1L7IL 4FQIH 5IFJA 3MNVB 5EORL 3N1FC 3RVXC 3SDYH 4JG1H 2DKSA 4GFTB 5DGRA 3TWCL 1E4WH 2OP4H 1J8HA 1MHCB 1TJIH 1YMMB 3VJ6B 2GCYA 1MI5A 3C60D 4PRHE 3CVHH 4LPXA 1XIWC 3FTGA 3OB0K 1K3ZA 3T0DA 3WN5B 5E2UL 1RFDH 2GTWA 12E8L 1XCTA 4NYLA 5C2BL 3TFKC 3MRIB 3BKML 1CS6A 2GTZA 2LV4A 1KPUB 2X4QA 2VXUL 2Y9RT 3H9HA 1IC7L 3O3AA 5IB3B 4DN4H 1J1XL 2KQNA 3RX5A 4HDIA 1TCMA 1JFQH 1U91B 3FB7A 5GSVA 1X3DA 2R9HD 4WNQB 1JIBA 3GSUB 4MD5A 5EPMB 4CU8A 3QNZA 1FL3A 5BV7L 1OCWH 4PRIB 3GI9H 3GSXB 1UEMA 4NN6C 3RIFK 5KSUB 3FQXA 1I9JL 1WBXA 5IQ7H 1Q72L 4P2RE 1R3KA 3VFGH 1GZPA 1V8HA 1HH9B 1QPXA 4KJYB 5IJVA 2H41A 4NOBA 4Y5XB 4JRYB 2B2XH 1HDMB 3NA9H 4WGWB 3TN0D 1I8KB 4BFIB 4CBPA 3T2OA 3B2UD 1UYWH 3FO1A 2OLDA 2W07A 5H37H 1G6VK 2A1WH 4BM7A 2JJSC 4DZ8A 2IPKB 4JFXB 4LCUA 4YXKH 4GW1A 5SX5H 1H3WM 3LQAC 3QEQE 2PXYB 3DX6B 2AJSH 4FQ1L 3P40A 3CFEA 4J6RL 4ZUVA 2D4DA 2R2EA 1EMTL 4PRNA 2KKQA 3PWPB 2IANA 2NY5H 2VLKA 1S9XB 1KYOK 3PGFH 3VFNB 1CDYA 1HCFX 3RQ3A 3KLAB 1NLBH 4HHAB 4PV8B 3S88H 5KOVC 1BGXL 1EZVY 3DPBA 4JN1H 4M62L 3PWJA 1DBJL 3MLSH 2PO6A 3VXMD 3VXQA 1LE5A 1VCAA 5SWZD 4PTTA 5DJXB 4CAGA 3MPCA 3GBLA 1T0NB 4NZJA 4Z7VA 2B1AL 3QDME 5BVPH 2HA1A 3H9SE 3GSNB 3MA9L 3K2UL 1QSEA 1NCDH 3B9VA 1Y6NR 2CUHA 3MCKA 4M48L 5MEPA 1LK3L 4Y4HA 5TJWK 3CH8A 4U3CA 3QI9A 1H5BC 5D1ZC 1DBKL 2ERJC 5BMFL 4TTDD 4WU5A 5F3HA 3VXUD 1WFNA 4HS3A 2P48B 5H8DA 3VFSA 3NZHL 5ERWA 4R97B 4JPKL 3PL6A 1AQKL 4H88H 4JPVH 4HBCH 3QIUC 4YHKH 5C08E 3ARDB 2D0FA 4OF8A 2AJYH 4K94L 1ZTXL 4MS8C 1M6OA 4OZFH 3D6GA 1QSFE 3SE4A 2X9XA 2OM5A 3DX8B 3KPRD 4OLXL 3RWGA 5IF0B 2NYYD 1VSCA 2MCG1 3BWAB 5M95B 5D7JD 1W0VB 2VDPH 3JWDL 4U1NA 1AC6A 3O2WH 4DKDC 1N2RB 1A6WL 1CVSC 1TQCB 5LGJA 1XF2B 1YEJH 4NQEE 5DJ8B 4Z7OF 3RWCA 5FA4B 4C56A 3T4YA 4XCNB 2YPKB 5DURB 4V2BA 1UFUA 1ES0B 5A2FA 4HEPG 3PWNB 1EVUA 1KENH 2JK5B 3KPTA 4S0TD 3KAAA 4BFEA 1AHWB 3S37H 4CVZA 1X6NA 4OJFL 1QACA 4C4KT 5AYUL 1C12A 1QA9B 4EXKA 3GHEL 1H0DB 4I4WB 1QFWI 1T1XB 5D71L 5HHNB 5HHXH 5DJYB 2VZSA 5I2IB 4FQ2L 4IOFC 4R4BB 5HXMA 5E9DD 3GMMB 1C5DB 1FC2D 1RIVL 5HY9B 3LKQB 3F7YA 2W0LA 3L3GB 3RVWD 5IFHH 5F9WB 3FO0L 1TPXC 4UNUA 1HKLH 1MJ8L 5DHYA 3ULVH 2BXYA 2CJUL 4YE4H 5H2BB 4YR6B 4JVWA 2GKIA 1OF2B 1R5WA 5J9PB 3RWIA 5FYLL 1AC0A 4WHTB 3ARFA 4PD4J 4QOKD 3NCEB 1EGJA 3BKYL 1N6UA 5FGBA 5DR5L 4AEIL 1N3NB 1KCVH 2EDTA 3GMQA 3JV6B 1WZ1L 5CJOH 1BVZA 4OV5A 4LF3B 4O4YH 2I25N 2BJMH 3G5VB 1C16A 2FWOB 3BH9A 1YEKH 2JB6B 3AS1A 2FX9H 3MGAA 2UYLA 2YD7A 3IDYB 1KEGL 4LHUB 3EJYD 3H3BC 5EDXA 2NY6B 1A3LL 1UACH 1FYTE 1X44A 1J9CT 4NSKB 2HFFA 1QVOA 2O5XH 1Y0LB 5JNYB 5D6DA 4I3SH 5TDOB 3ZTJG 3WXWH 1BVKB 2Q76B 2Z92B 2V17H 4IRZH 2A6JB 2P7TB 4KK8D 3BDYH 4P46A 1U8MA 4XVJH 3P73A 4MJ2A 3LN5A 3O6FC 3ALWA 5A3ID 5KAQG 5C07D 4L3EE 3ZL4H 1R24B 4OBRA 1D9KB 1G0DA 3OZ9H 1RIHL 2YR3A 5GRVL 1KXQE 1DBAH 5D1XB 5INCA 4XP9L 3U2SA 4MAYA 3BJ91 5B8CC 4POYA 1RZ8B 1UGNA 4CADB 3UP1A 2IALB 3SDCB 2BNRE 4AMKH 1IGIH 5IBTH 1A1OB 2X4TB 1WZKA 3ULUF 3HC3H 5DD6B 1KNOA 3K46A 4I77L 4PRHB 1YPZB 4BKLB 2X4UA 1SJHA 3BYTA 2F19L 4MDJB 4P99A 2DD8H 3RWHB 2M26A 5FFLA 