2GYKA

Crystal structure of the complex of the colicin e9 dnase domain with a mutant immunity protein, imme9 (d51a)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
83
Chain Sequence
LKHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSALIYYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the complexes of the Colicin E9 DNase domain with mutant immunity proteins
rcsb
source organism Escherichia coli k12
molecule tags Antibiotic/antibiotic inhibitor
molecule keywords Colicin-E9 immunity protein
total genus 29
structure length 83
sequence length 83
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gykA00
1EMVA 2GZIA 5EW5E 1AYIA 2GZJA 1FR2A 2JB0A 2VLNA 1GXHA 2NO8A 2GZGA 2VLOA 3GKLC 2VLQA 1E0HA 4UHPB 2ERHA 2JAZA 2VLPA 1UJZA 1UNKA 1IMQA 2WPTA 1IMPA 2GZFA 1ZNVA 1BXIA 2JBGA 2K5XA 7CEIA 2GYKA 1CEIA 4QKOA 3U43A 3GJNA 1MZ8A 2K0DX 2GZEA 1GXGA 4F37A
chains in the Genus database with same CATH superfamily
4H2XC 5KP8B 5HGNA 1GPJA 1T8KA 2Z44A 2GDXA 4H2YC 2AF8A 1HQBA 3CD6P 2FQ0A 1IMPA 2FQ2A 2K92A 1YI2P 1YIJP 2E1MA 2PEJA 3EJDA 5EJDA 5KP6B 2LTEA 1ACPA 2PEQA 1VQ6P 3G1IA 2EIAA 2JU1A 2MY5A 1UNKA 1A43A 3CMAP 2JBGA 3CC7P 3CCRP 2XZ1C 4MRTC 1Q7YQ 2AFEA 2LL8A 1KC8Q 2KR5A 1M6EX 5EW5E 1AF8A 2KOOA 5HGLA 3GZLA 2VLPA 1L0IA 3H0DA 1IMQA 3CCQP 2K5XA 3U43A 2XZ0D 1YITP 2GDWA 2PEMA 3B5IA 4F37A 2L9FA 1EMVA 3NY7B 3CCMP 4BPHA 1F80D 3G0VA 3RG2A 4U0FA 1BAJA 2EHSA 2GDYA 2KW2A 3DS4A 2L6EA 3CE7A 1Q82Q 4QKOA 1MZ8A 1DNYA 2N5IA 3HZQA 4PWVB 2AVAA 2OTLP 4XFZA 3G26A 2LPKA 2JB0A 1YJ9P 2PEIA 2JAZA 4U0EA 5HGOA 4WYMA 1ZNVA 1D1DA 3CCSP 3P05A 2N6ZA 5HVCA 1Q81Q 1K30A 1VQ8P 2K0YA 2FHSC 2KGCA 4DG9A 3DS5A 2CNRA 5HV8A 3LMOA 1BXIA 2QEXP 2FQ1A 2KOSA 2GYKA 2N98A 2KG8A 2EHTA 1GXGA 2LIWA 2M8LA 2GZIA 5F2KA 1S72P 2M5RA 3CMEP 2LF4A 2ROQA 1YJNP 1E6JP 1KD1Q 3DS2A 2LMLA 5JPAA 2MVVA 1K9MQ 3EJEA 1EOQA 3GJNA 1IUQA 2FADA 2PNGA 3G71P 1KQSO 2CG5B 4IZ6A 1NJIQ 5DCKA 3Q20A 1AYIA 2DGYA 3GKLC 2M8PA 2VLQA 3DTJA 1RO0A 3WBHA 1VQ9P 2KG9A 3RG6C 2XT1A 1VQKP 1M74A 3B4QA 2Z46A 1QRJA 4NEOA 1VHNA 2JO0A 2X2BA 3M1MA 4R0MA 1YJWP 2CWOA 3CCLP 2MR7A 2PY8A 2LKIA 2WPTA 2KWLA 2LIUA 2KORA 2KOPA 1A8OA 7CEIA 2GZEA 1JJ2O 5F2OA 1ZMBA 4M0IA 2CGQA 2MD9A 4XFYA 3G6EP 4XFXA 3OW2O 2KG6A 1GXHA 2VLOA 2JYGA 2JGPA 2ERHA 1VQ4P 2ONTA 3CXCO 2MVUA 2GZFA 2L22A 3CC4P 1QVFO 1M6NA 4XRQA 3I55P 2K0DX 5F2NA 1VKUA 2M8NA 2PENA 3G1GA 2L4BA 2JYLA 2N50A 3CPWO 5KP7B 1NQ4A 1RO2A 3H47A 4GR2A 3CC2P 1VQNP 4CA3A 1HY8A 3MGEA 3NTEA 1L0HA 5I4TG 1RNIA 4XROA 2DNWA 3LRYA 1VQLP 3DS1A 1QVGO 1YHQP 2EG5A 2FAEA 2BUOA 1M90Q 3DS3A 2VSQA 2EFJA 2GZGA 1VQ5P 2Z45A 2N6YA 4IPYA 