2GZ7A

Structure-based drug design and structural biology study of novel nonpeptide inhibitors of sars-cov main protease
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Drug Design and Structural Biology Study of Novel Nonpeptide Inhibitors of Severe Acute Respiratory Syndrome Coronavirus Main Protease
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
molecule keywords Replicase polyprotein 1ab
total genus 84
structure length 306
sequence length 306
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2gz7A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gz7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gz7A02
1XX9A 2FLRH 2FP7B 1AE5A 3G01A 3UOPA 3Q76A 2GP9B 2XWBI 2LNCA 1XXFA 1L1NA 3BG4C 1GCTB 2R9PA 3RUOA 1AVXA 1SB1H 3KN2A 3O8CA 2M5TA 1DOJA 1M9UA 1P10A 1O3PB 2JH5D 1BHXF 1K1PA 1HIAA 1V2OT 1LDTT 1F0UA 2GDEH 3RM2H 1G3BA 1HJ9A 3ZVFA 4NIXA 1KY9A 2A5IA 2A32A 1FONA 2OBOA 1TMBH 2AGEX 4FVDA 2HVXA 5DGJA 1UTMA 1O3NA 1TGBA 2V35A 2BD7A 1YYY1 2OLGA 2BQ6B 4J2YB 2VJ1A 3MH6A 2Q1JA 3LC3A 3PYHA 2Z94A 1UVPA 1MTUA 1NRSH 1F2SE 3BN9A 4JYUH 3SO3A 1SQOA 1DVAH 2ZECA 5LGOA 1C5NH 4BAOB 5EODA 1GVKB 1QA0A 6GCHF 3N7OA 1SFIA 4RN6A 3P8GA 5DP5A 1A4WH 4AORA 3GDUA 2H5CA 1KLJH 4K1EA 1O3IA 4MG3A 1DWEH 3LJOA 2G52A 1TALA 2R3YA 1GMHF 2I6QA 1K1LA 4KTCA 1GHVH 2F91A 1RD3B 1A0JA 2VIPA 3DA9B 3SUDA 1ORFA 1DLEA 4DURA 3SGBE 3VB3A 2IJOB 3SU4A 5C1XA 1AU8A 1H8IH 2G51A 1ZSLA 2EI8A 1W13U 3NKKA 2SFAA 2XWAA 2V0BA 1AUJA 4OS1A 2AMPA 1C2HA 2BD4A 2J34A 3QTVH 1T8LA 4AFQA 1YBWA 4A7IB 3M5LA 4Z0KA 2FOBA 2FX4A 1HAXB 3A86A 2ZCKP 1L1GA 5DP9A 1FPHH 1P12E 3RXKA 3ATKA 2A7JA 3UOUA 3ZZ6A 3D62A 1F92A 1TRMA 1RTKA 2OINA 2R0LA 2GX4A 1QJ7B 1GBIA 4UFEH 1YP9A 1E0FD 2XXLA 1GJ5H 3OY6U 1GBKA 3BTTE 2P3FH 1O3EA 1V3XA 2PFEA 3S9AA 1C5MD 2KAIA 5F03A 3BIVH 1PYTD 1B0EA 1O2MA 1CU1A 1S83A 1LCYA 3TNTA 2ZKSA 3SGAE 1PYTC 1LO6A 3RLYH 1O35A 2FO9A 1MU6B 2XYAA 3VB5A 3A88A 2Y5GA 1IQLA 4B75A 1TNJA 1BTWA 1MKWK 2WPLS 5T6FA 4I8KA 4GSOA 3SGQE 4I8HA 1L4ZA 1VCQA 1NFUA 1KTSB 4BTIB 1YLCA 4A1TA 2EI6A 2R2MB 3SJIA 3P92A 3UWIA 1DY8A 3SV2H 1BMNH 3RXUA 2ZGHA 4HTCH 2YNAA 3M61U 3AASA 3SUGA 2BY7X 1GHBG 5L30H 4TPIZ 5SGAE 1RTFB 1D6RA 1OWJA 1T8OA 2ZWLH 1O3JA 8KME2 4GHQA 1AZ8A 4BAMB 1BJUA 2LPRA 1AKSA 2FOHA 4ZROA 3U8RH 4K2YA 3F1SB 3E91A 1DITH 4B1TA 1PQ7A 6CHAC 3KEEA 1HJAC 5FX5A 1DY9A 1LHGH 3AW1A 3R0FA 2D26C 4FUEA 4YLQH 2OP9A 3SU1A 1MQ6A 1ZSJA 3KQBA 2H9HA 1HIAB 2VIVA 1V2NT 5C3NA 3NPSA 1G30B 2F9UA 4D9RA 1IQEA 4ZHLU 1Q31A 4K1TA 1A5HA 5AVDA 1S0RA 3BTFE 2HNTF 2VIWA 3QZRA 1O2NA 1QQ4A 3FVFB 3GYLB 1LVOA 2G5VA 1BJVA 1TWXB 3QO6A 2PUXB 3F9GA 1ARBA 1C5VA 2SGFE 2BD2A 2AIPA 2O8UA 5FBIA 1NC6A 1V2UT 4YO9A 2C93B 4D7GA 1AVWA 4UONA 2O8TA 1GBAA 1IHTH 1NT1A 2A4RA 4NA9H 3TK9A 6LPRA 4WXVA 4D7FA 2CV3A 4DOQA 3GCTG 4ZXXH 1EQ9A 1GG6B 4Y0YE 1MMJN 3FP6E 5K7RA 1RTLA 4AG1A 4R8TB 2VINA 4NIWA 1IQHA 2RA3A 1PPZA 4ABDA 1AQ7A 2QCYA 3T5FH 3ZZ8A 4OS4A 3ZZDA 2HWLB 9LPRA 4K5ZA 1VGCC 2WPHS 5C5OA 3NCLA 3I29A 1D9IA 3UUZA 1KXEA 1VR1H 2Y81A 1EB1H 3BEUA 4YESB 2FLBH 2RA0A 3ZZ5A 1TNHA 4IC5A 3SZNA 1ZMNA 1HJAB 1GDNA 1DLKB 1P0SH 1GHXH 1MKWH 4ZHMU 1ZMJA 4WJG2 5AF9H 1LPGB 2PKSB 1TABE 1PJPA 1SHHB 4K8YA 3RXMA 1K1IA 1K1NA 1PQAA 1XM1A 3MH4A 1BTXA 3R3GB 2FOMB 1HAVA 1W7XH 4Y0ZE 1O2XA 3MU0A 3PLBA 1Z71A 3L33A 2SGDE 3ZZAA 2B9LA 2V3HH 3Q77A 2D1JA 1MUEB 4ABHA 1SLVB 1BCUH 4Y8YA 2BDCA 2FDAA 4X8UH 1TPSA 1WTHD 2TGDA 4INHA 1GL1A 3O8DA 1XVOA 1P2MA 1O2KA 1QRWA 3E1XB 1TRNA 1XXDA 1J16A 4OS6A 1UHBA 1P2JA 4X6OA 2ZFRH 5FX6A 4KELA 3SJOA 3GDSA 3E6PH 1OWDA 1TAWA 3GCOA 1GBTA 4LOYH 5FPSA 4IGDA 1ZR0A 2WYGA 1TONA 2AS9A 1GBCA 1K28D 4CR5A 1V2VT 4FU8A 6ESTA 1C1MA 2A5KA 2WPKS 1OXGA 1Y3VA 2ZU2A 2ODYB 1JIMA 1THPB 2PHBA 2QXJA 3ATIA 2AGIX 4ZKNU 1AO5A 2FODA 1CQQA 1FAXA 1GWAA 3FAOA 1CHOF 1RS0A 1DWCH 4UE7H 2EI7A 1MTWA 2HLCA 1ZTKA 3MH5A 4BNRA 5ESBA 1HYLA 2ZPSA 5FPTA 3BIUH 1ZLRA 1EZQA 4I31A 3BEIB 4DJZB 3U98H 3RXFA 1H8DH 1ZTLA 4CH8B 2BOKA 2QXGA 5E2PA 1GI5A 1LQDB 1GI3A 