2GYKA

Crystal structure of the complex of the colicin e9 dnase domain with a mutant immunity protein, imme9 (d51a)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
83
Chain Sequence
LKHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSALIYYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the complexes of the Colicin E9 DNase domain with mutant immunity proteins
rcsb
source organism Escherichia coli k12
molecule tags Antibiotic/antibiotic inhibitor
molecule keywords Colicin-E9 immunity protein
total genus 29
structure length 83
sequence length 83
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gykA00
1E0HA 2JBGA 3GJNA 1EMVA 2VLPA 2GZFA 2GZIA 3U43A 1ZNVA 1IMPA 1MZ8A 2GZGA 2GZJA 1CEIA 1IMQA 1AYIA 1GXGA 2K5XA 4UHPB 2WPTA 2JB0A 2ERHA 2VLOA 2VLQA 4F37A 3GKLC 1UNKA 2VLNA 2K0DX 4QKOA 1FR2A 2NO8A 2JAZA 1BXIA 7CEIA 1UJZA 2GZEA 5EW5E 1GXHA 2GYKA
chains in the Genus database with same CATH superfamily
4GR2A 1E0HA 3HZQA 3DS2A 2GZFA 2CG5B 1MZ8A 4COPA 2QNWA 2E1MA 5F2KA 2JB0A 2MR8A 2VLOA 1DV5A 3DS1A 2JQ4A 2L6EA 4XRQA 1YI2P 2PENA 2DNWA 5HV8A 3CC7P 2PY8A 2GDXA 2CWOA 1ZNVA 3G0VA 2LTEA 1JJ2O 1RO2A 1M90Q 2KG9A 1NJIQ 2K2QA 1YJNP 2KG8A 1QVFO 4R0MA 3M1MA 3CCRP 2MVUA 1OR5A 2LL8A 2KGEA 5I4TG 1VQLP 1YJ9P 2FHSC 3WBHA 2KWLA 3B4QA 2LF4A 1L0IA 2FVAA 2M5RA 3G1IA 1QRJA 4U0DA 2N5HA 1K73Q 4PH1A 2QEXP 1A43A 4IPYA 2FADA 4BPFA 3G21A 3G71P 3RG6C 2MF4A 4H2YC 1Q86Q 1VQ4P 2JGPA 4M0IA 3DTJA 2NO8A 1M74A 3CXCO 5DCKA 2AFDA 2GZEA 4U0BA 2PEMA 4PXHB 4BPHA 2KG6A 1W2BO 2N6YA 1IMPA 4PH0A 2K92A 2EIAA 3CD6P 4BPGA 2XT1A 2N5IA 2LKIA 5HGLA 3CCUP 1M6EX 2M8LA 5HGNA 1VQ6P 3NTEA 3CE7A 5KP8B 2KOPA 1Q82Q 1E6JP 3EJBA 2PEJA 2MD9A 1VQOP 5BS1A 2K0DX 5KP7B 1K30A 2CGQA 2JYGA 2KODA 2GYKA 4MRTC 1Q81Q 2EFJA 3G6EP 2X2BA 1EIAA 1S72P 2K5XA 4WYMA 5HGOA 5CZDB 1VQ5P 4H2XC 4QKOA 1FR2A 2FAEA 1BXIA 3EJEA 7CEIA 1M1KQ 2K93A 2LIWA 3CCQP 5EW5E 2JYLA 2BHVA 2DGYA 3P05A 1VQKP 2FACA 3G28A 1NQ4A 5JPAA 3GKLC 1VQMP 2JU1A 2Z46A 2KOSA 1AF8A 3OW2O 1L0HA 1KQSO 2FQ0A 2GZIA 2MY5A 1GPJA 2AFEA 3CCLP 1QVGO 2XZ0D 2P9XA 3CCMP 1VQ7P 3CPWO 3DS0A 3LMOA 2KW2A 2EHTA 2JU2A 3GZLA 3CC2P 1AUMA 3I55P 2MVVA 3MGEA 4COCA 1UNKA 1EOQA 1YITP 2JAZA 3NY7B 2K94A 1RNIA 1VQ9P 2KORA 5KP6B 3H47A 3EJDA 3GJNA 2ROQA 4DG9A 2XZ1C 2M8NA 2GZGA 1VQ8P 4XROA 3H0DA 2MR7A 4GR6A 2OTJP 4CA3A 4F37A 3CMAP 2ONTA 2FQ1A 1VQNP 3H4EA 1DNYA 1VKUA 3CMEP 1YIJP 1YHQP 2FVEA 2PEOA 4XFYA 2N98A 1BAJA 1GXGA 2FVFA 1RO0A 2L4BA 2WPTA 2ERHA 2N6ZA 1IUQA 5EJDA 3DS5A 2KGCA 4XFZA 2L0QA 4IZ6A 2LOLA 4PWVB 3CCVP 3G26A 1KLPA 2OARA 5HGMA 5BS2A 2L9FA 2XV6A 2GZJA 3RG2A 1IMQA 2KOQA 2PNGA 