2GYKA

Crystal structure of the complex of the colicin e9 dnase domain with a mutant immunity protein, imme9 (d51a)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
83
Chain Sequence
b'LKHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSALIYYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin-E9 immunity protein
publication title Crystal structures of the complexes of the Colicin E9 DNase domain with mutant immunity proteins
rcsb
source organism Escherichia coli k12
molecule tags Antibiotic/antibiotic inhibitor
total genus 29
structure length 83
sequence length 83
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gykA00
3GKLC 2K5XA 2JB0A 1EMVA 4QKOA 2JBGA 3GJNA 1GXGA 2GZIA 2GZGA 2VLQA 1CEIA 1AYIA 7CEIA 4UHPB 1BXIA 1ZNVA 2GZJA 2ERHA 1UJZA 1IMQA 1GXHA 2VLOA 2VLNA 2GZFA 3U43A 4F37A 2GYKA 5EW5E 1IMPA 1E0HA 2VLPA 1UNKA 1FR2A 2NO8A 1MZ8A 2K0DX 2JAZA 2WPTA 2GZEA
chains in the Genus database with same CATH superfamily
2AF8A 3MGEA 3RG2A 4XFYA 3CE7A 2KGDA 5F2KA 1ZMBA 3G4SP 7CEIA 2LIUA 2XXMA 5KP7B 3G29A 3M1MA 3DS4A 3CCEP 2N50A 5JPAA 2EHSA 4U0BA 1M6NA 1VQ5P 1S72P 1Z6MA 1GPJA 2MD9A 3GKLC 1VQ9P 4IZ6A 2M8LA 1BAJA 3H0DA 3P05A 1W2BO 2KOQA 2L4BA 4UHPB 2ONTA 4COPA 3CMAP 2GZFA 5EW5E 2MF4A 2OTJP 2JYGA 3LMOA 5F2OA 3CC2P 2LIWA 2EIAA 1K30A 2KG6A 4QKOA 2JBGA 3GJNA 1GXGA 3G21A 2JU1A 2PENA 4U0FA 1M74A 2QNWA 3GZLA 3H47A 1YI2P 2GDXA 1X3OA 4PH0A 1IMPA 2VLPA 1VQ4P 3CMEP 2L6EA 2FVAA 2PNGA 1VQ7P 2KGCA 1L0IA 2CG5B 1AUMA 1HY8A 1Q86Q 1VQ8P 2FQ0A 2XZ1C 2Z45A 4U0DA 2GYKA 1RO2A 2MVUA 2MR8A 2GDYA 3CCUP 1FR2A 1VQKP 2KG8A 1JJ2O 5BS1A 1EOQA 3B4QA 2K5XA 5DCKA 3CCQP 1VQ6P 2GZGA 4BPHA 1D1DA 2QEXP 2GZJA 4GR2A 1NJIQ 2VLNA 1Q82Q 3I56P 2BHVA 1Q81Q 2K92A 1VQPP 2KGEA 1VQMP 4U0AA 2BUOA 4BPGA 3EJBA 5KP8B 3CCVP 2EHTA 3DS2A 3NY7B 3RG6C 1K73Q 4U0EA 2MY5A 2CWOA 2Z44A 2AFEA 2CQ8A 1L0HA 2L9FA 2E1MA 4CA3A 2GZIA 3E2DA 1BXIA 1ZNVA 3B5IA 2PEIA 2XZ0D 2AVAA 3G28A 1YHQP 2FHSC 2DGYA 1IUQA 3G1IA 3G0VA 2JB0A 2KOSA 2LTEA 1DNYA 1CEIA 3DS5A 1RNIA 4F37A 1EIAA 2KR5A 3DTJA 4H2WC 1M90Q 2PEOA 2P9XA 3I55P 2LL8A 2FQ1A 2N5HA 4HKGA 2JU2A 2Z46A 2FVFA 1IMQA 2FACA 3DS0A 1YIJP 2XT1A 4WYMA 2N5IA 3EJEA 1E0HA 2L0QA 4XRQA 2DNWA 2KORA 4H2YC 2GZEA 1AF8A 2PEQA 4XROA 1K9MQ 1M1KQ 1KLPA 3NTEA 4XFZA 2MVVA 2JQ4A 2MR7A 5BS2A 1Q7YQ 2N6YA 2ERHA 2VLOA 5HVCA 2JGPA 4QNBA 2ROQA 1KD1Q 1KC8Q 5KP6B 1YJ9P 3CC7P 3VRLC 2LMLA 2K93A 2QA4P 1E6JP 3DS1A 1EMVA 3EJDA 3CD6P 4GR6A 4PXHB 3DPHA 5HGOA 4DG9A 3CXCO 1VKUA 1N8RQ 4M0IA 2KGAA 1M6EX 2KWLA 5F2NA 3WBHA 2PY8A 2M5RA 2PEKA 2M8NA 4PWVB 2EFJA 2L22A 2X2BA 1A8OA 3Q20A 3CCLP 3G6EP 1VQLP 2GDWA 2VSQA 