2GYKA

Crystal structure of the complex of the colicin e9 dnase domain with a mutant immunity protein, imme9 (d51a)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
83
Chain Sequence
b'LKHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSALIYYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin-E9 immunity protein
molecule tags Antibiotic/antibiotic inhibitor
source organism Escherichia coli k12
publication title Crystal structures of the complexes of the Colicin E9 DNase domain with mutant immunity proteins
rcsb
total genus 29
structure length 83
sequence length 83
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gykA00
2GZIA 4F37A 1BXIA 2GZEA 1GXHA 2GYKA 4UHPB 2JB0A 1UNKA 2JAZA 3GKLC 1GXGA 2JBGA 2WPTA 1EMVA 1CEIA 5EW5E 1UJZA 2GZGA 1IMPA 1MZ8A 1ZNVA 2GZFA 7CEIA 2ERHA 2VLNA 2VLQA 1IMQA 1E0HA 2VLOA 1FR2A 2GZJA 2VLPA 2NO8A 3GJNA 3U43A 1AYIA 2K5XA 2K0DX 4QKOA
chains in the Genus database with same CATH superfamily
1YITP 2EHTA 2GDYA 5KP6B 2AFEA 4HKGA 3G0VA 3CCVP 2M8PA 2ONTA 2LIUA 3G26A 2LPKA 1KC8Q 2VLPA 2KGDA 2QEXP 1K9MQ 1YJ9P 2KWLA 3CC4P 2KORA 1D1DA 1M6NA 2KODA 2Z46A 5HGNA 2FQ2A 2M8NA 1Q81Q 2L0QA 2OTLP 2GZJA 1KD1Q 1DNYA 3DS3A 5HGOA 2K93A 2JB0A 2P9XA 1ZMBA 2PY8A 2EG5A 2ROQA 2GZFA 2VLNA 3H0DA 2KOQA 1VQNP 2CQ8A 1VQ6P 3G29A 2FHSC 1CEIA 2DNWA 2JU1A 5EJDA 2LMLA 1T8KA 2LF4A 1VHNA 1YJWP 1VQKP 1EOQA 4XFXA 3MGEA 2K92A 2NO8A 1NJIQ 1K73Q 2L4BA 2Z45A 1DV5A 2X2BA 1M1KQ 2PEMA 3CE7A 3G6EP 3P05A 2L6EA 2OTJP 5HV8A 1N8RQ 1HY8A 2MF4A 4WYMA 2LKIA 2BUOA 3CCLP 1L0HA 2FVFA 3DPHA 3NTEA 1VQMP 4U0FA 3H47A 3HYBA 2K94A 2CWOA 2JQ4A 2K0DX 2KOPA 4H2WC 2FQ1A 2FADA 2GZGA 4DG9A 3CCSP 3CCEP 3G1GA 2FQ0A 2N6ZA 3EJDA 5CZDB 2MR7A 2M8LA 2KOSA 1QVFO 3CCJP 4PH0A 1AYIA 2K0YA 2JYGA 1ACPA 4NEOA 1GXHA 1M74A 3EJBA 3HZQA 1M90Q 5EW5E 1UJZA 3CCRP 3E2DA 1Q86Q 1IMPA 4U0CA 1VQ8P 5HGLA 3CPWO 2LL8A 1QVGO 2AVAA 3G4SP 1VQPP 4H2XC 3G71P 2BHVA 4BPGA 2PEIA 2MD9A 1KQSO 2GYKA 1IUQA 2KGAA 1EMVA 1RNIA 2EHSA 2JGPA 2PEQA 2LOLA 3OW2O 2MY5A 1QRJA 3NY7B 3RG2A 2VLQA 1M6EX 1K8AQ 3CMEP 2K0XA 1F80D 2JU2A 2N98A 1A8OA 5BS1A 1YI2P 3M1MA 3CC2P 2M5RA 5HVCA 4UHPB 2N50A 3CD6P 2JBGA 4IPYA 4U0BA 1Z6MA 2KG9A 2CGQA 2KOOA 3CCUP 2QNWA 2XT1A 1K30A 4PXHB 3U43A 3DS0A 2N6YA 3GZMA 2PENA 1Q7YQ 1RO2A 2L22A 3WBHA 2AF8A 2KGCA 1GPJA 1EIAA 1MZ8A 3CC7P 2DGYA 2JYLA 3VRLC 4BPHA 2KGEA 3Q20A 3CXCO 2CG5B 3EJEA 1A43A 4F37A 2EIAA 2PNGA 1HQBA 1UNKA 3GKLC 2Z44A 2XXMA 2N5HA 2KG8A 1X3OA 4MRTC 4IZ6A 2MR8A 1ZNVA 4U0AA 3DS5A 3B5IA 1JJ2O 3CCQP 2MVVA 5HGMA 3G28A 4QKOA 1OR5A 1BXIA 5KP8B 1YHQP 1YIJP 2WPTA 4GR6A 3DTJA 5BS2A 5KP7B 3LMOA 2GDWA 4GR2A 