1P2OA 3T62A 3UY9A 2CF9H 4ZKSU 2ZGJA 2ZTZA 3A8CA 2D2DA 1GJAB 1BMAA 2Y7ZA 3QWCH 1THSH 4H42U 4JZIA 2SGEE 4DVAU 4U01A 1Z6JH 3KCGH 3UFAA 4Y6DA 1W0ZU 2TPIZ 2ZA5A 4O97A 2PKAB 3BSQA 1EAUA 2PLXA 3RMNH 1NFXA 1H4WA 1QY6A 1GBFA 1QB6A 5DK1A 1O2YA 2GTBA 4NA8A 1ANEA 1DWDH 3RU4T 2FWWA 1AE8H 3PLPA 1BTZA 1JIRA 2F9OA 2IOTA 1C1NA 3E16B 3SU5A 2BDIA 3UR6A 3HK3B 4Y8ZA 3Q3YA 2BQWB 2XC0A 3ZZBA 1Y3WA 1SGNE 4VGCB 1UK4A 5A8YA 1ZJKA 2ZPRA 2TGPZ 1UTLM 2ESTE 3ELAH 1MKXH 2B5TB 2PGBB 3LGWA 1EPTA 2GD4B 1QTFA 1DT2A 1ZPZA 1SMFE 2BDGA 5J4SA 1LVMA 3RM0H 1ACBE 4BTTB 1OOKB 3LKWA 2VGCC 1Y5BT 4Y10E 1HCGA 3U8OH 2AERH 1FIWA 1FUJA 1TGNA 1P06A 2CN0H 5HYOA 3UNSA 5EQSA 4TWYA 1S5SA 3T2NA 3ZV9A 1O2QA 1OSSA 1SOTA 1GMDG 2G8TA 1KXDA 3QGNB 1MQ5A 2STBE 2OQUA 4PROA 1WUNH 1SGRE 1AFEH 3BV9B 3KNXA 3TJVA 4ABFA 3GCTF 5A0BA 1FMGA 5LPEA 2Z9KA 4GVUA 1OYQA 3A89A 1TMTH 1A0HB 3K2UA 3SHAH 3H7OA 1KYNA 2BLOA 3H5CB 1DPOA 1GJ7B 3E8LA 4SGBE 1ARCA 1E35B 2FOGA 4X2YA 1C1SA 2J92A 4WMDA 4U30A 3H7TA 1CO7E 3WY8A 3C27B 1JXPA 2FOAA 1OPHB 2Y80A 3FP8E 4GAWA 2UWPA 4UFDH 1G9IE 5GPIB 4CRGA 1YKTA 1CGJE 4YOJA 1BDAA 2PSYA 4JMYA 1W8BH 3ZVAA 1GI8B 3OYPA 5J4QA 2Z7FE 3QTOH 4X1PU 1AMHA 3PMHB 2ZGBH 1EAIA 3MNSA 1QA7A 1TNKA 1D6WA 3EYDA 1PQ5A 2FMJA 3SNBA 1V2TT 1FDPA 4KP0A 3E90B 1C5UA 1BQYA 1O2WA 5AFZH 3SQEE 2JH6D 2R0KA 1C5SA 1V2JT 2ULLA 1WBGB 4E05H 4WMFA 1SLXB 1QBVH 2GMTC 2ZGCA 1S6HA 1O3OA 1O2SA 1HXEH 2BY8X 2VU8E 2ZP0H 5A2MH 3Q3XA 2GKVE 2AEIH 1C4U2 1GJ8B 5JBAS 4CHAB 5DP3A 1O39A 1N8OB 3RMOH 1ANBA 3EAJA 1W12U 2PKAA 1TNIA 1DICA 5A8ZA 3QX5H 1QRZA 1UO6A 1WU1A 4JZEH 4SGAE 2THFB 1KLIH 1CT4E 2UWOA 1P11E 1K2I1 2QYIA 1CHGA 1ZYOA 1HNEE 1XVMA 4JZDH 3EQ0H 2SGQE 1XUFA 3GCHC 3NZIA 1BOQA 2FM2A 1YPGH 1AY6H 1EJMA 1NRRH 3BF6H 1RRKA 1UTKA 3OX7U 3JZ1B 3LIWA 2SGPE 4NSYA 1QB1A 1IQGA 3PMAB 1LKAA 3MFJA 3P17H 4YOGA 1G2LA 2P3UB 5FBEA 4CRCA 4NIYA 1TIOA 1BRAA 1GMHG 2BDAA 3E0PB 2ZEBA 3K6YA 2HRVA 1VITH 1SGFG 1A3EH 5EQRA 2VH0A 4AGKA 2J2UA 1SSXA 1SI5H 1QBNA 4UFGH 4CRFA 4X1NU 2BYAX 1PPEE 4X1RU 4A92A 1EP5A 1CGIE 4BTUB 3MI4A 7GCHF 3UIRA 1RFNA 3F6UH 3SU2A 1U6QA 3CP7A 1GJDB 5T6GA 1BMMH 3TGIE 5EPNA 5HM2A 3SV7A 3SNCA 1E37B 4I33A 2ZQ1A 1H1BA 4YOIA 5GXPA 4B71A 4I7YH 2H9TH 4Q7YA 1XMNB 2FI5E 3PTBA 2ANKH 4XOJA 1CA0B 1JRSA 1TBZH 4B2AA 1MCTA 1Z7KA 1QR3E 5EOKA 2NU2E 1WQSA 2XC4A 5F8TA 1Y3YA 5LPFA 4XE4A 3LGVA 1W10U 1NU7B 4X0WU 1OP0A 1QJ6B 2KAIB 1W11U 1O3FA 2F3CE 2C8YB 2Q6FA 2ZFPH 1DFPA 5GIBA 2O8LA 1SC8U 2OBQA 1C2EA 1GI4A 1SLWB 2HPPH 2CMYA 3A82A 3ZVCA 3ZVGA 5CE1A 4VGCC 1BTUA 1P05A 3MO3A 1FXYA 1AHTH 1T32A 1L0ZA 1HAIH 4K3JA 1GHAG 1T4UH 5JPMH 2BD5A 2H6MA 1MCVA 5EG4A 2ZF0H 4U32A 7ESTE 4D76A 3MHWU 8GCHF 5JBCS 3ODDA 1INCA 3ZV8A 2DUCA 3QZQA 2B0FA 1H9HE 3RMLH 3A8BA 3PO1B 4KTUA 1TOMH 1IHSH 2PKSC 2SGAA 4K60A 4X8SH 1TGTA 1YF4A 4WVPE 2OXSA 3URCA 1C5LH 1QURH 4B2BA 3QUMP 1D3PB 1BTPA 3OY5U 1KXCA 1GJCB 1QIXB 1VJ9U 4JK5A 8ESTE 1T8MA 3DUXH 3ZVDA 3HKIB 3F9HA 3B9FH 1C1PA 1GPZA 4X2WA 2ZCHP 3T29A 1C5ZB 1ZHMA 1C2GA 3TJUA 2AFQB 4E7RG 1T8NA 4NWLA 1AI8H 1YPLH 3PLKA 2Z9GA 1C5QA 2GZ9A 3FFGA 3MO6A 3EDXB 1RIWC 2FS9A 1F5KU 4XFQA 5FPYA 1TX8A 4M7GA 4XDEA 1HAYB 1MAXA 1FIZA 5CHAB 3M3VA 3EGKH 2D8WA 3A81A 1GHZA 4Y7AA 1NRPH 1MZDA 1IQFA 4OS7A 1FJSA 2G81E 1BBRK 1AWHB 2PR3A 1Z1JA 1ETRH 3BTME 4XBCA 1BA8B 4XSKU 1GDUA 3SQHE 2J4IA 5GCHG 1SGCA 1Y5UT 3M7UA 3SHCH 1TQ7B 3MWIU 1NY22 4YTAA 3UNQA 2BZ6H 1KXAA 1OWKA 1WSSH 4GHTA 3ZZ4A 1O0DH 1HAHH 2BMGB 2ZGXH 1KIGH 3UWJH 5T3HA 4Y11E 4NFEA 5A0CA 3S0NA 4FUDA 1Z6EA 2IN2A 4AFZA 2QN5T 5GCHF 1Y8TA 4A6LA 1V2LT 2BD3A 3NXPA 1TA6A 1N6YA 4YZUA 1YC0A 1K9OE 2G5NA 3F9FA 3A7WA 5FAHA 2ANWA 2ZTYA 1C2JA 3U69H 2O8MA 3RDZA 1Y3XA 2A2XH 1FY8E 3TH4H 1MD7A 3DD2H 4H4FA 1HDTH 2C8WB 1LMWB 5FCKA 1CVWH 1WV7H 1B0FA 1W3CA 1O3BA 1MTNC 3M5OA 3RC4A 1P04A 1LHDH 3UNRA 1O2LA 1G2MA 3K6ZA 3TGKE 3P8OA 2VNTA 2ZDVH 1G3DA 1P2IA 1VJAU 2BTCE 1BZXE 2GCHF 2GCTC 5DPAA 5A8XA 1O2UA 3T25A 2ANYA 1P3CA 2BXUH 2GGVB 1AWFH 1S0QA 4JZ1A 2HNTC 3MNXA 2PW8H 3BTKE 1XUIA 3QGJA 1TB6H 