3U9PL 3CLEH 5HGHA 3I6KA 1INDL 4HK0B 2RFXA 4QRRE 5EG6C 1RHHB 5HYQA 3NABL 1BVLB 4L8CA 3C6SA 3QDJE 3VI3E 3BEVB 3NZ8A 4LARL 5I76B 3TF7C 5GZOC 5K9QG 5TQ2H 1U8QA 2NX5B 4G42A 4K9EH 4ODHL 1NBYA 4NQUA 3H8NA 4YBQD 3ULSA 1ACZA 4OLWH 3QIBC 3G5ZA 4P59H 5GGRB 4Y16A 2IPTH 3RWJB 4NWTL 1T7WA 1OAUL 1HHHB 5TGBA 4P2RB 3OKNA 3TNNA 3WFBH 2YD9A 5EA0L 2AK4A 2ID5A 2EC9U 2ATKA 5IB4A 2QQNH 3BHBA 2BNUB 4P2OD 5ICXA 1NGWA 5A43C 3WDJA 4ODSH 3QUYB 3Q5OA 3DIFB 4OF5A 4J8RB 1A6AA 2H26B 5HYJA 3G5XA 4JG0L 3NN8A 2NW2B 3UO1L 1DCLA 3FT4A 4LPYA 4BUGA 3CGTA 3CSBA 3DUHA 2HMID 2F9BT 3D85D 2HKFH 3QEQB 5CP3A 4GMTH 3TO4D 1SVZA 4ZSOA 2C3HA 4B50A 2QQLH 4FXLA 3LEYL 2FEDC 3QDMD 4XWGL 4OIIL 2R0ZL 3IU3B 3H9SD 4GW5A 4PY8J 1T5WA 1BQHG 2PTVA 2YD5A 5IT2L 5KVMC 1FE8H 2BHZA 5D9SB 4RA3A 2WQ8A 2CMRH 1CLCA 3BKJL 2A9NL 2XYCA 1EBAA 1T03H 3UYRL 2NR6C 2OX5A 2DLFH 2YA0A 4FABL 1BHGA 2WWKO 5T1KB 3QUZC 3V4PL 3IDNB 1RZGA 1T5XB 5B4MD 3D9AL 5ENWA 1KJ2B 15C8H 3GGWA 5DYOA 3UTSA 4X6FA 4JQVC 3ZKMC 4HG4J 1S9VB 5F6HJ 2OSLA 1DUZA 5C0BA 3UTTD 1CXKA 3UAJD 3KXFA 1EZVX 1U3HD 4UBDC 4PJ7F 2C4FU 1TZIA 5FYJD 1CT8B 4PGCB 3K4AA 4HUXB 5EN2B 1HSBA 4HUUA 5JMRA 4JY6B 3HMXA 4DW2L 4JDZB 4OZGB 5KBNC 2P1YA 1L7TH 1OGTB 4W6XB 4HUMB 1A3RL 3NCFB 3BQUA 1ORQB 3LKOB 1F4XL 3DMMC 1QSFB 3IFOA 5C6TL 4MD4B 2XA8H 5KVFL 3GO1L 1IAOA 2GJZA 1G7PB 1IEAB 3A6BH 3S3SA 3F7VB 4KHXL 4GKZA 3S4SG 2KBGA 4EI5B 2I07B 3LRGA 4MQ7A 5GJTL 4LRIA 3HZMA 4NQEB 5J1AB 4MJ5A 5CBEB 4YFLI 3WDHA 2E7LA 2X4PB 3KPQA 3WHE0 1IAIH 1RU9H 3CX2A 5T5FH 1WCBA 4S2SA 2B8OT 2HT4D 5IW3A 5BRZE 2HFGL 2DOCA 5H94A 4X9BA 5D7IE 1YA5A 1H8OA 4IM8A 1OAKL 4KJWD 4K7PH 3MLTB 1MY7A 4YWGL 4W81A 3P4NA 5GGTL 4DCQB 1UWEH 3C08H 3ARGD 4B7IA 1A14H 4R4FH 3P30H 3O6LH 3VWJB 1IJ9A 4J4PA 1BX2A 2ZUWA 4UB0H 1U3JA 4F33B 4UTAL 3AB0C 3TPUB 5GZND 2R15A 2YEZA 1PD6A 4OD3H 4HJJH 4XPGL 4XMLL 3QUXB 1CLYH 2OR9H 3QJHA 3CXHK 3ALPA 3RZCB 4TN9A 1XGTB 2R2HA 1KC5H 1Q0YL 2E7BA 3HE6B 2B1HH 2LQRA 4WWID 3ZMRA 1IMHC 5C9JA 2XNAB 5MHSE 1EPFA 4PJDB 2F54E 2CR6A 4RFNC 3EYQC 4DZBB 1XAUA 1O0VA 1WQVT 1SEQH 2Q8AH 3EYOA 4XCEA 5AG9A 2AEQH 3MV7B 1NAML 32C2A 1LDPL 3V2AR 4DEPB 4PB9L 1AI1L 1N4XL 3CD4A 3FO2B 5C0AB 4JPWL 1MFEH 3WYRA 3I75A 1R0AH 4HSQA 1A6UH 4X4ME 5IVXE 1LD9A 1FNSH 1S5IH 3GB7B 2O5ZL 2V5TA 2A9MH 5TE6L 5EOTB 1XF5A 4XXCA 5JHDD 3VA2C 4G6JL 1FO0H 3VU2A 4PJXF 1BJ8A 5HGDB 4J1UB 5HHOA 3DLQR 4WDIA 2JJUA 2FL5B 1E4JA 1RURL 2E27L 4PUBL 4XMPH 2J7LA 3SE9L 2E7MA 5GGUA 4Z7UF 3SQBA 1EVTC 4NPYA 3TT3L 2R69H 1DBMH 4LLMB 2EE2A 43CAA 4QRRD 2EECA 4ONHB 3MRGB 5F72S 3QDJD 3L9RA 4FQXB 1HHJB 5HD8D 3BOVA 4NUJB 2BNRB 1XFPA 5JORA 3FB8A 5KSAA 1CE1H 1JV5B 2Z31B 4HKJB 3WL9B 2AGJH 1HXYB 2OTWB 5DMIL 1KIUA 1FVCA 1K4DA 1P9MA 1RJZB 3GJEB 3FRPG 1VPOL 3EO1B 3L5XL 2MFNA 1MCWW 1ZHKB 3MGOA 5SWQA 5DMGD 1JPGA 4TYUA 1OP5K 2DJUA 4OUUB 2N7BA 1FH5H 1JUFB 4OSUL 3SCMB 3UTQB 1HILA 3ARTA 1AD9A 3GKWH 1F3JB 1C1EH 3KYMA 1G6RL 4ELMA 1FFPA 1KF9B 1JHLL 2VDOH 4NO3A 3KS0H 2LAAA 5DUPH 3WXVH 4ZUTB 3TCXA 1W8NA 5K59F 1TVBB 3H7BA 5IOPA 1JPSL 1G6RA 2SEBA 2GW5A 3MNZB 5ANME 2MMXA 1DQML 1FORL 4D0DB 