4U0CA 3CCJP 5EJDA 2LOLA 2M8PA 3G71P 2FADA 2PEMA 1RO0A 2KW2A 2AFDA 2LPKA 2KOOA 4NEOA 2VLQA 4IPYA 2OTLP 4H2XC 2FAEA 3G1GA 2KG9A 2LF4A 2K2QA 5HV8A 2OARA 1KQSO 1K8AQ 1OR5A 2LKIA 2CNRA 2PEJA 4MRTC 2EG5A 5HGNA 5HGMA 1AYIA 2KODA 5HGLA 3OW2O 1YITP 2CGQA 2K94A 1GXHA 3CCRP 1YJWP 3CC4P 4PH1A 4R0MA 1F80D 2K0XA 3LRYA 1UNKA 1NQ4A 2NO8A 2K0DX 2JAZA 3G26A 1VQOP 1VQNP 1UJZA 1T8KA 2K0YA 3U43A 3CPWO 3CCMP 1A43A 2WPTA 1HQBA 3DS3A 1QVGO 2N6ZA 1DV5A 3H4EA 3CCSP 2XV6A 2KOPA 1QRJA 2JO0A 1YJNP 2N98A 3HYBA 4BPFA 2JYLA 1ACPA 3GZMA 5CZDB 1QVFO 1VHNA 1MZ8A 4COCA 5I4TG 4XFXA 2FVEA 2FQ2A 3HZQA
chains in the Genus database with same CATH topology
3GKLC 2K5XA 2JB0A 1EMVA 4QKOA 2JBGA 3GJNA 1GXGA 2GZIA 2GZGA 2VLQA 1CEIA 1AYIA 7CEIA 4UHPB 1BXIA 1ZNVA 2GZJA 2ERHA 1UJZA 1IMQA 1GXHA 2VLOA 2VLNA 2GZFA 3U43A 4F37A 2GYKA 5EW5E 1IMPA 1E0HA 2VLPA 1UNKA 1FR2A 2NO8A 1MZ8A 2K0DX 2JAZA 2WPTA 2GZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKL C;  2K5X A;  2JB0 A;  1EMV A;  4QKO A;  2JBG A;  3GJN A;  1GXG A;  2GZI A;  2GZG A;  2VLQ A;  1CEI A;  1AYI A;  7CEI A;  4UHP B;  1BXI A;  1ZNV A;  2GZJ A;  2ERH A;  1UJZ A;  1IMQ A;  1GXH A;  2VLO A;  2VLN A;  2GZF A;  3U43 A;  4F37 A;  2GYK A;  5EW5 E;  1IMP A;  1E0H A;  2VLP A;  1UNK A;  1FR2 A;  2NO8 A;  1MZ8 A;  2K0D X;  2JAZ A;  2WPT A;  2GZE A; 
#chains in the Genus database with same CATH topology
 2AF8 A;  3MGE A;  3RG2 A;  4XFY A;  3CE7 A;  2KGD A;  5F2K A;  1ZMB A;  3G4S P;  7CEI A;  2LIU A;  2XXM A;  5KP7 B;  3G29 A;  3M1M A;  3DS4 A;  3CCE P;  2N50 A;  5JPA A;  2EHS A;  4U0B A;  1M6N A;  1VQ5 P;  1S72 P;  1Z6M A;  1GPJ A;  2MD9 A;  3GKL C;  1VQ9 P;  4IZ6 A;  2M8L A;  1BAJ A;  3H0D A;  3P05 A;  1W2B O;  2KOQ A;  2L4B A;  4UHP B;  2ONT A;  4COP A;  3CMA P;  2GZF A;  5EW5 E;  2MF4 A;  2OTJ P;  2JYG A;  3LMO A;  5F2O A;  3CC2 P;  2LIW A;  2EIA A;  1K30 A;  2KG6 A;  4QKO A;  2JBG A;  3GJN A;  1GXG A;  3G21 A;  2JU1 A;  2PEN A;  4U0F A;  1M74 A;  2QNW A;  3GZL A;  3H47 A;  1YI2 P;  2GDX A;  1X3O A;  4PH0 A;  1IMP A;  2VLP A;  1VQ4 P;  3CME P;  2L6E A;  2FVA A;  2PNG A;  1VQ7 P;  2KGC A;  1L0I A;  2CG5 B;  1AUM A;  1HY8 A;  1Q86 Q;  1VQ8 P;  2FQ0 A;  2XZ1 C;  2Z45 A;  4U0D A;  2GYK A;  1RO2 A;  2MVU A;  2MR8 A;  2GDY A;  3CCU P;  1FR2 A;  1VQK P;  2KG8 A;  1JJ2 O;  5BS1 A;  1EOQ A;  3B4Q A;  2K5X A;  5DCK A;  3CCQ P;  1VQ6 P;  2GZG A;  4BPH A;  1D1D A;  2QEX P;  2GZJ A;  4GR2 A;  1NJI Q;  2VLN A;  1Q82 Q;  3I56 P;  2BHV A;  1Q81 Q;  2K92 A;  1VQP P;  2KGE A;  1VQM P;  4U0A A;  2BUO A;  4BPG A;  3EJB A;  5KP8 B;  3CCV P;  2EHT A;  3DS2 