2KOQA 3I56P 2K94A 2FACA 1K8AQ 3GZMA 2OARA 2CQ8A 3H4EA 1W2BO 1FR2A 2GZJA 5BS1A 1Z6MA 4BPGA 2QA4P 2QNWA 1VQMP 1DV5A 4GR6A 3CCUP 2FVAA 4U0AA 2KGAA 3VRLC 2OTJP 1VQPP 4PXHB 4BPFA 4PH0A 2VLNA 2N5HA 1M1KQ 3G21A 4HKGA 3G4SP 2L0QA 2KGDA 1UJZA 2PEOA 2BHVA 4PH1A 2AFDA 1VQ7P 1CEIA 2MR8A 1N8RQ 1VQOP 2KGEA 1Q86Q 2LOLA 5BS2A 3G28A 2NO8A 2PEKA 4UHPB 4U0CA 2FVFA 3EJBA 1EIAA 5CZDB 2JU2A 4QNBA 1AUMA 1K73Q 2XXMA 1OR5A 2K0XA 5HGMA 4H2WC 4COPA 3E2DA 3DPHA 3G29A 3CCEP 2P9XA 2KODA 1E0HA 2FVEA 4U0BA 1X3OA 3HYBA 4U0DA 2K93A 3DS0A 3CCJP 3CCVP 2K2QA 1KLPA 2XV6A 2JQ4A 4COCA 2MF4A
chains in the Genus database with same CATH topology
1EMVA 2GZIA 5EW5E 1AYIA 2GZJA 1FR2A 2JB0A 2VLNA 1GXHA 2NO8A 2GZGA 2VLOA 3GKLC 2VLQA 1E0HA 4UHPB 2ERHA 2JAZA 2VLPA 1UJZA 1UNKA 1IMQA 2WPTA 1IMPA 2GZFA 1ZNVA 1BXIA 2JBGA 2K5XA 7CEIA 2GYKA 1CEIA 4QKOA 3U43A 3GJNA 1MZ8A 2K0DX 2GZEA 1GXGA 4F37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EMV A;  2GZI A;  5EW5 E;  1AYI A;  2GZJ A;  1FR2 A;  2JB0 A;  2VLN A;  1GXH A;  2NO8 A;  2GZG A;  2VLO A;  3GKL C;  2VLQ A;  1E0H A;  4UHP B;  2ERH A;  2JAZ A;  2VLP A;  1UJZ A;  1UNK A;  1IMQ A;  2WPT A;  1IMP A;  2GZF A;  1ZNV A;  1BXI A;  2JBG A;  2K5X A;  7CEI A;  2GYK A;  1CEI A;  4QKO A;  3U43 A;  3GJN A;  1MZ8 A;  2K0D X;  2GZE A;  1GXG A;  4F37 A; 
#chains in the Genus database with same CATH topology
 4H2X C;  5KP8 B;  5HGN A;  1GPJ A;  1T8K A;  2Z44 A;  2GDX A;  4H2Y C;  2AF8 A;  1HQB A;  3CD6 P;  2FQ0 A;  1IMP A;  2FQ2 A;  2K92 A;  1YI2 P;  1YIJ P;  2E1M A;  2PEJ A;  3EJD A;  5EJD A;  5KP6 B;  2LTE A;  1ACP A;  2PEQ A;  1VQ6 P;  3G1I A;  2EIA A;  2JU1 A;  2MY5 A;  1UNK A;  1A43 A;  3CMA P;  2JBG A;  3CC7 P;  3CCR P;  2XZ1 C;  4MRT C;  1Q7Y Q;  2AFE A;  2LL8 A;  1KC8 Q;  2KR5 A;  1M6E X;  5EW5 E;  1AF8 A;  2KOO A;  5HGL A;  3GZL A;  2VLP A;  1L0I A;  3H0D A;  1IMQ A;  3CCQ P;  2K5X A;  3U43 A;  2XZ0 D;  1YIT P;  2GDW A;  2PEM A;  3B5I A;  4F37 A;  2L9F A;  1EMV A;  3NY7 B;  3CCM P;  4BPH A;  1F80 D;  3G0V A;  3RG2 A;  4U0F A;  1BAJ A;  2EHS A;  2GDY A;  2KW2 A;  3DS4 A;  2L6E A;  3CE7 A;  1Q82 Q;  4QKO A;  1MZ8 A;  1DNY A;  2N5I A;  3HZQ A;  4PWV B;  2AVA A;  2OTL P;  4XFZ A;  3G26 A;  2LPK A;  2JB0 A;  1YJ9 P;  2PEI A;  2JAZ A;  4U0E A;  5HGO A;  4WYM A;  1ZNV A;  1D1D A;  3CCS P;  3P05 A;  2N6Z A;  5HVC A;  1Q81 Q;  1K30 A;  1VQ8 P;  2K0Y A;  2FHS C;  2KGC A;  4DG9 A;  3DS5 A;  2CNR A;  5HV8 A;  3LMO A;  1BXI A;  2QEX P;  2FQ1 A;  2KOS A;  2GYK A;  2N98 A;  2KG8 A;  2EHT A;  1GXG A;  2LIW A;  2M8L A;  2GZI A;  5F2K A;  1S72 P;  2M5R A;  