1IKNA 1B6DA 3TVMD 3NCCB 3PABA 3KLDA 1U8LB 3GKZA 3TYFA 4HKZA 4NO2B 4U1HA 4GRLC 5BJTB 3OJ2C 1M05B 4Z7UA 4FQIL 4EIZC 5B38B 3SOBH 3KPSB 4L8SC 3DUSB 5GS2H 5GGVH 4IHOB 4OGYH 3SDYL 1LNUB 5FO9A 4Q6IB 4QHNA 4JG1L 1HYSD 4PP1D 1E4WL 2OP4L 3MRJB 4PB0H 4YK4C 4TVPL 1TJIL 5IHZB 1EV2E 3QEUB 5CD3A 1E4KC 4FXKA 3H42H 3BH8B 5HDQH 2A83A 2IQAA 4K07A 4M7LH 1R5IB 3CPLB 4CVWA 3WUWB 4V1DE 1QR1B 5E5MB 5GRJH 3IJSB 1ZXQA 3CVHL 1CGXA 2CQVA 2FBOJ 1OTTD 2EE6A 1I1YB 2WAHA 3OKEA 4U7KA 1RFDL 1RUMH 2CKNA 2E7HA 1S7XB 2Z93B 2FCBA 1Z9SA 3JWOC 4NC0B 5F7KC 3K4ZA 1S7RB 3B9DA 3CVHA 4L4TE 4MNHA 4HV8B 3VWKB 2BVPA 4DN4L 1QTYT 3WNOA 3L1OH 1TFHA 1JFQL 4LCYA 4JZOA 1A7PH 3MXWH 4PR5A 4W6YB 1UM6H 3FL7A 2DWDB 5FO8B 5K9OA 2VDMH 4EQ3A 1OCWL 2FZ3A 3GI9L 3ARZA 5GRYA 2HFEB 1YEEH 1OGAE 1SBSH 5DJ2B 5IQ7L 3LVEA 2CXGA 4J2XA 2XFXB 3TZVA 4CNIA 3GIVB 1JHTA 3NVQA 1C7SA 3DX9B 1ND0B 1VB9A 2HT2D 4U1KB 4AEEA 5KANG 5AD0B 1MCKA 4R2GD 3IKKA 2B2XL 5I71B 5I8OH 2VLLB 3NA9L 3BP4A 5EU3B 5KS9A 4TQEH 1UENA 3U0TB 4P4KD 1SHMA 4CU7A 3W9EB 4G9DA 5JA8B 1Q9OA 3IDXL 1UYWL 1T3FB 1XF1A 1SMOA 2A1WL 4QTHA 2VLRE 5E6ZA 4WTWA 2BY2A 5E8PB 3TEUA 3CFCH 4YXKL 2FJFB 4UINH 5BRZD 1UEYA 3RVXD 3K4DA 5BOZG 5HYSG 1OTSD 2CDEA 4YFEA 5E1HB 3AREB 2R0WH 3LY6A 4GMSH 3QBTB 2KQMA 4PJAA 2AJSL 4WWKA 1V3LA 3HRPA 3SGKA 3VXNA 1IILE 2KL6A 5CIPH 4XP6H 3VFMA 4M1CD 5ICYB 1FFNB 4I0PC 4Y4FA 2NY5L 4LASH 1OT1A 3PGFL 1S7SA 4BELD 2QKIB 2PW1A 4O2FA 3SO3C 4LGRB 4NQSA 1NLBL 5IG7A 3S88L 3C09C 4QRTA 3TFKD 2WBJB 3WJLA 1I7UA 4X6CB 5IIEB 1GXEA 3MLSL 3X14A 1UCTA 4YHOH 4HIHB 4RX4D 4JPIA 5CSGA 2QADD 1PZ5A 3U0PA 4KKNA 5F3BB 5CLWA 3GHBH 5BVPL 4PLJD 1AKJA 4X5WB 4GAGH 4EJ1C 4XCYA 2F54D 1NCDL 1HHKB 4I48B 4JFEA 2A6IA 3BEWA 3ARXA 4OZHF 1XIWB 2P4AB 5IM7B 4RWYH 4I18A 1IL1A 4MDIA 3FB6B 1VENA 3B6SA 5T1DL 5CGTA 4F8TA 4W4OA 1X5GA 1PJ9A 4WY7H 2V2XA 3TIDB 3DVNA 4H88L 4JPVL 2XWJB 4JRXE 4HBCL 4YHKL 5E08H 3ULVF 4FQQB 4JREC 4LLQA 2IC2A 2AJYL 4HKBA 4O9HH 4N9OB 3D39E 2BK8A 3VXOA 1A1MB 3D2UA 5MENB 5I75B 3DETD 3C6LB 4LSDA 5HI5C 4NFBA 1JCKA 2JJWA 2W91A 2VDPL 4JO3H 3SJVD 1T80A 3HC0B 3O2WL 3VDAA 2B4CH 1L6XA 5IWLA 3B5GA 3B3IA 5IVXB 2X2YA 5D7LE 1ZHNA 1BZ9A 4Q2ZB 1YEJL 1GYAA 1EFXB 3FZUC 1QLFB 2ZOLB 4HWBH 4HAFA 3LD8B 1UKSA 2J5LC 2BSTB 4JFYA 1KJ2H 1V7NH 1KENL 2Y4SA 5LCVH 3FFCA 2NPLX 4OCRL 3S37L 1F2QA 4OI7A 2JJVA 3RX7A 4NT6B 3WNNA 2Y25A 5HHXL 3QPXH 3CIQA 1NEZA 5DEFB 4F3FB 4TNWF 2F53A 1U9KA 5EUOA 4M1DH 3H9YA 4ONGH 3HG1E 4KKLD 4MJIE 4R3SA 3L95A 3OJMB 4UU9A 4R26H 4S11A 5IFHL 3PXJA 5E56A 3BXNA 4U1SB 1HKLL 2ZUYA 3ULVL 1PKOA 1GHFH 4HUWA 1BM3H 4FHBD 4PGDA 4YE4L 4K94C 4QKXB 2VN7A 4J3TA 1QFOA 5E8NB 1ZK9A 1KTLA 4ZNEE 3BZEB 3QIWA 5D6CA 5D2LB 4ZO8A 1N8ZA 1GRWA 1MAKA 4Q9CA 3BPLC 2NNAA 5JO5B 1DBBH 2NZ9C 1CGUA 1KCVL 1UZ6F 2ESVA 3P77B 4I3RH 5CJOL 1GJIA 2FJHB 3CNKA 2BJML 4O4YL 3W81A 1YDPB 5FUOH 1YEKL 2DWEA 3KLSA 5DEZA 2EIZA 2R29H 2FX9L 3D69B 4XVUD 2VQ1B 1BZ7A 4K3GA 1H5BB 4XNZB 5D1ZB 3V0WH 1N5YH 2ERJB 1HQRA 1UACL 1BFOA 1J0KA 2VRAA 5GRVK 1MUJB 2O5XL 3MRQA 3NCYS 5ANMB 1JZ3A 3ETBF 4ZMAT 5DS8A 4I3SL 3WXWL 2PYFB 3QIUB 2V17L 