A;  3NY7 B;  3RG6 C;  1K73 Q;  4U0E A;  2MY5 A;  2CWO A;  2Z44 A;  2AFE A;  2CQ8 A;  1L0H A;  2L9F A;  2E1M A;  4CA3 A;  2GZI A;  3E2D A;  1BXI A;  1ZNV A;  3B5I A;  2PEI A;  2XZ0 D;  2AVA A;  3G28 A;  1YHQ P;  2FHS C;  2DGY A;  1IUQ A;  3G1I A;  3G0V A;  2JB0 A;  2KOS A;  2LTE A;  1DNY A;  1CEI A;  3DS5 A;  1RNI A;  4F37 A;  1EIA A;  2KR5 A;  3DTJ A;  4H2W C;  1M90 Q;  2PEO A;  2P9X A;  3I55 P;  2LL8 A;  2FQ1 A;  2N5H A;  4HKG A;  2JU2 A;  2Z46 A;  2FVF A;  1IMQ A;  2FAC A;  3DS0 A;  1YIJ P;  2XT1 A;  4WYM A;  2N5I A;  3EJE A;  1E0H A;  2L0Q A;  4XRQ A;  2DNW A;  2KOR A;  4H2Y C;  2GZE A;  1AF8 A;  2PEQ A;  4XRO A;  1K9M Q;  1M1K Q;  1KLP A;  3NTE A;  4XFZ A;  2MVV A;  2JQ4 A;  2MR7 A;  5BS2 A;  1Q7Y Q;  2N6Y A;  2ERH A;  2VLO A;  5HVC A;  2JGP A;  4QNB A;  2ROQ A;  1KD1 Q;  1KC8 Q;  5KP6 B;  1YJ9 P;  3CC7 P;  3VRL C;  2LML A;  2K93 A;  2QA4 P;  1E6J P;  3DS1 A;  1EMV A;  3EJD A;  3CD6 P;  4GR6 A;  4PXH B;  3DPH A;  5HGO A;  4DG9 A;  3CXC O;  1VKU A;  1N8R Q;  4M0I A;  2KGA A;  1M6E X;  2KWL A;  5F2N A;  3WBH A;  2PY8 A;  2M5R A;  2PEK A;  2M8N A;  4PWV B;  2EFJ A;  2L22 A;  2X2B A;  1A8O A;  3Q20 A;  3CCL P;  3G6E P;  1VQL P;  2GDW A;  2VSQ A;  4U0C A;  3CCJ P;  5EJD A;  2LOL A;  2M8P A;  3G71 P;  2FAD A;  2PEM A;  1RO0 A;  2KW2 A;  2AFD A;  2LPK A;  2KOO A;  4NEO A;  2VLQ A;  4IPY A;  2OTL P;  4H2X C;  2FAE A;  3G1G A;  2KG9 A;  2LF4 A;  2K2Q A;  5HV8 A;  2OAR A;  1KQS O;  1K8A Q;  1OR5 A;  2LKI A;  2CNR A;  2PEJ A;  4MRT C;  2EG5 A;  5HGN A;  5HGM A;  1AYI A;  2KOD A;  5HGL A;  3OW2 O;  1YIT P;  2CGQ A;  2K94 A;  1GXH A;  3CCR P;  1YJW P;  3CC4 P;  4PH1 A;  4R0M A;  1F80 D;  2K0X A;  3LRY A;  1UNK A;  1NQ4 A;  2NO8 A;  2K0D X;  2JAZ A;  3G26 A;  1VQO P;  1VQN P;  1UJZ A;  1T8K A;  2K0Y A;  3U43 A;  3CPW O;  3CCM P;  1A43 A;  2WPT A;  1HQB A;  3DS3 A;  1QVG O;  2N6Z A;  1DV5 A;  3H4E A;  3CCS P;  2XV6 A;  2KOP A;  1QRJ A;  2JO0 A;  1YJN P;  2N98 A;  3HYB A;  4BPF A;  2JYL A;  1ACP A;  3GZM A;  5CZD B;  1QVF O;  1VHN A;  1MZ8 A;  4COC A;  5I4T G;  4XFX A;  2FVE A;  2FQ2 A;  3HZQ A; 
#chains in the Genus database with same CATH homology
 3GKL C;  2K5X A;  2JB0 A;  1EMV A;  4QKO A;  2JBG A;  3GJN A;  1GXG A;  2GZI A;  2GZG A;  2VLQ A;  1CEI A;  1AYI A;  7CEI A;  4UHP B;  1BXI A;  1ZNV A;  2GZJ A;  2ERH A;  1UJZ A;  1IMQ A;  1GXH A;  2VLO A;  2VLN A;  2GZF A;  3U43 A;  4F37 A;  2GYK A;  5EW5 E;  1IMP A;  1E0H A;  2VLP A;  1UNK A;  1FR2 A;  2NO8 A;  1MZ8 A;  2K0D X;  2JAZ A;  2WPT A;  2GZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...