2GYKA

Crystal structure of the complex of the colicin e9 dnase domain with a mutant immunity protein, imme9 (d51a)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
83
Chain Sequence
LKHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSALIYYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin-E9 immunity protein
publication title Crystal structures of the complexes of the Colicin E9 DNase domain with mutant immunity proteins
rcsb
source organism Escherichia coli k12
molecule tags Antibiotic/antibiotic inhibitor
total genus 29
structure length 83
sequence length 83
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gykA00
2JAZA 3U43A 2GZFA 7CEIA 1IMQA 2GZJA 3GKLC 1ZNVA 1GXGA 2VLQA 1E0HA 2VLPA 2JB0A 4F37A 1IMPA 3GJNA 1UJZA 2ERHA 1GXHA 2K0DX 2GYKA 2GZEA 2VLNA 2WPTA 5EW5E 1EMVA 1FR2A 1UNKA 2GZIA 1CEIA 4UHPB 2JBGA 2GZGA 2NO8A 4QKOA 1AYIA 1MZ8A 2VLOA 2K5XA 1BXIA
chains in the Genus database with same CATH superfamily
2CG5B 2JO0A 5KP7B 2CQ8A 1GXGA 2N6ZA 1KC8Q 2FVFA 1VQ5P 1Q86Q 4NEOA 1QVGO 2VLNA 4PH0A 4U0AA 1FR2A 4COPA 2OTLP 4H2WC 2KGDA 3G0VA 2N5HA 1NJIQ 2JAZA 2GDXA 1ZMBA 4H2YC 2LIWA 2L4BA 1UJZA 2KR5A 2KOOA 2JU2A 1ACPA 3DS0A 2M8PA 2KGEA 4GR6A 2NO8A 4BPFA 2K0YA 2VLOA 4M0IA 4COCA 3H47A 1E6JP 2VLPA 2MR8A 3CC2P 1S72P 2JYLA 1M74A 4WYMA 3E2DA 3G6EP 1M6NA 2MF4A 5HGMA 3DS2A 1VQMP 3CC7P 1HY8A 1F80D 4BPHA 1L0IA 2LKIA 3EJBA 3CC4P 2LOLA 2JB0A 1K30A 3GJNA 2PY8A 2N50A 1YJWP 2GZIA 2BUOA 4CA3A 2N6YA 2GZGA 2FHSC 1AYIA 2FQ1A 2FQ2A 3CCRP 2EFJA 3CMAP 5CZDB 1KD1Q 2BHVA 2M8NA 2Z44A 3DS4A 2PEMA 1K9MQ 3NTEA 2K0DX 2CWOA 1A43A 3I55P 2WPTA 1Q82Q 2XXMA 2CNRA 4R0MA 2PENA 2KWLA 3DPHA 1Q81Q 1YJ9P 3GZMA 2KG6A 2ONTA 2DGYA 2PNGA 2JU1A 2L22A 1K73Q 5JPAA 2K0XA 4UHPB 2EHTA 4H2XC 2L9FA 2CGQA 2EHSA 3U43A 3HYBA 1VQ4P 2PEIA 1VQKP 2FVAA 3LRYA 2OTJP 1IMPA 3EJEA 3G4SP 2FAEA 2MVVA 2AF8A 4HKGA 1VQ7P 3DS3A 4QKOA 1Q7YQ 3B4QA 2KOPA 1E0HA 5F2KA 1VQPP 1RNIA 2JQ4A 2PEQA 3VRLC 3CCSP 2E1MA 2AFEA 2EG5A 2KOSA 2QA4P 1KLPA 2KORA 1VQ8P 4F37A 5F2NA 1YITP 1OR5A 4PXHB 2GYKA 2GZEA 2KG9A 2FACA 2GDYA 5KP6B 1UNKA 1RO2A 2XZ1C 4IZ6A 4U0DA 1KQSO 1MZ8A 1JJ2O 5BS2A 3WBHA 7CEIA 4PWVB 2GZJA 2X2BA 2L0QA 5BS1A 1Z6MA 4XFYA 3I56P 2ERHA 2JGPA 3LMOA 4IPYA 3CCQP 3CMEP 3CCMP 2XZ0D 1GPJA 1VHNA 3H4EA 4U0FA 3CCJP 1AF8A 2EIAA 1CEIA 3G29A 4XFZA 3H0DA 2FADA 3G1IA 2LF4A 4MRTC 5DCKA 2P9XA 2N98A 3CCVP 1VQLP 1L0HA 2M8LA 3OW2O 4BPGA 1RO0A 3G26A 5HGLA 2LTEA 5HVCA 2KW2A 2M5RA 2K5XA 2PEKA 1BXIA 3NY7B 3CCLP 1W2BO 1ZNVA 2LL8A 5HGNA 3GZLA 1EOQA 3DTJA 5HGOA 1VQ9P 1QVFO 2KOQA 2QEXP 2DNWA 4DG9A 1VQ6P 2FQ0A 1EIAA 3HZQA 2MD9A 3CD6P 3B5IA 