3HNSH 4HJGB 4IRZL 4R8WH 2ITDA 3WUZA 5INDB 1I3UA 4KRMB 3BDYL 3LKPA 1BQUA 4XVJL 3WFEH 1VADA 1I85C 2EDBA 4YO0B 4ODUB 4JEGB 4KI5C 3IFPA 3RWEA 4F7PA 3ZL4L 3SKNA 4F15C 3OMZA 4R9HA 4RMTA 5LXGH 4U31A 3OZ9L 3N85H 1HQ4B 1DBAL 2XICA 3MREA 1H3XA 3VFTB 3LH2H 5FXCH 2JLLA 4Z8FH 4DWHA 2MKLC 2X5PA 3UBXB 2VUYA 1QR4A 2UY7A 3D18B 4WV1B 4AMKL 1DJSA 5ID1A 1IGIL 2OS7A 2QJDA 5IBTL 3JTSA 3ARQA 4K55A 3HC3L 1SQ2N 3EJJX 4M6OL 5KSBE 1L9MA 1QRNB 5C0RH 1F58H 2DD8L 2HG5A 1HZHH 4N0UB 3PHQA 1ZSDA 4BZ1H 1BBJB 4C58B 3RDTA 3CLEL 3UC0H 5F7LB 4QRQB 4L4TB 5DSCB 3SGEH 3E6HB 1HOCA 5TQ2L 3RVVC 5C0CD 3O4LE 5IW6B 4K9EL 3T09A 4ZUSB 3OBAA 1ETZA 3VXRA 1P4LA 4FXGB 5I8CB 1ZEAH 1CFNA 2XI9A 3BKCH 4NJ9H 3DBXA 1DFBH 4OLWL 3LRHA 3MRFB 4P59L 4L4VE 4RFEB 1I8MB 4R7NA 1DVFC 5JOFB 2GJ6A 1R6VA 2IPTL 3FJTA 3IDMA 4NQTA 1AFVH 4EN3C 1JF1A 4D9RD 1OGAB 3WFBL 4NQDA 1JGLH 3KPLA 1K4CB 5ISZA 2QQNL 5GSRA 3SDDD 3RUGE 4PRPA 1SJEB 4Z7WB 3H0TA 2R56H 1JNJA 4ODSL 1T83A 3I84A 3WLBB 1XGPB 2WUCH 3O6FD 4JN2B 2GK0A 1A6TB 3K0WA 5EUKB 3QFJE 2VLRB 1MCQA 5J1SC 1QUNA 3LV3B 1G7IB 2HKFL 3TYGH 4GKSB 4GMTL 3J7HA 3QHZH 3SKJH 1NBZA 3WFDH 4O00A 4AIOA 2QQLL 4GXVH 1H15B 3MZTA 3KR3H 3NH7H 5EOCH 4ZODA 3PNWB 5JR1L 5IBLC 4LLUB 3INUH 1FE8L 5FM4A 1ZT1A 3GSQA 2Y07H 2R2BB 2CMRL 43C9B 1R3JB 1X7QB 2Z4QB 3LQZA 1T03L 1T1YA 1A8JH 2DLFL 1L9NA 2LE9A 3MMEB 4ZUUA 5C6WH 3OF6A 3D5OF 3ARPA 1D5ZB 4G9FE 15C8L 5EIVA 4P23A 4JRXD 1CGYA 5DVNA 4QRPE 3PWUB 1MSPA 4HCRH 2B5IB 3QIBD 4JANB 2W0FB 4QT5A 4CN1A 1TITA 3D39D 1W72B 1ZGLM 3U46B 1IAII 2IMNA 2C7UA 4OD1H 5JOPE 5JXEC 1QZ1A 3ULUC 2IFFH 2AXGB 4OFYA 3LHPH 1J12A 1V3KA 7CGTA 4JFPA 1UADC 3GJFK 2BRQA 5D7LD 1CFVH 1MQ8A 4PJGE 3HZKA 3RY5A 3HA0A 1C08B 4WUKH 1I9EA 4GAYB 1L7TL 5E5RB 4PLOB 1Q94A 1MRDH 3JVGC 5GRWA 3ILPB 3I6LD 3NFNA 2XA8L 5J3HC 1F4HA 3A6BL 5HHQA 1SJVA 3V6FA 5T3ZE 4XBEH 1KJMB 3TBTA 3GFUA 4N0CD 3KYNA 5KW9H 2AKRA 3RI5F 3FAWA 1J0ZA 3ORJA 3HG1D 1TVDA 3GMLA 4GRMB 1BQLL 2P5EE 4U6HA 1IAIL 1RU9L 4Y2DC 4AH2A 5L88H 3NCBB 5T5FL 4G7VH 2X4RB 1NCNA 1S9WA 2WIIA 3MYJB 2AW2A 4LCWE 4WW1B 4X6DB 1JTTA 1BFTA 4K7PL 2CGRH 4XNMB 2NR6D 5FHAH 4OM0H 3VMOA 3NBNA 5A2JH 1UWEL 2Y06L 3F7PC 1FLTX 3C60A 3C08L 4X83A 1ZA6A 2BSED 3ARBC 2LTQC 3VD5A 2P8MB 1A14L 3LS4H 1EDQA 3MGTA 3O6LL 3P30L 3V4VH 3JUZA 5I16B 1HINH 4UB0L 4K7PY 1E27B 5IR1B 2MOVA 3FN9A 4MJIB 4YIQB 1F4YH 4BSVA 7FABH 5SWZB 4HJJL 3IRPX 1SY6A 1CLYL 2OR9L 2VZTA 1DLHB 2ZSVB 2W9DL 4HK3N 4HZLB 4XVSH 4GQPH 4JM2D 1KC5L 3MV9B 2B1HL 3C8KB 2UWEB 3S37X 4X7EC 4QYOB 4MCYB 2VZUA 1KB9K 4L9LB 1SEQL 1MH5A 2Q8AL 3BGMB 2AEQL 4QEGA 4W68A 3VCLA 4POZC 1TCRA 3VRIB 4KK5D 1PSKH 4HLZG 3VXUB 2PYEE 5I15H 2ICWI 2YXFA 1MFEL 5IVOA 1R0AL 1A6UL 5LVEA 3AU1A 2Q87A 1UKQA 3BO8B 3TN0A 1MEXH 1FNSL 1S5IL 5E00A 5I66B 2Q6WA 4P57B 4PGZA 3ZKSD 3CFDA 2X41A 3W11C 2A9ML 3QB7C 4YHIB 1FO0L 3KPRB 2R8SL 3OL2A 25C8H 5HI4C 2VAAA 5FK9A 2Q8BH 5D7JB 3DMMB 3N0PB 3ZE1F 4XMPL 2QHRH 2X10A 4B53A 3MJ9H 4PY7A 3RWDA 4QCIB 4WO4D 1FO0A 4FZ8L 4RRPA 2R69L 2VL4A 4ZOBA 1K2DB 1DBML 5CHNB 5IEKA 4GAFB 4CMHC 3HUJE 3BN9C 1HE7A 1QLRB 3CFJA 4PJ9B 2CRIA 