3LJJA 3KQCA 3T26A 4ABEA 5ABWA 3DHKH 3V7TA 2F83A 1HGTH 2WPMS 1Q3XA 1VITG 1GMCF 4A1VA 1O2IA 1SGEE 2BHGA 1ZSKA 1UHBB 2CXVA 4ABBA 2UUFB 3SN8A 1GI9B 4NCYA 1BHXB 1LHCH 1MTVA 2BZAA 1D3TB 1FAKH 1JBUH 4NGAH 1IQKA 1V2RT 1QFKH 2ZPQA 1GBLA 1OWEA 2A4GA 4CRDA 2P94A 2ZFQH 1O3HA 2K1QA 5JBTA 1AZZA 2G4UA 1SG8B 3MU1A 1C4Y2 1OP2A 3BTHE 1W0YH 2W3KA 2VVUA 3S69A 4DY7B 4R0IA 5JBBS 2IPHA 1AVGH 1ZOMA 2HOBA 3L6PA 3TITA 4HZHA 2XW9A 3AW0A 4YM9A 2BVSH 3VXEH 1O5DH 1TNLA 3PMBB 1Q2WA 2ZG0H 4JCNA 2C3SA 1C1RA 2P16A 4GPGA 3CS0A 2F9NA 1GBMA 1EJAA 1TE0A 1P01A 3VEQB 1BMLA 3ENSB 1EAXA 1JOUB 4B73A 1A7SA 4F49A 5E8EH 3VGCC 2J38A 3SV6A 1TGCA 1NZQH 1GMCG 3RU4E 1WQVH 1BTHH 1SR5C 1AB9C 2W7SA 2BM2A 2QY0B 2RCEA 1C5PA 2XBYA 2OCVB 1P02A 3SU0A 2GZ7A 1ELBA 3IG6B 3KQEA 1HFDA 2QV1A 1O5BB 1C9TA 2LIZA 2GV7A 2ASUB 1GBEA 2JETC 1G3CA 3LT3A 2FXRA 5C1YA 4CREA 2F9PA 2NWNA 3FP7E 1ELDE 2SNVA 4TPYA 1YPEH 1GDQA 3RXOA 1N1LA 1O2ZA 1GVLA 1ELEE 1ANDA 1BBRE 1KTTB 2VB0A 2ZIQH 4CBOA 1D4PB 3DT0H 3MU5A 1EPTB 4FXGH 3BTWE 3A85A 5EPYA 4Y79A 5DP8A 2VH6A 2NU4E 1UTPA 4Z6AH 1MTSA 1OWIA 1T31A 2SNWA 3ZVEA 1V2KT 2QXIA 2TRMA 4FU9A 4MNVA 3QLPH 2ZDMA 2QA9E 2FPZA 1PPBH 2NU1E 1ELVA 2AMDA 2HALA 3FZZA 3RXVA 4Y71A 1GMDF 2ODPA 1UJ1A 3TJOA 1Z8JB 1SQTA 1AB9B 1W2KH 2H5DA 4IMQA 2ZDNA 4RKOB 1GJ9B 4BAHB 3TJNA 4ZAEA 3T28A 1S84A 5HGGA 1C2KA 1LPKB 1MU8B 1TPPA 2FYRA 1O37A 4AGJA 4U2WA 5EW2H 1UVSH 1RXPA 3CS7A 3IITA 3O8RA 1CSOE 1ELCA 4X1SU 1SGTA 5DP6A 1EZXC 1QRXA 3P8FA 1EATA 2FOEA 4ZKOU 1FV9A 3GDVA 3EBNA 3PROA 1QB9A 2OC1A 4IN2A 5FXLA 3FZDA 1OS8A 3A80A 4MNWA 1SVPA 1GI2A 2Z9IA 1DANH 2H2ZA 2O8WA 5JYIA 2QIQA 4GCHF 4IMZA 4O03A 4AB8A 4D9QA 1V2ST 1O2GH 1F0SA 2XNIA 2YNBA 3PO1C 3MMGA 1DSUA 5C1UA 1P2QA 3M5MA 1BRCE 4ZHAA 1E36B 2ZQ2A 2ZU5A 2ZHEH 3M5NA 3B23B 1AKSB 1F5RA 4Y7BA 1F0RA 2TGTA 2FI3E 3M7QA 1EZUC 2B7DH 1ZGIA 1K21H 4K1SA 2ODQA 1UTNA 9ESTA 4X6PA 2ZI2H 1CHOG 4A5TS 1QJ1B 7LPRA 1KXBA 4DGJA 2FS8A 2FTLE 3EA7A 1TFXA 1O38A 4IW4E 2AH4X 2TGAA 5JB8S 2A7CA 2OD3B 1NRQH 4MPXA 1GBJA 2QGRA 1O3GA 2BB4A 2FTMA 1SGPE 3HGNA 1FZZA 1FY4A 5AHGH 3SI3H 3KF2A 1C2LA 2GT8A 5DO4H 4RSPA 1CA0C 1G36A 2FEQH 3IWMA 4IC6A 1HB0B 4AYYB 1C1UH 1ABIH 1F7ZA 1O30A 3RXHA 4ESTE 4JK6A 4O3UA 3VGCB 5C2ZA 1C1QA 2O9QA 1BITA 3RXLA 1MZAA 5JDUB 1O36A 2C4FH 4AN7A 3S9CA 1KSNA 1UCYH 1MH0A 4OGYA 3CENA 3K9XB 4JYVH 2Z9LA 2NU0E 1ID5H 1Z8RA 4X8VH 1GCDA 1VGCB 2Y5HA 1ETSH 4FUCA 4DW2U 1NN6A 2G00A 1S6FA 1EB2A 3ODFA 1ZHPA 3GICB 1V2WT 3W94A 3ZYDA 3F9EA 5GDSH 1XKAC 1ABJH 4QT8C 2XTTB 1XUHA 3PTNA 5I25A 1V2QT 3SNDA 1EZSC 1GI6A 3LPRA 1SOZA 5HXFA 2A4OA 1ZHRA 1EX3A 1MD8A 4AFUA 1XKBC 1GI0A 1EXFA 2F9BH 1GHBF 4NA7A 1O5GH 3P95A 4BXWA 1YCPK 5JB9S 1QQUA 4H6SB 1EP6A 1YCPM 4DCDA 1ANCA 3SU6A 1EPTC 5FHTA 3QDZB 2PUQH 1J9CH 4HI3A 3GY2A 1YLDA 3SV8A 3ZYEA 1MBMA 1O5AB 4KTSA 4K69A 2R3UA 2VIQA 5F8ZA 4ABIA 1EAWA 1MBQA 4ISOA 3MU8A 3UPEA 5I46H 1TRYA 1FI8A 1LKBA 1LQEA 4O9VA 5E0JA 4WXIA 3A83A 2GCTB 1N8OC 3QK1A 1TGSZ 6CHAB 1SPJA 1PPGE 2A45B 1GI1A 3QN7A 4K8BA 4HGCA 2A7HA 2XC5A 2P95A 4WWYA 5K0HA 1DE7H 2GDDA 1EKBB 2GMTB 3UQOA 2FX6A 3GY6A 1WCZA 1HAOH 2ZHDA 1QGFA 2BXTH 1DS2E 5EU8A 1HPGA 4I32A 2BX3A 4OS5A 2VIOA 2EC9H 4B76A 4TWWA 1LHFH 1BBRH 1ELGA 2QF3A 7KMEH 5CMXH 1SGFA 2CGAA 5C67A 4X8TH 3M3TA 2CJIA 1KLTA 3D49H 1DSTA 1XUJA 1O2RA 5T6DA 3A7TA 2W26A 2WPJS 3TVJB 1J8AA 3A8DA 1HAPH 3AVZA 1A5IA 2WUBA 3LOXA 3MH7A 1EOLA 4B2CA 1L2EA 2GV6A 1P9SA 3BG4B 1HAVB 2JETB 1K1MA 1CGHA 2ALPA 4YLUA 3D65E 2A31A 1GVZA 3TK5A 1TMUH 4LK4A 1MKXK 2UUYA 1D3QB 3DFLA 3FANA 1IQIA 2FYQA 3LH3A 1TBRH 4BXSA 1T4VH 4FUBA 3LONA 4Y76A 1A61H 1WYKA 2HNTE 1LVYA 1O2PA 4TYDA 2BVXH 1BUIA 4CBNA 1PPHE 3RC6A 4WMEA 2DE8A 1DUEA 4AOQA 4DIHH 5BRRE 1C5XB 2AMQA 2BDBA 1O2OA 4NIVA 1C1TA 2VWNA 1RGQA 3MO9A 1SGYE 1NM6A 2J9NA 4UEHH 5DJ7A 1DM4B 2BY5X 1C5OH 4FU7A 3TGJE 1FY5A 4AYVB 1C2FA 1FY3A 4WF8A 3VPKA 2WUCA 3P70B 4NFFA 1TA2A 1NFWA 2GVFA 4OGXA 3VB6A 2K7XA 2UUJB 1F5LA 2ANMH 2C8XB 2XCFA 1LPZB 1LVBA 3SJ8A 3B8JA 3SUEA 1HV7A 1OWHA 3HKJB 1THRH 4I8LA 