3CME P;  2LF4 A;  2ROQ A;  1YJN P;  1E6J P;  1KD1 Q;  3DS2 A;  2LML A;  5JPA A;  2MVV A;  1K9M Q;  3EJE A;  1EOQ A;  3GJN A;  1IUQ A;  2FAD A;  2PNG A;  3G71 P;  1KQS O;  2CG5 B;  4IZ6 A;  1NJI Q;  5DCK A;  3Q20 A;  1AYI A;  2DGY A;  3GKL C;  2M8P A;  2VLQ A;  3DTJ A;  1RO0 A;  3WBH A;  1VQ9 P;  2KG9 A;  3RG6 C;  2XT1 A;  1VQK P;  1M74 A;  3B4Q A;  2Z46 A;  1QRJ A;  4NEO A;  1VHN A;  2JO0 A;  2X2B A;  3M1M A;  4R0M A;  1YJW P;  2CWO A;  3CCL P;  2MR7 A;  2PY8 A;  2LKI A;  2WPT A;  2KWL A;  2LIU A;  2KOR A;  2KOP A;  1A8O A;  7CEI A;  2GZE A;  1JJ2 O;  5F2O A;  1ZMB A;  4M0I A;  2CGQ A;  2MD9 A;  4XFY A;  3G6E P;  4XFX A;  3OW2 O;  2KG6 A;  1GXH A;  2VLO A;  2JYG A;  2JGP A;  2ERH A;  1VQ4 P;  2ONT A;  3CXC O;  2MVU A;  2GZF A;  2L22 A;  3CC4 P;  1QVF O;  1M6N A;  4XRQ A;  3I55 P;  2K0D X;  5F2N A;  1VKU A;  2M8N A;  2PEN A;  3G1G A;  2L4B A;  2JYL A;  2N50 A;  3CPW O;  5KP7 B;  1NQ4 A;  1RO2 A;  3H47 A;  4GR2 A;  3CC2 P;  1VQN P;  4CA3 A;  1HY8 A;  3MGE A;  3NTE A;  1L0H A;  5I4T G;  1RNI A;  4XRO A;  2DNW A;  3LRY A;  1VQL P;  3DS1 A;  1QVG O;  1YHQ P;  2EG5 A;  2FAE A;  2BUO A;  1M90 Q;  3DS3 A;  2VSQ A;  2EFJ A;  2GZG A;  1VQ5 P;  2Z45 A;  2N6Y A;  4IPY A;  2KOQ A;  3I56 P;  2K94 A;  2FAC A;  1K8A Q;  3GZM A;  2OAR A;  2CQ8 A;  3H4E A;  1W2B O;  1FR2 A;  2GZJ A;  5BS1 A;  1Z6M A;  4BPG A;  2QA4 P;  2QNW A;  1VQM P;  1DV5 A;  4GR6 A;  3CCU P;  2FVA A;  4U0A A;  2KGA A;  3VRL C;  2OTJ P;  1VQP P;  4PXH B;  4BPF A;  4PH0 A;  2VLN A;  2N5H A;  1M1K Q;  3G21 A;  4HKG A;  3G4S P;  2L0Q A;  2KGD A;  1UJZ A;  2PEO A;  2BHV A;  4PH1 A;  2AFD A;  1VQ7 P;  1CEI A;  2MR8 A;  1N8R Q;  1VQO P;  2KGE A;  1Q86 Q;  2LOL A;  5BS2 A;  3G28 A;  2NO8 A;  2PEK A;  4UHP B;  4U0C A;  2FVF A;  3EJB A;  1EIA A;  5CZD B;  2JU2 A;  4QNB A;  1AUM A;  1K73 Q;  2XXM A;  1OR5 A;  2K0X A;  5HGM A;  4H2W C;  4COP A;  3E2D A;  3DPH A;  3G29 A;  3CCE P;  2P9X A;  2KOD A;  1E0H A;  2FVE A;  4U0B A;  1X3O A;  3HYB A;  4U0D A;  2K93 A;  3DS0 A;  3CCJ P;  3CCV P;  2K2Q A;  1KLP A;  2XV6 A;  2JQ4 A;  4COC A;  2MF4 A; 
#chains in the Genus database with same CATH homology
 1EMV A;  2GZI A;  5EW5 E;  1AYI A;  2GZJ A;  1FR2 A;  2JB0 A;  2VLN A;  1GXH A;  2NO8 A;  2GZG A;  2VLO A;  3GKL C;  2VLQ A;  1E0H A;  4UHP B;  2ERH A;  2JAZ A;  2VLP A;  1UJZ A;  1UNK A;  1IMQ A;  2WPT A;  1IMP A;  2GZF A;  1ZNV A;  1BXI A;  2JBG A;  2K5X A;  7CEI A;  2GYK A;  1CEI A;  4QKO A;  3U43 A;  3GJN A;  1MZ8 A;  2K0D X;  2GZE A;  1GXG A;  4F37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...