3BUYA 3GSOA 4PFEA 3RJDA 1CE1L 5CEYA 3QSKB 1RVFH 4U49A 3VXMA 1JN6B 5SV4A 4GO6B 3QRFM 4L4VD 3F5WA 2CUMA 1ZLWH 3KLHD 4MX7B 4B0MM 4N5EC 5AZEH 4LQ1A 1FH5L 1LP9E 3CXDH 2ICWA 4YGVB 5J6GB 1MCFA 2ADFH 1AGCB 4TUJA 1NGZA 4H1LA 3GKWL 3IGAA 1FP5A 3BSZH 2VDOL 4K2UH 4YDJB 3CC5B 2Q86A 3RGVC 3VRLF 3JBG7 1S8DA 1CICB 2BCKB 3LAFA 3FRUB 5DUPL 3WXVL 5HDBE 2FLBT 3OR6B 1D5MA 1NBVH 2VABA 3BGFC 4ZAKC 4XZUA 3WNMA 3RL1A 1WAAF 3LEVH 3DXAD 3RA7H 3RNKA 4X7CC 3PJSA 3LQAH 1N5AA 1I4FA 3WEXA 4FQHA 4U1IB 1FNEA 1LEIA 1BREA 2V9RA 4OGAC 5FDWA 2CO7B 4YNYB 3T2PA 3HE7D 4K7FA 2F5BH 3FCTB 5HPMB 5HJ3A 5IMMA 5JIKA 4OCSH 4PJFE 2DL9A 2ZWLT 2NXZD 3ES6B 5JHLH 1JWSB 3SOBL 3CSPA 5GGVL 4WHCA 1ZLSH 5E6IC 3G08B 2G5BB 4OGYL 3V6ZB 4GG8A 1GCFA 1NMCC 1C8PA 2CR3A 2NXYC 2ZUUA 4I0CC 4PB0L 3RZWA 1FZJB 3H42L 5HDQL 3C5ZD 3MO1B 4OAWB 4M7LL 1ADQH 1A4JA 3B8SA 1A9EA 2C9AA 1N0LA 1XEDA 3VFRB 5GRJL 1ZV5A 1YPZF 5F1OB 1FFOA 4FQPA 3V5KB 1RUML 1SJXA 4G8GE 3BZFA 4P4RA 5BZWB 3RIAK 5E9DA 3VFUA 1BOGA 5JOPD 5IB5A 3DVGA 3L1OL 4P2QE 1RUPH 3R06A 1A7PL 4G9FB 4HWEH 3ET9F 2VITA 3MXWL 4O2CA 5CGMA 1J88A 4QRPB 3DRQA 5CEZD 2VDML 5CGYD 3ZYOA 3F6IA 1VACB 5L8JB 5IHUH 4AK1A 1CG9B 1MCOH 1SBSL 3I6GB 5J6HA 1B3JA 2N7AA 4PGBA 4QOKA 5SX5K 5JDJA 1TVHA 1H3UA 3W0WE 1JZ8A 2G5RA 1ZGLB 3RKPA 3BW9A 1BIIB 1MLBB 4X4YB 2HVJB 3WIHA 1S5HA 5I8OL 1CTOA 3STZB 4CMMA 2VDNH 3U4EA 4ACPA 4TQEL 1B9ZA 4PJGB 4OLYH 3W39B 4E42B 1XGRA 4GRLD 3PQYE 4HWUA 3CFCL 2Z91A 1FG2B 4UINL 4LSTH 5CP7A 2KZ1B 4KJQC 3T0EC 4NZDA 2NY4B 2A0LC 2P42B 4CU6A 4I9WE 4UUJB 2R0WL 4GMSL 1JHKH 1PQZA 3AS3A 3O9WC 1EBPA 2UVEA 3SGJC 4JY5H 2R23A 4H0IA 4QRUB 5D1QC 2I9LA 3D3VE 4LASL 5C07A 3FOLB 3A67H 5ETUA 3A0OA 1P4BH 4XGZA 4KI5E 3S35H 2Z8WC 2Y23A 3TA3C 2YUZA 2D3VA 5CIPA 1IARB 4OD2B 4LCWB 2J6EA 4Q9RH 4EBQH 2WANA 3QULA 4G80B 3RWFA 4YHOL 3R1GH 3GMPA 3GHBL 1AO7D 2CPCA 4XHJC 2QSCH 4GAGL 4RDQF 5AAWA 2VXTH 4LNRB 5DRNB 4G6AC 4YBHA 1KJVA 5BZDB 4LLYB 3LSOB 4RWYL 2XPGB 1XMWA 5TDNA 3TO2B 3HI1B 1CCZA 4JLRA 3LQMA 3GUTB 5E99H 2GT9A 2X44D 4WY7L 2OJEA 1BWWA 3BZDA 4XP5H 1UJ3C 1FAIH 4JKWA 5TDPB 5EU5B 1NFKA 4L5FH 5C6PB 3LKRB 3MRDA 3S36H 2R1XA 3I3EA 4DJMA 4NKQB 3FQWA 3UTTB 4OZGF 1U3HB 1D6EA 5TE4H 4O9HL 3X13A 4NZRH 3WHXB 3U0WH 4XHQA 4OF7A 3EZ8A 1P7KA 1A7NH 5EH1A 3EO0B 5KVGH 4DK6A 2NY5C 2H2SC 5IUSA 2PYEB 2VDLH 3HS0A 4LLVA 4JO3L 3QQ4A 4P2OA 5DDHB 3BD4A 1RUKH 2B4CL 1CD1A 3MJ8B 3Q6FA 5DRXB 3PP4H 3T1FB 4GLRI 4MSWB 1I7ZA 3BZ4B 3EDDA 5L2JA 2P8PA 3WS3A 4HWBL 4I0PD 1XT5A 1UVQB 3VGEA 1KJ2L 1MPAH 2X4SA 1V7NL 5LCVL 4A2LA 1MCEA 1YN6B 3D85A 1UCBH 5ESAB 4K3EH 4ORGA 4LLAA 3TO4A 4HWBA 4IBLT 3QDMA 3QPXL 4MAUH 1F3RB 1RZJC 5FIEA 3MBED 3H9SA 1BF2A 3HUJB 1T4KB 3L3DA 4LMQE 4NN5C 4M1DL 4ONGL 4R26L 4XPTH 3DURB 3TBSA 3SO3B 4P5TC 4WTXA 2QHLA 2F74A 1GHFL 1KPVB 3C09B 4Z0BH 1BM3L 5IK3A 3NA4A 3ARGB 4PJCB 5FAAA 4IDLA 1B4JH 5FA3A 2H9GA 1DQJA 5KG9A 3C5JB 1M4KA 4PJDF 5C08A 4PP2A 1LP9B 4NZUH 4XT1C 4BSWB 4ETQB 1U8HA 4RIRB 2KH2B 3DGGB 1DBBL 5J11C 4QXWA 5DRWA 1V7MH 4I3RL 5C0DB 3BX7C 4I2XE 3B9KB 4U33A 3O2VH 4JFQB 5FUOL 4TNWK 5FGRA 4IS6B 2YD1A 2EXYC 