3RXEA 1A2CH 3M7TA 1C2DA 2UWLA 3A7ZA 5IDKA 1A1RA 4AZ2B 3BTEE 2FIRH 1ZMLA 2HGTH 5EQQA 2XRCA 3RXDA 1NPMA 4O3TA 1J17T 1O33A 1V2MT 1GHYH 4KKDA 3RXGA 2ZU1A 1YCPH 1IQMA 1V2PT 1AN1E 2CHAC 1BRUP 3BTDE 1BRBE 2XBXA 3RXIA 1QCPA 5ETXA 1GJBB 2XCNA 4IN1A 1TLDA 4FUHA 1NTPA 1SLUB 1DDJA 1C1VH 2GT7A 3GISB 3TPIZ 1ZGVA 2VVCA 2ZHWH 1MAYA 4CHAC 4AB9A 3UREA 5HM9A 3D23A 4INLA 4NZQA 1ZRKA 4MNXA 3V12A 4RKJB 3W95A 5EGMA 4DT7B 1GBDA 1QNJA 1Z1IA 1SL3A 3Q00A 4MQAA 1D3DB 3ZZ7A 2FZZA 4BAQB 1ESTA 2AIQA 1TBQH 3URDA 1HAGE 1K1JA 1AFQB 2JKHA 1EJNA 2BY9X 2GZ8A 4A1XA 3TIUA 1O3MA 1J15A 3RXSA 2PWXA 2Y5FA 3PWCA 3VFEA 2VWOA 2BX4A 3ZVBA 2ZHFH 4I8JA 4JZFH 1O3DA 1OP8A 1A46H 1JMOH 3PV4A 1AD8H 1CT0E 8LPRA 3DFJA 3AAVA 1OYTH 2RG3A 3A7XA 5DKMA 1HJ8A 2OQ5A 3LH1A 5HMAA 1A0LA 4ZH8A 3PM3A 1LTOA 2Q6DA 1RJXB 2GCHG 3HPTB 4OS2A 1P03A 3K65B 2BVRH 1L4DA 1YPHC 2CF8H 3EE0B 1FNIA 4HFPB 4ISHH 3EA9A 1TX6A 2BD8A 2H9EH 1PPFE 1K1OA 3OU0A 1O2VA 1QL9A 1FQ3A 2C90B 2WINI 2JH0D 2C8ZB 1XUGA 3RXBA 3SJ9A 1B5GH 1C1OA 3A7VA 3S9BA 1JRTA 1O3AA 3SUFA 2EEKA 2WYJA 4Q7XA 1DXWA 1RIWB 1O2JA 5PTPA 1TNGA 2ZNKH 1GJ4H 1IQNA 1GGDC 3T27A 4LZ4B 3S7HB 3HATH 5EXNA 3GOVB 3ATMA 1P57B 3VB7A 4YT6H 1H9LB 3V13A 3RXAA 4E06H 1UTOA 1UTJA 2PGQB 5EXLA 5TCAA 4MTBA 3TH3H 2A0QB 1HAZB 1YPHE 2PSXA 6GCHG 1O3CA 1K22H 2CHAB 1GHWH 1YM0A 2Q6GA 3A84A 8GCHG 5GWZA 1Y3UA 4X2XA 2W5EA 3U1IB 2FESH 3GY7A 2BY6X 1IOEA 3SORA 1P9UA 4NZLA 3MNCA 3A7YA 1SBWA 2RDLA 1O32A 1GG6C 2STAE 5C5NA 1UVTH 2XBWA 5H4IB 4F4OC 5F6MA 1BIOA 1C5YB 1ZTJA 2A2QH 2V6NA 3M37A 4J1YA 1FLEE 4IBLH 3AAUA 3STJA 2BOHB 2A4QA 1ESAA 3TU7H 1VCPA 1ZRBA 2F9VA 4FVBA 1UK3A 4WH8A 1AIXH 5EW1H 1XUKA 4IS5A 5A09A 2P8OB 3O8BA 1SGIB 1YPJH 2B8OH 3ZZCA 1NU9A 1PQ8A 5E0GA 3LGUA 1O3LA 4ABAA 2YOLA 3V0XA 1TPOA 1C9PA 1CBWB 2NU3E 3PB1E 3JZ2B 4NWKA 2VWMA 3GY3A 4ISLA 2G4TA 4GLYA 5LH8A 5LPRA 2DE9A 3TLOA 3U8TH 5CHAC 1NFYA 3ATWA 4WH6A 3RC5A 1SHYA 3NUMA 1IQJA 1JWTA 1SQAA 1WOFA 2A1DB 1DUAA 2XBVA 5L6NH 1C5WB 2ZU4A 3TH2H 3I78A 2ALVA 1GJ6A 1G37A 3LGIA 4Q80A 1NO9H 2ZCLP 4GUXA 1T7CA 1KDQA 1FPCH 5FCRA 1O5FH 3GY4A 3I77A 3OTJE 5BPEA 1P2NA 3GYMA 1CBWC 3S7KB 3V3MA 3MNBA 1YGCH 3HGPA 4ZKRU 3E0NB 4H6TA 5DP4A 3PMJA 4CRBA 2Z3EA 1O3KA 4AFSA 3RXRA 2FI4E 4FUIA 4MVNA 1HBTH 1WAYB 3KGPA 1GGDB 1NRNH 1S85A 1V6DA 1P3EA 2ZHQH 1SFQB 1EUFA 1O5EH 2ZFFH 3M35A 2UUKB 5GJ4B 2Z3CA 1DWBH 1G32B 1TX7A 2R2WU 1O2HA 1OX1A 1NROH 2QAAA 3M36A 1O2TA 1GI7B 1TPAE 1QHRB 3PWBA 5ESTE 4BANB 3HK6B 4CR9A 3SJKA 3RXPA 2OC8A 1BTYA 2QXHA 2W7UA 1LHEH 3GCHB 1FN6A 2A5AA 2AGGX 4AG2A 4UFFH 1ZJDA 1CA8B 5A0AE 1BT7A 1S82A 2WV4A 1C2MA 2ZTXA 2Y7XA 1AUTC 3RMMH 4D8NA 1EASA 1TQ0B 4MLFB 1Z8IB 4ISIH 1NS3A 2P93A 5L2YH 3EA8A 1GBBA 4THNH 4CH2B 3E3TA 2ZDKA 1GCTC 1P8VC 3RXCA 2EA3A 1WTGH 1S81A 4E7NA 4FUGA 5C20A 2BLVA 3RXJA 1A5GH 3ZZ9A 2J95A 4Q7ZA 2BLWA 1YPMH 1N6XA 3VXFH 1O34A 4MPUA 5TCCA 4ABJA 3KIDU 1YPKH 3SU3A 5E0HA 3ESTA 3LU9B 1UVOA 1HXFH 2FOFA 2WV5A 4JYTA 3ZZ3A 2ILNA 1UMAH 3LDXH 4B74A 3BEFB 1J14A 4XBBA 4BAKB 1UCYK 3UQVA 2Z3DA 2VGCB 1QBOA 2Y82A 5E2OA 2ZDLA 1VCWA 4TY6A 1UTQA 1ELAA 4X1QU 4LXBH 1ETTH 1KXFA 7GCHG 4X6MA 5EXMA 1QL7A 2OUAA 4ISNA 4MNYA 2BQ7B 3A8AA 4X6NA 3RP2A 4AX9H 3MU4A 4MPWA 3VB4A 1ZZZA 3NK8A 4CRAA 5F8XA 1C5RA 2V3OH 3P6ZB 4I8GA 1IAUA 2Y6TA 1TOCB 5G4BA 5AFYH 1ESBA 3KL6A 3GCNA 1C1WH 1A3BH 4DIIH 4FUJA 2G55A 3KHVA 3TK6A 5TJXA 1E38B 3Q3KA 4GCHG 1PFXC 2BDHA 2VWLA 2FOCA 3BTQE 3LC5A 1KDQB 4UD9H 1W7GH 1G3EA 4YT7H 2TIOA 1CE5A 3MOCA 2QC2A 1OKXA 1DX5M 1ELFA 2QF0A 5L2ZH 1UVUH 2ZFSA 1PPCE 1EOJA 2I6SA 1C2IA 1HRTH 1E34B 2P3TB 2ZU3A 1DXPA 1C4V2 2BD9A 3P8NA 4DG4A 3L3TA 1HUTH 2BLQA 1O31A 2VIDA 2BDYA 3GY5A 1L1JA 1P2KA 3LGTA 3STIA 3OSYA 4X2VA 3ATLA 1NESE 3SBKA 1ZPCA 1UCYE 4FUFA 1F0TA 1FN8A 1SGQE 1QL8A 2PTNA 4TY7A 1P09A 2H1UA 2OTVA 1C5TA 1UK2A 3SOSA 3SNAA 1Y5AT 2VVVA 1BB0B 4NG9H 2PV9B 4LZ1H 2ZDAH 3UR9A 1FY1A 1X7AC 2ZC9H 3SW2B 1GL0E 3A87A 2TBSA 3NWUA 3U1JB 4NSVA 3U9AH 4BOHA 2J94A 4WY3A 1CT2E 3TNSA 3BG8A 3F68H 4XBDA 1SGDE 3SNEA 2OC7A 3MYWA 4MDSA 2P59A 4KGAA 2P8OC 5IYTA 2Z9JA 1GBHA 4ZUHA 1ZPBA 1H9IE 2HPQH 2PTCE 3RXTA 5DG6A 1O5CB 4INKA 4MPVA 5DP7A 3C1KA 1Y59T 4Q2KA 1ELTA 1VITF 2Z6BD 1AGJA 4Y8XA 3SV9A 1GHAF 3UTUH 1TYNA 3BTGE 2AYWA 2WPIS 4ZXYH 3ITIA 3GY8A 1HLTH 3RLWH 4ZMAH 5B6OA 2ZZUH 3SI4H 3M3SA 3MTYA 1AFQC 1VZQH 2W3IA 3LGYA 1Z8GA 3KQDA 4ABGA 1MTNB 4UDWH 1W14U 2ZO3H 2ZFTA 2OC0A 4ASHA 1B7XB 3RXQA 3RU4D