3LRYA 5F2NA 2GDWA 2PEIA 2CQ8A 2VLNA 1T8KA 2JO0A 4U0CA 2KOOA 4U0AA 2FQ2A 2K0XA 1Q7YQ 1EMVA 3Q20A 2CNRA 3U43A 1ACPA 1A8OA 3GZMA 3VRLC 3G29A 2LPKA 3G1GA 2PEQA 3DS3A 2VSQA 1Z6MA 2OTLP 1HQBA 4XFXA 3CCJP 1YJWP 4U0FA 2AF8A 2AVAA 3CCEP 1D1DA 2QA4P 2VLPA 2Z44A 1VHNA 2KGAA 1HY8A 1CEIA 3CC4P 1AYIA 5HVCA 4UHPB 2GDYA 3CCSP 2XXMA 3HYBA 3E2DA 1K8AQ 2KGDA 2EHSA 2KR5A 2JBGA 3DPHA 2N50A 2K0YA 1ZMBA 4HKGA 4U0EA 4NEOA 2PEKA 2BUOA 2EG5A 3B5IA 2LIUA 1UJZA 1GXHA 5F2OA 1K9MQ 1N8RQ 4H2WC 2M8PA 1KD1Q 1VQPP 2VLQA 1M6NA 4QNBA 2Z45A 1X3OA 2L22A 1KC8Q 3DS4A 3G4SP 1F80D 3I56P 2LMLA
chains in the Genus database with same CATH topology
1E0HA 2JBGA 3GJNA 1EMVA 2VLPA 2GZFA 2GZIA 3U43A 1ZNVA 1IMPA 1MZ8A 2GZGA 2GZJA 1CEIA 1IMQA 1AYIA 1GXGA 2K5XA 4UHPB 2WPTA 2JB0A 2ERHA 2VLOA 2VLQA 4F37A 3GKLC 1UNKA 2VLNA 2K0DX 4QKOA 1FR2A 2NO8A 2JAZA 1BXIA 7CEIA 1UJZA 2GZEA 5EW5E 1GXHA 2GYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E0H A;  2JBG A;  3GJN A;  1EMV A;  2VLP A;  2GZF A;  2GZI A;  3U43 A;  1ZNV A;  1IMP A;  1MZ8 A;  2GZG A;  2GZJ A;  1CEI A;  1IMQ A;  1AYI A;  1GXG A;  2K5X A;  4UHP B;  2WPT A;  2JB0 A;  2ERH A;  2VLO A;  2VLQ A;  4F37 A;  3GKL C;  1UNK A;  2VLN A;  2K0D X;  4QKO A;  1FR2 A;  2NO8 A;  2JAZ A;  1BXI A;  7CEI A;  1UJZ A;  2GZE A;  5EW5 E;  1GXH A;  2GYK A; 
#chains in the Genus database with same CATH topology
 4GR2 A;  1E0H A;  3HZQ A;  3DS2 A;  2GZF A;  2CG5 B;  1MZ8 A;  4COP A;  2QNW A;  2E1M A;  5F2K A;  2JB0 A;  2MR8 A;  2VLO A;  1DV5 A;  3DS1 A;  2JQ4 A;  2L6E A;  4XRQ A;  1YI2 P;  2PEN A;  2DNW A;  5HV8 A;  3CC7 P;  2PY8 A;  2GDX A;  2CWO A;  1ZNV A;  3G0V A;  2LTE A;  1JJ2 O;  1RO2 A;  1M90 Q;  2KG9 A;  1NJI Q;  2K2Q A;  1YJN P;  2KG8 A;  1QVF O;  4R0M A;  3M1M A;  3CCR P;  2MVU A;  1OR5 A;  2LL8 A;  2KGE A;  5I4T G;  1VQL P;  1YJ9 P;  2FHS C;  3WBH A;  2KWL A;  3B4Q A;  2LF4 A;  1L0I A;  2FVA A;  2M5R A;  3G1I A;  1QRJ A;  4U0D A;  2N5H A;  1K73 Q;  4PH1 A;  2QEX P;  1A43 A;  4IPY A;  2FAD A;  4BPF A;  3G21 A;  3G71 P;  3RG6 C;  2MF4 A;  4H2Y C;  1Q86 Q;  1VQ4 P;  2JGP A;  4M0I A;  3DTJ A;  2NO8 A;  1M74 A;  3CXC O;  5DCK A;  2AFD A;  2GZE A;  4U0B A;  2PEM A;  4PXH B;  4BPH A;  2KG6 A;  1W2B O;  2N6Y A;  1IMP A;  4PH0 A;  2K92 A;  2EIA A;  3CD6 P;  4BPG A;  2XT1 A;  2N5I A;  2LKI A;  5HGL A;  3CCU P;  1M6E X;  2M8L A;  5HGN A;  1VQ6 P;  3NTE A;  3CE7 A;  5KP8 B;  2KOP A;  1Q82 Q;  1E6J P;  3EJB A;  2PEJ A;  2MD9 A;  1VQO P;  5BS1 A;  2K0D X;  5KP7 B;  1K30 A;  2CGQ A;  2JYG A;  2KOD A;  2GYK A;  4MRT C;  1Q81 Q;  2EFJ A;  3G6E P;  2X2B A;  