1ED3B 3MJGX 1GOGA 4IRSD 2JCCE 1BD2E 3OKMA 5HI5D 3VXPA 3V0WL 1N5YL 3ULUE 5CSBA 5EBLA 3S98A 3KJ4C 5DTFB 3ZE2F 1F4AA 1WFUA 3MROB 1G9EA 4KMLB 4JDVA 3HNSL 4R8WL 3FZUD 3WMSA 5T5NG 3O41B 1EO7A 4Y4KA 4Y5YC 3IVKB 2ICEB 3SGEI 4ZDHB 5C0FA 3WFEL 4LCCC 1GGBH 4UI2A 1ZHBA 1T1WB 1KACB 2L4OA 3M17B 3V5HB 3FN0H 4HS6B 3QZWA 1A6VH 3HAEA 1OSPH 2DAVA 1I1CA 2D9QB 3N85L 2RQ8A 1W0YT 2HLAB 4HWZB 3X12B 4K23H 5T1MA 3PDOB 1CFQB 3LH2L 4Z8FL 5BXFA 1G7MA 5SWSB 2EYRA 4OLUH 2BNQE 1RJLB 4A2MA 3EOTH 2AJZB 1DTUA 1ZA3A 4P2QD 4NHCH 1CIDA 1FNFA 2ZPKH 4AM0B 5J1TC 4HZAA 2HTKC 4GT7A 1TDQA 5C0RL 1F58L 3FOMA 2ILLA 3P4OB 1HZHL 3KWWA 1TNNA 4BZ1L 4D9LH 1XGUB 3MRMA 4G8GB 4GG6E 4KDTC 3NFPB 3UC0L 5CAYB 4IRJC 3QNYB 2W1NA 3FQTB 1RI8A 3HB3C 4HBQA 4J23A 2K7QA 3C9NB 2NZ9D 1ZEAL 3TT1H 4HAGA 2ZJSH 3BKCL 4NJ9L 1L6ZA 4NGHL 1FGNH 1DFBL 3K1KC 4WJ5B 1NC2D 2HLFC 2X70B 2D7TH 2XG5A 4PJ8C 4PGEA 3RX8A 1GGIH 1ORSB 1A6ZB 1VFUA 2YD8A 4WUUB 1HWGB 4PBWD 1AFVL 1FYTA 5DJAA 1IEBA 2IPUG 1BQHB 1JGLL 3W0WB 1JPFA 4Z5RA 3ALXA 1QHPA 3BPLB 2FB4H 1JWUB 4RGMC 3N50A 4TUKH 2R56L 1QO3A 3O3BA 1RQ5A 3UPCA 1DEEB 2WUCL 4IIQA 4L3EA 1DDHA 3PGDA 2DYPB 1IGJB 3ZDYE 3LRSB 4AT6B 4RNRA 4H20H 4CW1B 2P8LB 5DI8A 2J8HA 4X99A 2ICES 2J8UB 3TYGL 3RRQA 1UB5B 5JHDA 4MNGE 5EIIB 3QHZL 3SKJL 3BP5B 3WFDL 4HX1B 4QXTA 3RPIA 5FUZH 1WBYA 3MJ6A 4GXVL 3WD5L 1Y18A 2Q3ZA 1AGBB 4PJ7E 5FKPB 4APQD 3D3VB 5FYLD 3LN9A 5HGGS 3KR3L 5HHPA 3IDIA 1X5HA 3NH7L 4L4JA 5EOCL 5IHLB 5DRZB 3T2NH 5I6XC 4AIZA 3INUL 5I18H 4MVBD 2Y07L 1EX0A 4TRPH 4ZO7A 4QRRA 3UJJH 1K8IA 2XWTB 2DDQH 3QDJA 4HIJB 5L2KE 4ZTOH 2EC8A 3T77B 2VLME 5KN5A 5BQ7A 3DRTA 4GH7B 2I9TA 4LOUC 3VFVB 4DK3A 3ZHKA 4LSSH 5F93C 3KPPB 2EIBA 5H35A 4JCMA 4WHYG 4YAQB 3KHQA 4HCRL 2VDQH 2E3VA 1T20A 4NIKB 5D5MA 3S4SB 3U48A 4H26B 2ICWJ 3MUHL 3MRNA 2Z35B 3FONB 4LCIH 3VE0B 1OHQA 4FTVD 4EN3D 5E24E 3JV4A 4OD1L 4PRAA 5C0EB 4K71C 2IFFL 5DZNA 1TQBC 3LHPL 4HCRA 5CBAB 5F96H 1YMHA 4HXBH 1DUYA 3MYZA 4OM1H 1CFVL 2ZSWA 5IMOB 5J06A 3X11A 3IB4A 4QWWC 4WUKL 2I27N 3FO9A 2WWKT 5I9QC 1MRDL 3DV4A 5GS1B 3VXTA 1JVKA 4Y19B 3SDXB 3KS0J 2P5WE 4HH9B 1DVFB 2AJUH 2H1PH 4R2GB 3X17A 2P24B 2NY1C 3IXTB 1AQDB 1AH1A 1KB5B 1UT9A 2CK2A 1F11A 4LP4A 3TVMA 4XBEL 1NGXB 3VFOB 5E2TH 1CXIA 4JR9H 2NY3D 4OBSA 3LN4B 1B0GB 3WNLA 1CN4A 1BFVH 5KW9L 5A2KH 2IBBA 5JPMA 1NUDA 5L88L 3V8CA 4LVOC 4YHYC 4G7VL 5DMKB 4XPFH 2IADA 4YHZH 5IBLD 1CDUA 1ZVSB 4X6CF 1M7IB 5ID0B 5DJZA 2CGRL 4K8RC 5EBMB 4F57H 4OUOA 5FHAL 4OM0L 3T3MF 1B0WA 2YMXH 2XZQH 4PJBA 3LS4L 3V4VL 1HINL 3NFSH 3KYOB 1F4YL 2PW2A 1U0QA 4E0RB 7FABL 3BDXA 2UY6A 4MHHI 2QADB 3GNMH 1QEWB 3RI5K 1P7QD 4IMLA 3UYOD 4YC2B 5HTSA 4XXDA 2AABH 4XVSL 4KKBD 1S9YA 4MXWH 2Y5TA 5ACZA 1I7RB 4LGSB 2YD4A 3WN5C 5I1LB 4N9GB 4BH8A 2NTFA 3V5DA 1EHAA 4JFOA 1I8LC 4O2EB 4HJ0C 1MCDA 2PO6C 5T3ZH 1E28B 5DO2C 5AEAA 5K9KB 4G8EA 1AXSB 4I2XB 5ITFB 3HZYA 1CFTB 2PUQT 1PSKL 3UJTH 1Z9MA 5I15L 2A74B 2JCCB 1BD2B 1Q9LA 3CK0H 2COQA 3QH3B 5J3HD 4D9QE 3KPNA 3L6FA 2WMPA 5JPNB 4HPOH 1MEXL 5B39A 5IVXF 4KKAD 4P4KA 4X8JB 2FIKB 1MREH 2H8PA 4Y4HC 3O45B 4XBGA 4WEMB 4MLSA 3ZE0E 3O0RH 3QI9C 4Y1AE 2BSRB 5BS0D 1MHHA 3CSYA 1F90H 3VD3A 3B83A 4ZG1A 25C8L 3EIFA 5BRZA 2Q8BL 5CZXC 3O11B 2LU3A 4HC1A 5D7IA 3SJVB 2GUOB 3THMH 5IVZA 3T0EE 2VH5H 3BESR 3PL6C 2QHRL 4Y5XC 5GGQH 5I1EH 3MJ9L 3SGDH 3QEHA 2ADGB 3SDAB 2EKSA 3DTXA 2VISB 3JWOH 1OSZA 4JHZA 3SE4C 3MRRA 5K59E 4ZXBB 2BNQB 1YY8A 3EGSB 4O02H 1YY9D 5FOJA 3ZSTA 3T4AB 4LEOA 1RVFL 3ZYZA 2BSSB 4Y2DB 3IDGB 1MWAH 1WFOA 3OX8A 1RY7B 2OL3B 1TMCB 3L3IA 3OJDB 4RA0C 3B9EA 2GITA 4RX4A 5IJKA 3SY0B 1J05A 1K85A 1LHZA 5I1DB 3MLUH 2JKXA 5LAXB 1NFDB 5AZEL 4GG6B 4PTUA 2F54A 3CXDL 1MIEH 3FQRB 4YH6A 5D2LF 5E8EA 2FDBP 2ADFL 1YEHH 2CLRB 3MNWB 2LTQB 1II4E 3MRBB 4FQCH 2ADIA 3W9DA 1BECA 3CVIL 5D93C 2WBWB 2O5YH 3BSZL 4K2UL 1F3DH 3DROA 4G8IA 4PG9B 4POZD 4H25B 4M6MH 4YPGA 1S7WB 3QT2A 3RKDC 1BAFH 1NBVL 5GS0C 3D25B 2C5DC 4PJ5D 5DQ9B 2V7NA 3LEVL 4ZFZA 3RA7L 3RTQD 1CQYA 2ZUTA 3LQAL 1JE6A 3J8F7 3O3UN 4EUPA 4KK9D 3U36A 3W11D 2M1KA 2F5BL 3D0VA 4F7MA 1B4RA 1J10A 4Y5VB 2FGZA 2X1QA 5HI4D 4CVXB 4OCSL 1SYSA 4OIAA 1D5XA 4MCZB 4NM4H 2EXWD 4OZIA 3ARFC 5JHLL 5C0JB 5B38G 1O7SA 4X6EB 1ZLSL 2D2OA 1CXFA 4PJHB 3ZTJH 3L3KA 1NC4A 3ARDC 1AXIB 4Z95H 5CEXB 2ZOKB 3VXSE 5L2KD 3EDFA 2IAMB 4KGJA 1KPRB 3QG6B 3C2SA 1AGFA 1ADQL 5KVEH 1SYVB 4KH2A 3RVUC 5EU6B 4KTDH 2YN5A 4N0FA 3WFHB 3QWOB 1NANH 4K3HA 5TH2A 3QXAB 5GIRA 1CZ8H 4MNQE 5F1NA 5BVJA 3EKCA 1EEYA 2A6DB 2WV3A 4FQLH 1ADQA 4N5ED 3MV8E 4P46C 4H0GA 3ZTNH 4HFWA 1Z0NA 1LO3H 1SEBA 4CMHB 2BC4B 1IGTB 4DFHA 4E9LA 4RCAA 3VDCA 5F71A 3KDMB 1RUPL 5HYSB 4RAUB 2ZCLH 3BIKA 4HWEL 1CL7H 4XRCA 2VC2H 5FKAA 4S1DC 3VI4F 1KG0A 2P49B 5IHUL 3FN3A 1AR1C 1H3VA 5FOBA 3IF1B 1MCOL 4LAJH 5C0CB 4X0KB 4U1LB 3GSRB 4JZNA 1CF8H 2UZIH 3ILQC 5F9WC 1ZAGA 3REWB 1T22B 1WIOA 3NCJH 1YEFH 2EO1A 2UV3A 2ZUXA 1GZQA 1G7LB 1RJYA 2VDNL 2NMSA 2QV2A 3G5YA 1KT2A 2DIAA 3TLRA 1OP3H 4OLYL 3VFPA 2XKNB 3OGCB 1IAMA 1C5CH 5EBWA 1W8OA 4JFFE 4C83B 1XR8B 5DUBA 1FZKB 3BGFB 3MFFB 4LSTL 5E6ID 5C2UB 2FEEI 4WFGD 3WIFB 4LDOB 5L0QB 2J3SA 3NACH 5DJ0A 3HZVA 2VLJD 4LFHG 3LKSA 4OZHE 2H6PB 4PRDB 2UVFA 3EO9H 4V1DA 1PKQB 4JY5L 4Y16C 2VL5A 3O3EA 2B7DT 2EDJA 4D0BA 1SM3H 4NQVA 2D31B 3A67L 1P4BL 3S35L 4OF0A 3FFDB 3R8BB 4I5BB 4KZEH 4Q9RL 4WI9A 4EBQL 1T21B 5F6IC 4ZPVB 3S96A 1HNFA 5CWSB 2BVQB 3Q5YA 5I73B 2X09A 2AEPH 4YHNA 3R1GL 2EDLA 2QR0B 2ZUSA 5EC2B 5CJ8A 2QSCL 2VXTL 5GQBA 2AK1H 1NFIB 1D9KC 2NW3B 2GSGA 2R1YB 4TUOB 1U8NB 4JY4A 1I3RA 1GAFH 3EYFA 4N1CA 1KIPB 5I30H 2FEEL 3OHXA 3HPJB 4BZ2H 3D0LB 2FO4A 2ORBH 5JIHA 3SDCC 5EZLB 3NIDF 4GBXD 1E4XI 1PX4A 1P84J 1M71B 4YPJA 4XP5L 1YNTB 4JFDB 1FAIL 1UQSA 4NC1C 2FJGB 1G7HB 4L5FL 1J11A 3TBYB 3HFMH 3S36L 2P44B 3GEWB 1CLOL 3IDJA 5EZJB 2OI9B 4U1MB 5TE4L 4ZFOB 4FQJH 3U0WL 4YDLB 4HIIB 3PV6A 5KVGL 2C26A 4NBZB 3T0ED 1ZT7B 2VDLL 1CQKA 4PRBA 4E41E 1DQQA 4NRZB 3SDDA 2C3XA 1L4IA 1RUKL 3O9WD 3KHOA 3PP4L 4F8QA 3HC4L 1DP0A 3O6FA 5HGAB 2YC1B 1WWAX 3MLVH 4IJ3B 3CZJA 1IM9B 4XPHH 2E9WA 2GEEA 1MPAL 3QUMA 3V6OC 1IM3B 2YPLE 1RK1A 1UCBL 4X6DF 4K3EL 5B8CA 5JQHC 4YDIH 5DQJB 5ADPH 1UZ6E 3QXVA 2GSIB 3G6JA 3NMEA 3QUYC 1MQKH 4MAUL 1X5LA 5DHVA 