chains in the Genus database with same CATH superfamily
1XX9A 2FLRH 2FP7B 1AE5A 1SKYE 3G01A 3UOPA 3Q76A 2GP9B 2XWBI 2LNCA 1XXFA 1L1NA 3BG4C 1GCTB 2R9PA 5C0TA 3RUOA 1AVXA 1SB1H 3KN2A 3O8CA 2M5TA 1DOJA 1M9UA 1P10A 1O3PB 2JH5D 1BHXF 2JIZD 1K1PA 2WHXA 1HIAA 1V2OT 2HVYB 1LDTT 1F0UA 2GDEH 3RM2H 1G3BA 1HJ9A 2LELA 3ZVFA 1W0JD 4NIXA 1KY9A 2A5IA 2A32A 1FONA 2OBOA 3OFND 1TMBH 2AGEX 4FVDA 2HVXA 5DGJA 1UTMA 1O3NA 1TGBA 2V35A 2BD7A 1YYY1 2OLGA 2BQ6B 4J2YB 2VJ1A 3MH6A 2Q1JA 2M2AA 3LC3A 3PYHA 2Z94A 1UVPA 1MTUA 1NRSH 1F2SE 3BN9A 4JYUH 3SO3A 1SQOA 1DVAH 2ZECA 3FOAA 1C5NH 5LGOA 4BAOB 5EODA 1GVKB 1QA0A 6GCHF 3N7OA 1SFIA 3CNRA 4RN6A 3P8GA 5DP5A 1A4WH 4AORA 3GDUA 2H5CA 1KLJH 4K1EA 1O3IA 4MG3A 1DWEH 3LJOA 2G52A 1TALA 2R3YA 1GMHF 2I6QA 1K1LA 3N7DA 4KTCA 1GHVH 2F91A 1RD3B 1A0JA 2VIPA 3DA9B 3SUDA 1ORFA 1DLEA 4DURA 3SGBE 3VB3A 2IJOB 3SU4A 5C1XA 1AU8A 1H8IH 2G51A 1ZSLA 2EI8A 1W13U 3NKKA 2SFAA 2XWAA 2V0BA 1AUJA 4OS1A 2AMPA 4ACAA 1C2HA 2BD4A 2J34A 3QTVH 5IK2D 1T8LA 4AFQA 1YBWA 4A7IB 3M5LA 4Z0KA 2FOBA 2FX4A 1HAXB 3A86A 2ZCKP 1L1GA 5DP9A 1FPHH 1P12E 3RXKA 3ATKA 2A7JA 3UOUA 3ZZ6A 3D62A 1F92A 3F0OA 1TRMA 1RTKA 2OINA 2R0LA 2GX4A 1QJ7B 1GBIA 4UFEH 3WWFA 1YP9A 1E0FD 2XXLA 1GJ5H 3OY6U 1GBKA 3BTTE 2P3FH 1O3EA 1V3XA 2PFEA 3S9AA 1C5MD 2KAIA 5F03A 3BIVH 1PYTD 1B0EA 1O2MA 1CU1A 1S83A 1LCYA 3TNTA 2ZKSA 3SGAE 1PYTC 1BMFD 1LO6A 3RLYH 1O35A 2FO9A 1MU6B 2XYAA 3VB5A 3A88A 2Y5GA 1IQLA 4B75A 1TNJA 1BTWA 1MKWK 2WPLS 5T6FA 4I8KA 4GSOA 3SGQE 4I8HA 1L4ZA 1VCQA 1NFUA 1KTSB 4BTIB 1YLCA 1NBMD 4A1TA 2EI6A 2R2MB 3SJIA 3P92A 3UWIA 3OEED 1DY8A 3SV2H 1BMNH 3RXUA 2ZGHA 4HTCH 2YNAA 3M61U 3AASA 3SUGA 2BY7X 1GHBG 5L30H 4TPIZ 5SGAE 1RTFB 1D6RA 1OWJA 1T8OA 2ZWLH 1O3JA 8KME2 4GHQA 1AZ8A 4BAMB 1BJUA 2LPRA 1AKSA 2FOHA 4ZROA 3U8RH 4K2YA 3F1SB 3E91A 1DITH 4B1TA 1PQ7A 6CHAC 3KEEA 1HJAC 5FX5A 1DY9A 1LHGH 3AW1A 3R0FA 2D26C 4FUEA 4YLQH 2OP9A 3SU1A 1MQ6A 1ZSJA 3KQBA 2H9HA 1HIAB 2VIVA 4I86A 1V2NT 5C3NA 3NPSA 1G30B 2F9UA 4D9RA 1IQEA 4ZHLU 1Q31A 4K1TA 1A5HA 5AVDA 1S0RA 3BTFE 2HNTF 2VIWA 3QZRA 1O2NA 1QQ4A 3FVFB 3GYLB 1LVOA 2G5VA 1BJVA 1TWXB 3QO6A 2PUXB 3F9GA 1ARBA 1C5VA 2SGFE 2BD2A 2AIPA 2O8UA 5FBIA 1NC6A 1V2UT 4YO9A 2C93B 4D7GA 1AVWA 4UONA 2O8TA 1GBAA 1IHTH 1NT1A 2A4RA 4NA9H 3TK9A 6LPRA 4WXVA 4D7FA 2CV3A 4DOQA 3GCTG 4ZXXH 1EQ9A 1GG6B 4Y0YE 1MMJN 3FP6E 5K7RA 1RTLA 4AG1A 4R8TB 2VINA 4NIWA 3F3BA 1IQHA 2RA3A 1PPZA 4ABDA 1AQ7A 2QCYA 3T5FH 3ZZ8A 4OS4A 3ZZDA 2HWLB 9LPRA 4K5ZA 1VGCC 2WPHS 5C5OA 3NCLA 3I29A 5EJLA 1D9IA 3UUZA 1KXEA 1VR1H 2Y81A 1EB1H 3BEUA 4YESB 2FLBH 2RA0A 3ZZ5A 1TNHA 4IC5A 3SZNA 1ZMNA 1HJAB 1GDNA 1DLKB 1P0SH 1GHXH 1MKWH 4ZHMU 1ZMJA 4WJG2 5AF9H 1LPGB 2PKSB 1TABE 1PJPA 1SHHB 4K8YA 3RXMA 1K1IA 1K1NA 1PQAA 1XM1A 3MH4A 1BTXA 3R3GB 2FOMB 1HAVA 1W7XH 4Y0ZE 4RT1A 1O2XA 3MU0A 3PLBA 1Z71A 3L33A 2SGDE 3ZZAA 2B9LA 2V3HH 3PV5A 2D1JA 3Q77A 1MUEB 4ABHA 1SLVB 1BCUH 4Y8YA 5T1VA 2BDCA 2FDAA 4X8UH 1TPSA 1WTHD 2TGDA 4INHA 1GL1A 3O8DA 1XVOA 1P2MA 5EJ1A 1O2KA 1QRWA 2KCYA 3E1XB 4ASUD 1TRNA 1XXDA 1J16A 4F55A 4OS6A 1UHBA 1P2JA 4X6OA 2ZFRH 5FX6A 4KELA 3SJOA 3GDSA 3E6PH 1OWDA 1TAWA 3GCOA 1GBTA 4LOYH 5FPSA 4IGDA 1ZR0A 2WYGA 1TONA 2AS9A 1GBCA 1K28D 4M9FA 4TT3D 4CR5A 1V2VT 4FU8A 6ESTA 1C1MA 2A5KA 2WPKS 1OXGA 1Y3VA 2ZU2A 2ODYB 1JIMA 1THPB 2PHBA 2QXJA 3ATIA 2AGIX 4ZKNU 1AO5A 2FODA 1CQQA 1FAXA 1GWAA 3FAOA 1CHOF 1RS0A 1DWCH 3OTPA 4UE7H 2EI7A 5C0UA 1MTWA 2HLCA 1ZTKA 3MH5A 4BNRA 5ESBA 1HYLA 2ZPSA 5FPTA 3UB0A 3BIUH 1ZLRA 1EZQA 4I31A 3BEIB 4DJZB 3U98H 3RXFA 1H8DH 1ZTLA 4CH8B 2BOKA 2QXGA 5E2PA 2EY4C 1GI5A 1LQDB 1GI3A 1P2OA 