2JYGA 3DS1A 2K92A 1VQNP 1M6EX 2KGCA 4U0BA 2XT1A 4XFXA 2N5IA 1HQBA 5EW5E 1EMVA 3M1MA 3G1GA 2Z45A 2JBGA 2XV6A 2PEJA 4XRQA 5I4TG 2Z46A 5HV8A 4GR2A 2GZFA 3EJDA 1T8KA 4PH1A 2KODA 2AFDA 1N8RQ 1VKUA 4XROA 5EJDA 3CPWO 1X3OA 2VSQA 2MR7A 2KG8A 3CCEP 1K8AQ 1M90Q 3CE7A 3RG6C 3RG2A 3Q20A 2K2QA 1DNYA 2L6EA 2MVUA 3GKLC 3G21A 4QNBA 4U0CA 2VLQA 4U0EA 1YI2P 1IUQA 1QRJA 3DS5A 3MGEA 1NQ4A 1YIJP 2MY5A 2LPKA 1AUMA 2GDWA 1BAJA 5KP8B 1A8OA 3CXCO 2K94A 2LIUA 2FVEA 1YJNP 3G28A 2LMLA 5F2OA 1IMQA 1DV5A 2AVAA 1D1DA 2KGAA 2K93A 3CCUP 1VQOP 3G71P 1GXHA 2PEOA 1YHQP 3P05A 1M1KQ 2OARA 2QNWA 2ROQA
chains in the Genus database with same CATH topology
2JAZA 3U43A 2GZFA 7CEIA 1IMQA 2GZJA 3GKLC 1ZNVA 1GXGA 2VLQA 1E0HA 2VLPA 2JB0A 4F37A 1IMPA 3GJNA 1UJZA 2ERHA 1GXHA 2K0DX 2GYKA 2GZEA 2VLNA 2WPTA 5EW5E 1EMVA 1FR2A 1UNKA 2GZIA 1CEIA 4UHPB 2JBGA 2GZGA 2NO8A 4QKOA 1AYIA 1MZ8A 2VLOA 2K5XA 1BXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JAZ A;  3U43 A;  2GZF A;  7CEI A;  1IMQ A;  2GZJ A;  3GKL C;  1ZNV A;  1GXG A;  2VLQ A;  1E0H A;  2VLP A;  2JB0 A;  4F37 A;  1IMP A;  3GJN A;  1UJZ A;  2ERH A;  1GXH A;  2K0D X;  2GYK A;  2GZE A;  2VLN A;  2WPT A;  5EW5 E;  1EMV A;  1FR2 A;  1UNK A;  2GZI A;  1CEI A;  4UHP B;  2JBG A;  2GZG A;  2NO8 A;  4QKO A;  1AYI A;  1MZ8 A;  2VLO A;  2K5X A;  1BXI A; 
#chains in the Genus database with same CATH topology
 2CG5 B;  2JO0 A;  5KP7 B;  2CQ8 A;  1GXG A;  2N6Z A;  1KC8 Q;  2FVF A;  1VQ5 P;  1Q86 Q;  4NEO A;  1QVG O;  2VLN A;  4PH0 A;  4U0A A;  1FR2 A;  4COP A;  2OTL P;  4H2W C;  2KGD A;  3G0V A;  2N5H A;  1NJI Q;  2JAZ A;  2GDX A;  1ZMB A;  4H2Y C;  2LIW A;  2L4B A;  1UJZ A;  2KR5 A;  2KOO A;  2JU2 A;  1ACP A;  3DS0 A;  2M8P A;  2KGE A;  4GR6 A;  2NO8 A;  4BPF A;  2K0Y A;  2VLO A;  4M0I A;  4COC A;  3H47 A;  1E6J P;  2VLP A;  2MR8 A;  3CC2 P;  1S72 P;  2JYL A;  1M74 A;  4WYM A;  3E2D A;  3G6E P;  1M6N A;  2MF4 A;  5HGM A;  3DS2 A;  1VQM P;  3CC7 P;  1HY8 A;  1F80 D;  4BPH A;  1L0I A;  2LKI A;  3EJB A;  3CC4 P;  2LOL A;  2JB0 A;  1K30 A;  3GJN A;  2PY8 A;  2N50 A;  1YJW P;  2GZI A;  2BUO A;  4CA3 A;  2N6Y A;  2GZG A;  2FHS C;  1AYI A;  2FQ1 A;  2FQ2 A;  3CCR P;  2EFJ A;  3CMA P;  5CZD B;  1KD1 Q;  2BHV A;  2M8N A;  2Z44 A;  3DS4 A;  2PEM A;  1K9M Q;  3NTE A;  2K0D X;  2CWO A;  1A43 A;  3I55 P;  2WPT A;  1Q82 Q;  2XXM A;  2CNR A;  4R0M A;  2PEN A;  2KWL A;  3DPH A;  1Q81 Q;  1YJ9 P;  3GZM A;  2KG6 A;  2ONT A;  2DGY A;  2PNG A;  2JU1 A;  2L22 A;  1K73 Q;  5JPA A;  2K0X A;  4UHP B;  2EHT A;  4H2X C;  2L9F A;  2CGQ A;  2EHS A;  3U43 A;  3HYB A;  1VQ4 