4HUVB 4AIXA 5AG8A 1T2QH 2LU4A 2YWYA 3T0XA 2XN9E 1VKXB 4OB5H 2HJKA 4KFZC 5EIQA 5TFSL 1BLNA 3OAUL 3TCLB 2WNGA 4EVNA 4XPTL 3CUPA 1GGUA 1QSZA 2A38A 3F6LA 4UAOB 5DD5H 3IJYA 4PJEE 3AC0A 4F7TA 4U1JA 1FDLH 3TA3B 2GFBB 5IGXH 4Z0BL 4J3OC 3L5WB 4DOHB 1T1ZB 1JGDB 1B4JL 4EDXB 2Y6SD 2VKWA 3CZFB 3SKMA 1EEZA 4KK6C 4RMUA 4EKXA 5BO1H 1CDGA 1R3IH 4KKCC 2UWEF 2R0KH 4PJIB 4JRXA 4M7KH 1VFBA 4NZUL 1KB5H 5FCSH 5I8EA 2FATH 3WE6B 3VGDA 1EEUA 3B4NA 1YN7B 4Z77B 2GK2A 3QIBA 4P5KA 2HT3C 3D39A 1J8HE 3I2CH 4NM8H 2XT1B 5IW1B 3O2VL 4RMWA 4XI5C 4KTEH 1X5ZA 1DE4A 1X4YA 1MCPH 3EFDH 2EH7H 5IV2B 2H2SD 4J4PC 1ZT4B 1G7QB 3T65B 4HQQH 2DLHA 2YUVA 5D7LA 3HR5B 1UJ3B 5ECJE 4HGWB 3FQNA 3SBWC 3VXSD 1ODAA 1QQDA 2NY2C 1I3VA 2YRLA 4QHLB 5JW4M 4LSVH 5HI3D 4DVBB 2V9QA 5DJDA 3EYSH 4FS0A 2YS4A 2LU7A 1B88A 1EJOH 3T0BA 4FMFA 5I17B 1EXUB 3FN0L 1A6VL 5J13B 2DIBA 1OSPL 3EOAA 2IH3B 4CJ1A 4MNQD 1O7VA 1BIHA 1M7DB 4K23L 4QXGH 3VRJB 4CVUA 1U8JA 1LO5A 3LEXA 2BVOA 4R6UA 4OLUL 3UBXG 3HG1A 5A16A 2X7LB 1U92A 3EOTL 4P5MA 1BF8A 5DVMA 3U6RA 1C7TA 5F7HA 3ECBA 3AGVA 4NHCL 1OAXH 2ZPKL 4RGNC 4EI6B 3CMGA 4P5TD 1Z5LA 4EI5C 2WINB 1HKFA 4M3KB 3QDGE 3QUZA 4D9LL 5F21B 3BRFA 5E94A 4ZNEA 4XVTH 5D96B 5ICZB 2OTUB 3F12B 3MV8B 4LLWA 1Q9KA 1TIUA 4KC3B 4OKVB 4JQVA 1S7UA 3ULUH 2OXHA 2AV7B 1EO8H 4JHBA 2WLYA 3TT1L 3GMNA 2ZJSL 4QY8B 3QWRD 4OLEA 1FGNL 2MHAB 2E6JA 5MEOB 1U8PA 3L7EB 4LVEA 4QHUB 2D7TL 1YMME 4JJHA 1GGIL 4JM2A 4P9MH 1DQDH 2IANE 2VLKE 5DFTA 3R8QA 3ARSA 4OCXH 3TPKA 1FZOA 3OR7B 1MJJB 4U6YA 3FQUA 1I1AB 5C0GA 1CFSB 5C09B 4HIEB 5BW7C 1F6AA 1REIA 3QFDB 1HCVA 2ATPB 2FB4L 5J11B 3QUXC 4XNQB 4F80A 4TUKL 1EAPA 4NO0B 1NDGA 5F8QC 1Q8MA 1KFAH 3PF2A 2DLTA 4J3UA 3I02B 1IQWH 3DXAB 3HE6C 3NIFF 1EERB 4IOIA 1ZHLB 3PWVA 3MUGB 1UM5H 3TIEA 3MOAH 1EIBA 1MCNA 3AS0A 3QO0B 4H20L 1IGYA 4QRSB 4JFFB 2BHUA 1P2CA 4F9PA 2OL3H 1J8KA 3KYAA 3ULVD 1WBZB 5ESQB 2BOBA 4DQOH 4NQCB 4PRIE 4RMSA 2AQ2A 4DEPC 5FUZL 1X6LA 1TZHB 3BJLA 4Y5YB 4ZYKB 5KSBA 1KCUH 3DX7A 2DQFA 1MCIA 3QUKA 2HTKD 2YUXA 4WO4A 4X4XB 4JRYE 5T1LD 5I18L 4TRPL 3PIQB 2DLIA 4XNUH 1U8KA 3H3PL 2EO9A 3C5ZB 1UXWA 3UJJL 1L0YA 1ITBB 1S7QB 5AUMA 2DDQL 2BRRH 3BP6A 5FCUH 2JELH 4IRJD 4MQXC 4ZTOL 1U58B 4M61B 3O4LA 1K5NB 2DS4A 2NLJA 2XIDA 5I1AB 4L4VA 2VDQL 1UB6A 2JIXB 3QWQB 4BQCA 2CRYA 4C56E 4J3XA 5IEHB 4FQXC 3S6CA 4XTRC 4LCIL 3SO5A 2CIKA 1UZ8B 1P4IH 2YPVH 1KIQB 2Z31C 1VGKA 1FL6B 4UDTB 4E41D 5FB8B 1U95A 3RUGA 1XGYH 4NRXB 5F96L 4F7EB 5EO1A 4HXBL 3L7FA 1MRFH 1KIRB 3DV6A 4OM1L 1NBQA 1LEKA 4NKOB 4PJGF 1GIGH 2FBJH 3UMTA 1KLUB 3QFJA 4BH7B 4PJ8B 4NDMA 3SCMC 3LIZH 1CGTA 5EFIA 3RDTD 3IKCB 3DUUA 2AJUL 2H1PL 4ODXB 5LG1A 3QQ9D 1NGYB 1QG3A 5FUCC 4FNLH 2UZYB 1XCQA 4RMRA 3HE7A 5FO7B 2CIIA 1I8IB 3REVB 5E2TL 4HS8L 3IAPA 4JR9L 2Y36H 1NLDH 4RGMB 3T8XB 2XN9D 1BFVL 2XTLA 5EULV 3HNVH 4ZS7H 3TZVC 2HN7A 1G0XA 2O61B 4ESKA 5MI0B 4JHWH 5BOPA 4XPFL 5EOQH 2GJ6D 4YHZL 4LL9A 1GGTA 3EYVB 2YPLB 3FHAA 3Q3GB 4MB5A 1PGRB 2CKBB 4MWFA 4F57L 3KPOA 3H7LA 2YA2A 1T0MB 2AI0H 3MLYH 4JB9H 2I26N 5I1HH 4FOMA 2YMXL 2XZQL 3GMRA 3STLB 1AD0A 1QFWM 3NFSL 1D5B