3T62A 3UY9A 2GJGA 2CF9H 4ZKSU 2ZGJA 2ZTZA 3A8CA 2D2DA 1GJAB 1BMAA 2Y7ZA 2V7QD 3QWCH 1THSH 4H42U 4JZIA 2SGEE 4DVAU 4U01A 1Z6JH 3KCGH 3UFAA 4Y6DA 1W0ZU 2TPIZ 2K0QA 2ZA5A 4O97A 2PKAB 3BSQA 4TSFD 1EAUA 2PLXA 3RMNH 1NFXA 1H4WA 1QY6A 1COWD 1QB6A 1GBFA 5DK1A 1O2YA 2GTBA 4NA8A 1ANEA 1DWDH 3RU4T 2FWWA 1AE8H 3PLPA 1BTZA 1JIRA 2F9OA 2IOTA 1C1NA 3E16B 3SU5A 2BDIA 3UR6A 3HK3B 4Y8ZA 5HIYA 3Q3YA 2BQWB 3ZIAD 2XC0A 3ZZBA 1Y3WA 1SGNE 4VGCB 1UK4A 5A8YA 1ZJKA 2ZPRA 2TGPZ 1UTLM 2ESTE 3ELAH 1MKXH 2B5TB 2PGBB 3LGWA 1EPTA 2GD4B 1QTFA 1DT2A 1ZPZA 1SMFE 2BDGA 5J4SA 1LVMA 3RM0H 1ACBE 4BTTB 1OOKB 3LKWA 2VGCC 1Y5BT 4Y10E 1HCGA 3U8OH 2AERH 1FIWA 1FUJA 1TGNA 1P06A 2KZ4A 2CN0H 5HYOA 3UNSA 5EQSA 4TWYA 1S5SA 3T2NA 3ZV9A 1O2QA 1OSSA 1SOTA 1GMDG 2G8TA 1KXDA 3QGNB 1MQ5A 3GS9A 2STBE 2OQUA 4PROA 1WUNH 1SGRE 1AFEH 2AHME 3BV9B 3KNXA 3TJVA 4ABFA 3GCTF 5A0BA 1FMGA 5LPEA 2Z9KA 3F0PA 4GVUA 1OYQA 3A89A 1TMTH 1A0HB 3K2UA 3SHAH 3H7OA 3F2FA 1KYNA 3WW7A 2BLOA 3H5CB 1DPOA 1GJ7B 3E8LA 4SGBE 1ARCA 1E35B 2FOGA 4X2YA 1C1SA 2J92A 4WMDA 3DSOA 4U30A 3H7TA 1CO7E 3WY8A 3C27B 1JXPA 2FOAA 1OPHB 2Y80A 3FP8E 4GAWA 2UWPA 4UFDH 1G9IE 5GPIB 4CRGA 1YKTA 1CGJE 1OHHD 4DT4A 4YOJA 1BDAA 2PSYA 4JMYA 1W8BH 3ZVAA 1GI8B 3OYPA 5J4QA 2Z7FE 3QTOH 1S6LA 4X1PU 1AMHA 3PMHB 2ZGBH 1EAIA 3MNSA 1QA7A 1TNKA 1D6WA 3EYDA 1PQ5A 2FMJA 3SNBA 1V2TT 1FDPA 4KP0A 3E90B 1C5UA 1BQYA 1O2WA 5AFZH 3SQEE 2JH6D 2R0KA 1C5SA 1V2JT 2ULLA 1WBGB 4E05H 4WMFA 1SLXB 1QBVH 2GMTC 2ZGCA 1S6HA 1O3OA 1O2SA 1HXEH 2BY8X 2VU8E 2ZP0H 5A2MH 3Q3XA 2GKVE 2AEIH 1C4U2 1GJ8B 5JBAS 4CHAB 5DP3A 1O39A 1N8OB 3RMOH 1ANBA 3FKSD 3EAJA 1W12U 2PKAA 1TNIA 1DICA 5A8ZA 3QX5H 1QRZA 1UO6A 1E1RD 1WU1A 4JZEH 4SGAE 2THFB 1KLIH 1CT4E 4B6FA 2UWOA 1P11E 1K2I1 2QYIA 1CHGA 1ZYOA 1HNEE 1XVMA 4XRNA 4JZDH 3EQ0H 2SGQE 1XUFA 3GCHC 3NZIA 1BOQA 2FM2A 1YPGH 1AY6H 1EJMA 1NRRH 3BF6H 4P00A 1RRKA 1UTKA 4HG6A 3OX7U 3JZ1B 3LIWA 2SGPE 4NSYA 1QB1A 1IQGA 3PMAB 1LKAA 3MFJA 3P17H 4YOGA 1G2LA 2P3UB 5FBEA 2JDID 4CRCA 4NIYA 1TIOA 1BRAA 1GMHG 2BDAA 3E0PB 2ZEBA 4FETA 3K6YA 2HRVA 1VITH 1SGFG 1A3EH 5EQRA 2VH0A 4AGKA 2J2UA 1QZ8A 1SSXA 1SI5H 2KCPA 1QBNA 4UFGH 4CRFA 4X1NU 2BYAX 1PPEE 4X1RU 4A92A 1EP5A 1CGIE 4BTUB 3MI4A 7GCHF 3UIRA 1RFNA 3F6UH 3SU2A 1U6QA 3CP7A 2PP6A 1GJDB 5T6GA 1BMMH 3TGIE 5EPNA 5HM2A 3SV7A 3SNCA 1E37B 4I33A 2ZQ1A 1H1BA 4YOIA 5CHBA 5GXPA 4B71A 4I7YH 2H9TH 4Q7YA 1XMNB 2FI5E 3PTBA 2ANKH 4XOJA 1CA0B 1JRSA 1TBZH 4B2AA 1MCTA 1Z7KA 1QR3E 5EOKA 2NU2E 2J5UA 1WQSA 2XC4A 5F8TA 1Y3YA 5LPFA 4XE4A 3LGVA 1W10U 1NU7B 1FX0B 4X0WU 1OP0A 1QJ6B 2KAIB 5C17A 1W11U 1O3FA 2F3CE 2C8YB 2Q6FA 2ZFPH 1EFRD 4OM9A 1DFPA 5GIBA 2O8LA 1SC8U 2WV9A 2OBQA 1C2EA 1GI4A 1SLWB 2HPPH 2CMYA 2JJ2D 3A82A 3ZVCA 3ZVGA 5CE1A 4VGCC 1BTUA 1P05A 3MO3A 1FXYA 2XOKD 1AHTH 1T32A 1L0ZA 1HAIH 4K3JA 1GHAG 1T4UH 5JPMH 2BD5A 2H6MA 1MCVA 5EG4A 2ZF0H 4U32A 7ESTE 4D76A 3MHWU 8GCHF 5JBCS 3ODDA 1INCA 3ZV8A 2DUCA 3QZQA 2B0FA 1H9HE 3RMLH 3A8BA 3PO1B 4KTUA 2JJ1D 1TOMH 1IHSH 2PKSC 2SGAA 4K60A 4X8SH 1TGTA 1YF4A 4WVPE 2OXSA 3URCA 1C5LH 1QURH 4B2BA 3QUMP 1D3PB 1BTPA 3OY5U 1KXCA 1GJCB 1QIXB 1VJ9U 4JK5A 8ESTE 1T8MA 3DUXH 3ZVDA 3HKIB 3F9HA 3B9FH 1C1PA 1GPZA 4X2WA 2ZCHP 3T29A 1C5ZB 1ZHMA 1C2GA 2W6ID 3TJUA 2AFQB 4E7RG 5GNDA 1T8NA 4NWLA 1AI8H 1YPLH 3PLKA 2Z9GA 1C5QA 2GZ9A 3FFGA 3MO6A 3EDXB 1RIWC 2FS9A 1F5KU 4XFQA 5FPYA 1TX8A 4M7GA 4XDEA 1HAYB 1MAXA 1FIZA 5CHAB 3M3VA 3EGKH 2D8WA 3A81A 1GHZA 4Y7AA 1NRPH 1MZDA 1IQFA 4OS7A 1FJSA 2G81E 1BBRK 1AWHB 2PR3A 2VBCA 1Z1JA 1ETRH 3BTME 4XBCA 1BA8B 4XSKU 1GDUA 3SQHE 2J97A 2J4IA 5GCHG 1SGCA 1Y5UT 3M7UA 3SHCH 1TQ7B 3PRBA 3MWIU 1NY22 4YTAA 3UNQA 2BZ6H 1KXAA 1OWKA 1WSSH 4GHTA 3ZZ4A 1O0DH 1HAHH 2BMGB 2ZGXH 1KIGH 3UWJH 5T3HA 4Y11E 4NFEA 5A0CA 3S0NA 4FUDA 1Z6EA 2IN2A 4AFZA 2QN5T 5GCHF 1Y8TA 4A6LA 4YXWD 1V2LT 2BD3A 3NXPA 1TA6A 1N6YA 4YZUA 1YC0A 1K9OE 2G5NA 3F9FA 3A7WA 5FAHA 2ANWA 2ZTYA 1C2JA 3U69H 2O8MA 2J98A 3RDZA 1Y3XA 2A2XH 1FY8E 2L6OA 3TH4H 1MD7A 3DD2H 4H4FA 5B6LA 1HDTH 