2LTEA 4PWVB 4H2YC 3B4QA 1VQ4P 2OARA 3G1IA 1Q82Q 4COCA 2FACA 5F2NA 4XFYA 5F2KA 2GZEA 2MVUA 2KW2A 3G21A 1GXGA 3RG6C 1VQLP 2K2QA 4R0MA 2JO0A 2PEKA 4XROA 2ERHA 2VLOA 2L9FA 2PEOA 4XRQA 2PEJA 1S72P 3I56P 1W2BO 1VQ9P 2AFDA 3DS1A 1VQ5P 3CMAP 4PH1A 4QNBA 7CEIA 4U0EA 2N5IA 3CCMP 2XV6A 3LRYA 2LIWA 1AUMA 2FAEA 2QA4P 5I4TG 2EFJA 3GZLA 3H4EA 3GJNA 1E6JP 2CNRA 1BAJA 1YJNP 3DS2A 4M0IA 1VKUA 2KR5A 5DCKA 1KLPA 1IMQA 2E1MA 5F2OA 3I55P 1VQ7P 1RO0A 3DS4A 1VQOP 2KG6A 2K5XA 2GZIA 4BPFA 1NQ4A 2FVAA 1L0IA 2JAZA 2FVEA 2GDXA 2VSQA 4CA3A 4U0DA 5JPAA 4XFZA 1AF8A 2XZ0D 1E0HA 1FR2A 4COPA 2XZ1C
chains in the Genus database with same CATH topology
2GZIA 4F37A 1BXIA 2GZEA 1GXHA 2GYKA 4UHPB 2JB0A 1UNKA 2JAZA 3GKLC 1GXGA 2JBGA 2WPTA 1EMVA 1CEIA 5EW5E 1UJZA 2GZGA 1IMPA 1MZ8A 1ZNVA 2GZFA 7CEIA 2ERHA 2VLNA 2VLQA 1IMQA 1E0HA 2VLOA 1FR2A 2GZJA 2VLPA 2NO8A 3GJNA 3U43A 1AYIA 2K5XA 2K0DX 4QKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZI A;  4F37 A;  1BXI A;  2GZE A;  1GXH A;  2GYK A;  4UHP B;  2JB0 A;  1UNK A;  2JAZ A;  3GKL C;  1GXG A;  2JBG A;  2WPT A;  1EMV A;  1CEI A;  5EW5 E;  1UJZ A;  2GZG A;  1IMP A;  1MZ8 A;  1ZNV A;  2GZF A;  7CEI A;  2ERH A;  2VLN A;  2VLQ A;  1IMQ A;  1E0H A;  2VLO A;  1FR2 A;  2GZJ A;  2VLP A;  2NO8 A;  3GJN A;  3U43 A;  1AYI A;  2K5X A;  2K0D X;  4QKO A; 
#chains in the Genus database with same CATH topology
 1YIT P;  2EHT A;  2GDY A;  5KP6 B;  2AFE A;  4HKG A;  3G0V A;  3CCV P;  2M8P A;  2ONT A;  2LIU A;  3G26 A;  2LPK A;  1KC8 Q;  2VLP A;  2KGD A;  2QEX P;  1K9M Q;  1YJ9 P;  2KWL A;  3CC4 P;  2KOR A;  1D1D A;  1M6N A;  2KOD A;  2Z46 A;  5HGN A;  2FQ2 A;  2M8N A;  1Q81 Q;  2L0Q A;  2OTL P;  2GZJ A;  1KD1 Q;  1DNY A;  3DS3 A;  5HGO A;  2K93 A;  2JB0 A;  2P9X A;  1ZMB A;  2PY8 A;  2EG5 A;  2ROQ A;  2GZF A;  2VLN A;  3H0D A;  2KOQ A;  1VQN P;  2CQ8 A;  1VQ6 P;  3G29 A;  2FHS C;  1CEI A;  2DNW A;  2JU1 A;  5EJD A;  2LML A;  1T8K A;  2LF4 A;  1VHN A;  1YJW P;  1VQK P;  1EOQ A;  4XFX A;  3MGE A;  2K92 A;  2NO8 A;  1NJI Q;  1K73 Q;  2L4B A;  2Z45 A;  1DV5 A;  2X2B A;  1M1K Q;  2PEM A;  3CE7 A;  3G6E P;  3P05 A;  2L6E A;  2OTJ P;  5HV8 A;  1N8R Q;  1HY8 A;  2MF4 A;  4WYM A;  2LKI A;  2BUO A;  3CCL P;  1L0H A;  2FVF A;  3DPH A;  3NTE A;  1VQM P;  4U0F A;  3H47 A;  3HYB A;  2K94 A;  2CWO A;  2JQ4 A;  2K0D X;  2KOP A;  4H2W C;  2FQ1 A;  2FAD A;  2GZG A;  4DG9 A;  3CCS P;  3CCE P;  3G1G A;  2FQ0 A;  2N6Z A;  3EJD A;  5CZD B;  2MR7 A;  2M8L A;  2KOS A;  1QVF O;  3CCJ P;  4PH0 A;  1AYI A;  2K0Y A;  2JYG A;  1ACP A;  4NEO A;  1GXH A;  1M74 A;  3EJB A;  3HZQ A;  1M90 Q;  5EW5 E;  1UJZ A;  3CCR P;  3E2D A;  1Q86 Q;  1IMP A;  4U0C A;  1VQ8 P;  5HGL A;  3CPW O;  2LL8 A;  1QVG O;  2AVA A;  3G4S P;  1VQP P;  4H2X C;  3G71 P;  2BHV A;  4BPG A;  2PEI A;  2MD9 A;  1KQS O;  2GYK A;  1IUQ A;  2KGA A;  1EMV A;  1RNI A;  2EHS A;  2JGP A;  2PEQ A;  2LOL A;  3OW2 O;  2MY5 A;  1QRJ A;  3NY7 B;  3RG2 A;  2VLQ A;  1M6E X;  1K8A Q;  3CME P;  2K0X A;  1F80 D;  2JU2 A;  2N98 A;  1A8O A;  5BS1 A;  1YI2 P;  3M1M A;  3CC2 P;  2M5R A;  5HVC A;  4UHP B;  2N50 A;  3CD6 P;  2JBG A;  4IPY A;  4U0B A;  1Z6M A;  2KG9 A;  2CGQ A;  2KOO A;  3CCU P;  2QNW A;  2XT1 A;  1K30 A;  4PXH B;  3U43 A;  3DS0 A;  2N6Y A;  3GZM A;  2PEN A;  1Q7Y Q;  1RO2 A;  2L22 A;  3WBH A;  2AF8 A;  2KGC A;  1GPJ A;  1EIA A;  1MZ8 A;  3CC7 P;  2DGY A;  2JYL A;  3VRL C;  4BPH A;  2KGE A;  3Q20 A;  3CXC O;  2CG5 B;  3EJE A;  1A43 A;  4F37 A;  2EIA A;  2PNG A;  1HQB A;  1UNK A;  3GKL C;  2Z44 A;  2XXM A;  2N5H A;  2KG8 A;  1X3O A;  4MRT C;  4IZ6 A;  2MR8 A;  1ZNV A;  4U0A A;  3DS5 A;  3B5I A;  1JJ2 O;  3CCQ P;  2MVV A;  5HGM A;  3G28 A;  4QKO A;  1OR5 A;  1BXI A;  5KP8 B;  1YHQ P;  1YIJ P;  2WPT A;  4GR6 A;  3DTJ A;  5BS2 A;  5KP7 B;  3LMO A;  2GDW A;  4GR2 A;  2LTE A;  4PWV B;  4H2Y C;  3B4Q A;  1VQ4 P;  2OAR A;  3G1I A;  1Q82 Q;  4COC A;  2FAC A;  5F2N A;  4XFY A;  5F2K A;  2GZE A;  2MVU A;  2KW2 A;  3G21 A;  1GXG A;  3RG6 C;  1VQL P;  2K2Q A;  4R0M A;  2JO0 A;  2PEK A;  4XRO A;  2ERH A;  2VLO A;  2L9F A;  2PEO A;  4XRQ A;  2PEJ A;  1S72 P;  3I56 P;  1W2B O;  1VQ9 P;  2AFD A;  3DS1 A;  1VQ5 P;  3CMA P;  4PH1 A;  4QNB A;  7CEI A;  4U0E A;  2N5I A;  3CCM P;  2XV6 A;  3LRY A;  2LIW A;  1AUM A;  2FAE A;  2QA4 P;  5I4T G;  2EFJ A;  3GZL A;  3H4E A;  3GJN A;  1E6J P;  2CNR A;  1BAJ A;  1YJN P;  3DS2 A;  4M0I A;  1VKU A;  2KR5 A;  5DCK A;  1KLP A;  1IMQ A;  2E1M A;  5F2O A;  3I55 P;  1VQ7 P;  1RO0 A;  3DS4 A;  1VQO P;  2KG6 A;  2K5X A;  2GZI A;  4BPF A;  1NQ4 A;  2FVA A;  1L0I A;  2JAZ A;  2FVE A;  2GDX A;  2VSQ A;  4CA3 A;  4U0D A;  5JPA A;  4XFZ A;  1AF8 A;  2XZ0 D;  1E0H A;  1FR2 A;  4COP A;  2XZ1 C; 
#chains in the Genus database with same CATH homology
 2GZI A;  4F37 A;  1BXI A;  2GZE A;  1GXH A;  2GYK A;  4UHP B;  2JB0 A;  1UNK A;  2JAZ A;  3GKL C;  1GXG A;  2JBG A;  2WPT A;  1EMV A;  1CEI A;  5EW5 E;  1UJZ A;  2GZG A;  1IMP A;  1MZ8 A;  1ZNV A;  2GZF A;  7CEI A;  2ERH A;  2VLN A;  2VLQ A;  1IMQ A;  1E0H A;  2VLO A;  1FR2 A;  2GZJ A;  2VLP A;  2NO8 A;  3GJN A;  3U43 A;  1AYI A;  2K5X A;  2K0D X;  4QKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...