1EIA A;  1S72 P;  2K5X A;  4WYM A;  5HGO A;  5CZD B;  1VQ5 P;  4H2X C;  4QKO A;  1FR2 A;  2FAE A;  1BXI A;  3EJE A;  7CEI A;  1M1K Q;  2K93 A;  2LIW A;  3CCQ P;  5EW5 E;  2JYL A;  2BHV A;  2DGY A;  3P05 A;  1VQK P;  2FAC A;  3G28 A;  1NQ4 A;  5JPA A;  3GKL C;  1VQM P;  2JU1 A;  2Z46 A;  2KOS A;  1AF8 A;  3OW2 O;  1L0H A;  1KQS O;  2FQ0 A;  2GZI A;  2MY5 A;  1GPJ A;  2AFE A;  3CCL P;  1QVG O;  2XZ0 D;  2P9X A;  3CCM P;  1VQ7 P;  3CPW O;  3DS0 A;  3LMO A;  2KW2 A;  2EHT A;  2JU2 A;  3GZL A;  3CC2 P;  1AUM A;  3I55 P;  2MVV A;  3MGE A;  4COC A;  1UNK A;  1EOQ A;  1YIT P;  2JAZ A;  3NY7 B;  2K94 A;  1RNI A;  1VQ9 P;  2KOR A;  5KP6 B;  3H47 A;  3EJD A;  3GJN A;  2ROQ A;  4DG9 A;  2XZ1 C;  2M8N A;  2GZG A;  1VQ8 P;  4XRO A;  3H0D A;  2MR7 A;  4GR6 A;  2OTJ P;  4CA3 A;  4F37 A;  3CMA P;  2ONT A;  2FQ1 A;  1VQN P;  3H4E A;  1DNY A;  1VKU A;  3CME P;  1YIJ P;  1YHQ P;  2FVE A;  2PEO A;  4XFY A;  2N98 A;  1BAJ A;  1GXG A;  2FVF A;  1RO0 A;  2L4B A;  2WPT A;  2ERH A;  2N6Z A;  1IUQ A;  5EJD A;  3DS5 A;  2KGC A;  4XFZ A;  2L0Q A;  4IZ6 A;  2LOL A;  4PWV B;  3CCV P;  3G26 A;  1KLP A;  2OAR A;  5HGM A;  5BS2 A;  2L9F A;  2XV6 A;  2GZJ A;  3RG2 A;  1IMQ A;  2KOQ A;  2PNG A;  3LRY A;  5F2N A;  2GDW A;  2PEI A;  2CQ8 A;  2VLN A;  1T8K A;  2JO0 A;  4U0C A;  2KOO A;  4U0A A;  2FQ2 A;  2K0X A;  1Q7Y Q;  1EMV A;  3Q20 A;  2CNR A;  3U43 A;  1ACP A;  1A8O A;  3GZM A;  3VRL C;  3G29 A;  2LPK A;  3G1G A;  2PEQ A;  3DS3 A;  2VSQ A;  1Z6M A;  2OTL P;  1HQB A;  4XFX A;  3CCJ P;  1YJW P;  4U0F A;  2AF8 A;  2AVA A;  3CCE P;  1D1D A;  2QA4 P;  2VLP A;  2Z44 A;  1VHN A;  2KGA A;  1HY8 A;  1CEI A;  3CC4 P;  1AYI A;  5HVC A;  4UHP B;  2GDY A;  3CCS P;  2XXM A;  3HYB A;  3E2D A;  1K8A Q;  2KGD A;  2EHS A;  2KR5 A;  2JBG A;  3DPH A;  2N50 A;  2K0Y A;  1ZMB A;  4HKG A;  4U0E A;  4NEO A;  2PEK A;  2BUO A;  2EG5 A;  3B5I A;  2LIU A;  1UJZ A;  1GXH A;  5F2O A;  1K9M Q;  1N8R Q;  4H2W C;  2M8P A;  1KD1 Q;  1VQP P;  2VLQ A;  1M6N A;  4QNB A;  2Z45 A;  1X3O A;  2L22 A;  1KC8 Q;  3DS4 A;  3G4S P;  1F80 D;  3I56 P;  2LML A; 
#chains in the Genus database with same CATH homology
 1E0H A;  2JBG A;  3GJN A;  1EMV A;  2VLP A;  2GZF A;  2GZI A;  3U43 A;  1ZNV A;  1IMP A;  1MZ8 A;  2GZG A;  2GZJ A;  1CEI A;  1IMQ A;  1AYI A;  1GXG A;  2K5X A;  4UHP B;  2WPT A;  2JB0 A;  2ERH A;  2VLO A;  2VLQ A;  4F37 A;  3GKL C;  1UNK A;  2VLN A;  2K0D X;  4QKO A;  1FR2 A;  2NO8 A;  2JAZ A;  1BXI A;  7CEI A;  1UJZ A;  2GZE A;  5EW5 E;  1GXH A;  2GYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...