2C8WB 1LMWB 5FCKA 1CVWH 1WV7H 1B0FA 1W3CA 1O3BA 1MTNC 3M5OA 3RC4A 1P04A 1LHDH 3UNRA 1O2LA 1G2MA 3K6ZA 3TGKE 3P8OA 2VNTA 2ZDVH 1G3DA 3SYJA 1P2IA 1VJAU 2BTCE 1NBME 1BZXE 2GCHF 2GCTC 5DPAA 5A8XA 1O2UA 3T25A 2ANYA 1P3CA 2BXUH 2GGVB 1AWFH 2CK3D 1S0QA 4JZ1A 2HNTC 3MNXA 2PW8H 3BTKE 1XUIA 3QGJA 1TB6H 3LJJA 3KQCA 1E1QD 3T26A 4ABEA 5ABWA 3DHKH 3V7TA 2F83A 1HGTH 2WPMS 1Q3XA 1VITG 1GMCF 4A1VA 1O2IA 1SGEE 2BHGA 1ZSKA 1UHBB 2CXVA 4RI0A 4ABBA 2UUFB 3SN8A 1GI9B 4NCYA 1BHXB 1LHCH 1MTVA 2BZAA 1D3TB 1FAKH 1JBUH 4NGAH 1IQKA 1V2RT 1QFKH 2ZPQA 1GBLA 1OWEA 5C94A 2A4GA 4CRDA 2EQNA 2WPDD 2P94A 2ZFQH 1O3HA 5EJZA 2K1QA 5JBTA 1AZZA 2G4UA 1SG8B 3MU1A 1C4Y2 1OP2A 3BTHE 1W0YH 2W3KA 2VVUA 3S69A 4DY7B 2KX4A 4R0IA 5JBBS 2IPHA 1AVGH 1ZOMA 2HOBA 3L6PA 3TITA 4HZHA 2XW9A 3AW0A 4YM9A 2BVSH 3VXEH 1O5DH 1TNLA 3PMBB 1Q2WA 2ZG0H 4JCNA 2C3SA 1YWUA 1C1RA 2P16A 4GPGA 3CS0A 2F9NA 1GBMA 1EJAA 1TE0A 1P01A 3VEQB 1BMLA 3ENSB 1EAXA 1JOUB 4B73A 1A7SA 4F49A 5E8EH 3VGCC 2J38A 3SV6A 1TGCA 1NZQH 4B6EA 1GMCG 3RU4E 1WQVH 1BTHH 1SR5C 1AB9C 2W7SA 2BM2A 2QY0B 1C5PA 2RCEA 2XBYA 2OCVB 1P02A 3SU0A 2GZ7A 1ELBA 3IG6B 3KQEA 1H8ED 1HFDA 2QV1A 1O5BB 1C9TA 2LIZA 2GV7A 2WSSD 2ASUB 1GBEA 2JETC 1G3CA 3LT3A 2FXRA 5C1YA 4CREA 2F9PA 2NWNA 3FP7E 1ELDE 2SNVA 4TPYA 1YPEH 1GDQA 3RXOA 1N1LA 1O2ZA 1GVLA 3DSGA 1ELEE 1ANDA 1BBRE 1KTTB 2VB0A 2ZIQH 4CBOA 1D4PB 3DT0H 3MU5A 1EPTB 4FXGH 3BTWE 3A85A 5EPYA 4Y79A 5DP8A 2VH6A 2NU4E 1UTPA 4Z6AH 1MTSA 1OWIA 1T31A 2SNWA 3ZVEA 1V2KT 2QXIA 2TRMA 4FU9A 4MNVA 3QLPH 2ZDMA 2QA9E 2FPZA 1PPBH 2NU1E 2IJD1 1ELVA 2AMDA 2HALA 3FZZA 3RXVA 4Y71A 1GMDF 2ODPA 1UJ1A 3TJOA 1Z8JB 1SQTA 1AB9B 1W2KH 2H5DA 4IMQA 2ZDNA 4RKOB 1GJ9B 4BAHB 3TJNA 4ZAEA 3T28A 1S84A 5HGGA 1C2KA 1LPKB 1MU8B 1TPPA 2FYRA 2OK5A 1O37A 4AGJA 4U2WA 5EW2H 1UVSH 1RXPA 3CS7A 3IITA 3O8RA 3DCLA 1CSOE 1ELCA 4X1SU 1SGTA 5DP6A 1EZXC 1QRXA 3P8FA 1EATA 2FOEA 4ZKOU 1FV9A 3GDVA 3EBNA 1WDIA 3PROA 1QB9A 2OC1A 4IN2A 5FXLA 3FZDA 1OS8A 3A80A 4MNWA 1SVPA 1GI2A 2Z9IA 1DANH 2H2ZA 2O8WA 5JYIA 2QIQA 4GCHF 4IMZA 4O03A 4AB8A 4D9QA 1V2ST 2RFKC 1O2GH 1F0SA 2XNIA 2YNBA 3PO1C 3MMGA 1DSUA 5C1UA 1P2QA 3M5MA 1BRCE 2YMSB 4ZHAA 1E36B 2ZQ2A 2ZU5A 2ZHEH 3KYFA 3M5NA 2V3MA 3B23B 1AKSB 1F5RA 4Y7BA 1F0RA 2TGTA 2FI3E 3M7QA 1EZUC 2B7DH 1ZGIA 1K21H 4K1SA 2ODQA 1UTNA 9ESTA 4X6PA 2ZI2H 1CHOG 4A5TS 1QJ1B 7LPRA 1KXBA 4DGJA 2FS8A 2FTLE 3EA7A 1TFXA 1O38A 4IW4E 5F53A 2AH4X 2TGAA 5JB8S 2A7CA 2OD3B 1NRQH 4MPXA 1GBJA 2QGRA 1O3GA 4RT0A 2BB4A 2FTMA 3SZEA 1SGPE 3HGNA 1FZZA 1H8HD 1FY4A 5AHGH 3SI3H 3KF2A 1C2LA 2GT8A 5DO4H 4RSPA 1CA0C 3N7EA 1G36A 2FEQH 5KGOA 3IWMA 4IC6A 1HB0B 4AYYB 1C1UH 1ABIH 1F7ZA 1O30A 3RXHA 4ESTE 4JK6A 4O3UA 3VGCB 5C2ZA 1C1QA 2O9QA 1BITA 3RXLA 1MZAA 3UAIC 5JDUB 1O36A 2C4FH 4AN7A 3S9CA 1KSNA 1UCYH 1MH0A 4OGYA 3CENA 3K9XB 4JYVH 2Z9LA 2NU0E 1ID5H 1Z8RA 4X8VH 1GCDA 1VGCB 2Y5HA 1ETSH 4FUCA 4DW2U 1NN6A 2G00A 1S6FA 1EB2A 3MQKC 3ODFA 1ZHPA 3GICB 1V2WT 3W94A 3ZYDA 3F9EA 5GDSH 1XKAC 1ABJH 4QT8C 2KCOA 2XTTB 1XUHA 3PTNA 5I25A 1V2QT 3SNDA 1EZSC 1GI6A 3LPRA 1SOZA 5HXFA 2A4OA 1ZHRA 1EX3A 1MD8A 4AFUA 1XKBC 1GI0A 1EXFA 2F9BH 1GHBF 4NA7A 1O5GH 3P95A 4BXWA 1YCPK 2XNDD 5JB9S 1QQUA 4H6SB 1EP6A 1YCPM 4DCDA 1ANCA 3SU6A 1EPTC 5FHTA 3QDZB 2PUQH 1J9CH 4HI3A 3GY2A 1YLDA 3SV8A 3ZYEA 1MBMA 1O5AB 4KTSA 4K69A 4Q4LA 2R3UA 2VIQA 5F8ZA 4ABIA 1EAWA 1MBQA 4ISOA 3MU8A 2KCAA 3UPEA 5I46H 1TRYA 1FI8A 1LKBA 1LQEA 4O9VA 5E0JA 4WXIA 3A83A 2GCTB 3W1EA 1N8OC 3QK1A 1TGSZ 6CHAB 1SPJA 1PPGE 2A45B 1GI1A 3QN7A 4K8BA 4HGCA 2A7HA 2XC5A 2P95A 4WWYA 5K0HA 1DE7H 2GDDA 1EKBB 2GMTB 3UQOA 2FX6A 3GY6A 1WCZA 1HAOH 1K0HA 2ZHDA 1QGFA 2BXTH 1DS2E 5EU8A 1HPGA 2KM0A 4I32A 2BX3A 4OS5A 2VIOA 2EC9H 4B76A 4TWWA 1LHFH 4AC9A 1BBRH 1ELGA 2QF3A 7KMEH 5CMXH 1SGFA 2CGAA 5CDFE 5C67A 4FOUC 4X8TH 3M3TA 2CJIA 1KLTA 3D49H 1DSTA 1XUJA 1O2RA 5T6DA 3A7TA 3OEHD 2W26A 2WPJS 3TVJB 1J8AA 3A8DA 1HAPH 3AVZA 1A5IA 2WUBA 3LOXA 3MH7A 1EOLA 4B2CA 1L2EA 2GV6A 1P9SA 3BG4B 1HAVB 2QF4A 2JETB 1K1MA 