P;  2PEI A;  1VQK P;  2FVA A;  3LRY A;  2OTJ P;  1IMP A;  3EJE A;  3G4S P;  2FAE A;  2MVV A;  2AF8 A;  4HKG A;  1VQ7 P;  3DS3 A;  4QKO A;  1Q7Y Q;  3B4Q A;  2KOP A;  1E0H A;  5F2K A;  1VQP P;  1RNI A;  2JQ4 A;  2PEQ A;  3VRL C;  3CCS P;  2E1M A;  2AFE A;  2EG5 A;  2KOS A;  2QA4 P;  1KLP A;  2KOR A;  1VQ8 P;  4F37 A;  5F2N A;  1YIT P;  1OR5 A;  4PXH B;  2GYK A;  2GZE A;  2KG9 A;  2FAC A;  2GDY A;  5KP6 B;  1UNK A;  1RO2 A;  2XZ1 C;  4IZ6 A;  4U0D A;  1KQS O;  1MZ8 A;  1JJ2 O;  5BS2 A;  3WBH A;  7CEI A;  4PWV B;  2GZJ A;  2X2B A;  2L0Q A;  5BS1 A;  1Z6M A;  4XFY A;  3I56 P;  2ERH A;  2JGP A;  3LMO A;  4IPY A;  3CCQ P;  3CME P;  3CCM P;  2XZ0 D;  1GPJ A;  1VHN A;  3H4E A;  4U0F A;  3CCJ P;  1AF8 A;  2EIA A;  1CEI A;  3G29 A;  4XFZ A;  3H0D A;  2FAD A;  3G1I A;  2LF4 A;  4MRT C;  5DCK A;  2P9X A;  2N98 A;  3CCV P;  1VQL P;  1L0H A;  2M8L A;  3OW2 O;  4BPG A;  1RO0 A;  3G26 A;  5HGL A;  2LTE A;  5HVC A;  2KW2 A;  2M5R A;  2K5X A;  2PEK A;  1BXI A;  3NY7 B;  3CCL P;  1W2B O;  1ZNV A;  2LL8 A;  5HGN A;  3GZL A;  1EOQ A;  3DTJ A;  5HGO A;  1VQ9 P;  1QVF O;  2KOQ A;  2QEX P;  2DNW A;  4DG9 A;  1VQ6 P;  2FQ0 A;  1EIA A;  3HZQ A;  2MD9 A;  3CD6 P;  3B5I A;  2JYG A;  3DS1 A;  2K92 A;  1VQN P;  1M6E X;  2KGC A;  4U0B A;  2XT1 A;  4XFX A;  2N5I A;  1HQB A;  5EW5 E;  1EMV A;  3M1M A;  3G1G A;  2Z45 A;  2JBG A;  2XV6 A;  2PEJ A;  4XRQ A;  5I4T G;  2Z46 A;  5HV8 A;  4GR2 A;  2GZF A;  3EJD A;  1T8K A;  4PH1 A;  2KOD A;  2AFD A;  1N8R Q;  1VKU A;  4XRO A;  5EJD A;  3CPW O;  1X3O A;  2VSQ A;  2MR7 A;  2KG8 A;  3CCE P;  1K8A Q;  1M90 Q;  3CE7 A;  3RG6 C;  3RG2 A;  3Q20 A;  2K2Q A;  1DNY A;  2L6E A;  2MVU A;  3GKL C;  3G21 A;  4QNB A;  4U0C A;  2VLQ A;  4U0E A;  1YI2 P;  1IUQ A;  1QRJ A;  3DS5 A;  3MGE A;  1NQ4 A;  1YIJ P;  2MY5 A;  2LPK A;  1AUM A;  2GDW A;  1BAJ A;  5KP8 B;  1A8O A;  3CXC O;  2K94 A;  2LIU A;  2FVE A;  1YJN P;  3G28 A;  2LML A;  5F2O A;  1IMQ A;  1DV5 A;  2AVA A;  1D1D A;  2KGA A;  2K93 A;  3CCU P;  1VQO P;  3G71 P;  1GXH A;  2PEO A;  1YHQ P;  3P05 A;  1M1K Q;  2OAR A;  2QNW A;  2ROQ A; 
#chains in the Genus database with same CATH homology
 2JAZ A;  3U43 A;  2GZF A;  7CEI A;  1IMQ A;  2GZJ A;  3GKL C;  1ZNV A;  1GXG A;  2VLQ A;  1E0H A;  2VLP A;  2JB0 A;  4F37 A;  1IMP A;  3GJN A;  1UJZ A;  2ERH A;  1GXH A;  2K0D X;  2GYK A;  2GZE A;  2VLN A;  2WPT A;  5EW5 E;  1EMV A;  1FR2 A;  1UNK A;  2GZI A;  1CEI A;  4UHP B;  2JBG A;  2GZG A;  2NO8 A;  4QKO A;  1AYI A;  1MZ8 A;  2VLO A;  2K5X A;  1BXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...