1CGHA 2LP6A 2ALPA 4YLUA 3D65E 2A31A 1GVZA 3TK5A 1TMUH 4LK4A 1MKXK 2UUYA 1D3QB 3DFLA 3FANA 1IQIA 2FYQA 3LH3A 1TBRH 4BXSA 1T4VH 4FUBA 3LONA 4Y76A 1A61H 1WYKA 2HNTE 1LVYA 1O2PA 4TYDA 2BVXH 1BUIA 4CBNA 1PPHE 3RC6A 4WMEA 2DE8A 1DUEA 4AOQA 4DIHH 5BRRE 3DSPA 3VG8A 1C5XB 2AMQA 2BDBA 1O2OA 4NIVA 1C1TA 2VWNA 1RGQA 3MO9A 1SGYE 3FO8D 1NM6A 2J9NA 5HIZA 4UEHH 5DJ7A 1DM4B 2BY5X 1C5OH 3PV2A 4FU7A 3TGJE 1FY5A 4AYVB 1C2FA 1FY3A 4WF8A 3VPKA 2WUCA 3P70B 4NFFA 1TA2A 1NFWA 2GVFA 4F48B 4OGXA 3VB6A 5DSFA 2K7XA 2UUJB 1F5LA 2ANMH 2C8XB 2XCFA 1LPZB 1LVBA 3SJ8A 3AK5A 3B8JA 3SUEA 1MABB 1HV7A 1OWHA 3HKJB 1THRH 4I8LA 3RXEA 1A2CH 2F4LA 3M7TA 1C2DA 2UWLA 3A7ZA 5IDKA 1A1RA 4AZ2B 3BTEE 2FIRH 1ZMLA 2HGTH 5EQQA 2J98B 2XRCA 3RXDA 1NPMA 4O3TA 1J17T 1O33A 1V2MT 1GHYH 4KKDA 3RXGA 2ZU1A 1YCPH 1IQMA 1V2PT 1AN1E 2CHAC 1BRUP 3BTDE 1BRBE 2XBXA 1W0KD 4Z1MD 3RXIA 3WWBA 1QCPA 5ETXA 1GJBB 5HKKD 2XCNA 4IN1A 1TLDA 4FUHA 1NTPA 1SLUB 1DDJA 1C1VH 2GT7A 3GISB 3TPIZ 1ZGVA 2VVCA 3OE7D 2ZHWH 1MAYA 4CHAC 4AB9A 3UREA 5HM9A 3D23A 4INLA 4NZQA 1ZRKA 4MNXA 3V12A 4RKJB 3W95A 5EGMA 4DT7B 1GBDA 1QNJA 1KMHB 1Z1IA 1SL3A 3Q00A 4MQAA 5EIYA 1D3DB 3ZZ7A 2FZZA 4BAQB 1ESTA 2AIQA 1TBQH 3URDA 1HAGE 1K1JA 1AFQB 2JKHA 1EJNA 2BY9X 2GZ8A 4A1XA 3TIUA 1O3MA 1J15A 3RXSA 2PWXA 2Y5FA 3PWCA 3VFEA 2VWOA 2BX4A 3ZVBA 2ZHFH 4I8JA 4JZFH 1O3DA 1OP8A 1A46H 1JMOH 3PV4A 1AD8H 1CT0E 8LPRA 3DFJA 3AAVA 1OYTH 2RG3A 3A7XA 5DKMA 1HJ8A 2OQ5A 3LH1A 5HMAA 1A0LA 4ZH8A 3PM3A 1LTOA 2Q6DA 1RJXB 2GCHG 3HPTB 4OS2A 1P03A 3K65B 2BVRH 1L4DA 1YPHC 2CF8H 3EE0B 1FNIA 4HFPB 4ISHH 3EA9A 1TX6A 2BD8A 2H9EH 1PPFE 1K1OA 3OU0A 1O2VA 1QL9A 1FQ3A 2C90B 2WINI 2JH0D 2C8ZB 1XUGA 3RXBA 3SJ9A 1B5GH 1C1OA 3A7VA 3S9BA 1JRTA 1O3AA 3SUFA 2EEKA 2WYJA 4Q7XA 1DXWA 1RIWB 1O2JA 5PTPA 1TNGA 2ZNKH 1GJ4H 1IQNA 1GGDC 3T27A 4LZ4B 3S7HB 3HATH 5EXNA 3GOVB 3ATMA 1P57B 3VB7A 4YT6H 1H9LB 3V13A 3RXAA 4E06H 1UTOA 1UTJA 1UW7A 2PGQB 2W6JD 1WXRA 5EXLA 5TCAA 4MTBA 3TH3H 2A0QB 1HAZB 1YPHE 2PSXA 6GCHG 1O3CA 1K22H 2CHAB 1GHWH 2QE7D 1YM0A 2Q6GA 3A84A 8GCHG 5GWZA 1Y3UA 4X2XA 3EE7A 2W5EA 3U1IB 2FESH 3GY7A 2BY6X 1IOEA 3SORA 1P9UA 4NZLA 3MNCA 3A7YA 1SBWA 2RDLA 1O32A 1GG6C 2STAE 5C5NA 1UVTH 2XBWA 5H4IB 4F4OC 5F6MA 1BIOA 1C5YB 1ZTJA 2A2QH 2K8IA 2V6NA 3M37A 4J1YA 1FLEE 4IBLH 3AAUA 3KYGA 3STJA 3NRLA 2BOHB 2A4QA 1ESAA 3F2GA 3TU7H 1VCPA 1ZRBA 2F9VA 4FVBA 1UK3A 4WH8A 1AIXH 5EW1H 1XUKA 4IS5A 5A09A 2P8OB 3O8BA 1SGIB 1YPJH 2B8OH 4ZCNA 3ZZCA 1NU9A 1SQRA 1PQ8A 5E0GA 3LGUA 1O3LA 4ABAA 2YOLA 3V0XA 1TPOA 1C9PA 1CBWB 2NU3E 3PB1E 3JZ2B 4NWKA 2VWMA 3GY3A 4ISLA 2G4TA 4GLYA 5LH8A 5LPRA 2DE9A 3TLOA 3U8TH 5CHAC 1NFYA 3ATWA 4WH6A 3RC5A 1SHYA 3NUMA 1IQJA 1JWTA 1SQAA 1WOFA 2A1DB 1DUAA 2XBVA 5L6NH 1C5WB 2ZU4A 3TH2H 3I78A 2ALVA 1GJ6A 1G37A 3LGIA 4Q80A 1NO9H 2ZCLP 4GUXA 1T7CA 1KDQA 1FPCH 5FCRA 1O5FH 3GY4A 3I77A 3OTJE 2KFWA 5BPEA 1P2NA 3GYMA 1CBWC 3S7KB 3V3MA 3MNBA 1YGCH 3HGPA 4ZKRU 3E0NB 4H6TA 1YY3A 5DP4A 3PMJA 4CRBA 2Z3EA 1O3KA 4AFSA 3RXRA 2FI4E 3F2HA 4FUIA 4MVNA 1HBTH 1WAYB 3KGPA 1GGDB 1NRNH 1S85A 3PRDA 1V6DA 1P3EA 2ZHQH 1SFQB 1EUFA 1O5EH 2ZFFH 3M35A 2UUKB 5GJ4B 2Z3CA 1DWBH 1G32B 1TX7A 2R2WU 1O2HA 2IPQX 1OX1A 1NROH 2QAAA 3M36A 1O2TA 1GI7B 1TPAE 1QHRB 3PWBA 5ESTE 4BANB 3HK6B 4CR9A 3SJKA 3RXPA 2OC8A 1BTYA 2F43B 2QXHA 2W7UA 1YLNA 1LHEH 2WZQA 1FN6A 3GCHB 2A5AA 2AGGX 4AG2A 4UFFH 1ZJDA 1CA8B 5A0AE 1BT7A 1S82A 2WV4A 1C2MA 2ZTXA 2Y7XA 1AUTC 3RMMH 4D8NA 1EASA 1TQ0B 4MLFB 1Z8IB 4ISIH 1NS3A 2P93A 5L2YH 3EA8A 1GBBA 4ACBA 4THNH 4CH2B 3E3TA 2ZDKA 1GCTC 1P8VC 3RXCA 2EA3A 1WTGH 1S81A 4E7NA 4FUGA 5C20A 2BLVA 3RXJA 1A5GH 3ZZ9A 2J95A 4Q7ZA 2BLWA 1YPMH 1N6XA 3VXFH 1O34A 4MPUA 5TCCA 4ABJA 3KIDU 1YPKH 3U28C 3SU3A 5E0HA 3ESTA 3LU9B 1UVOA 1HXFH 2FOFA 2WV5A 4JYTA 3ZZ3A 2ILNA 1UMAH 3LDXH 4B74A 3BEFB 1J14A 4XBBA 4BAKB 1UCYK 3UQVA 2Z3DA 2VGCB 1QBOA 2Y82A 5FL7D 5E2OA 2ZDLA 1VCWA 4TY6A 1UTQA 1ELAA 4X1QU 4LXBH 1ETTH 1KXFA 7GCHG 4X6MA 5EXMA 1QL7A 2OUAA 2KR7A 4ISNA 4MNYA 2BQ7B 3A8AA 4X6NA 3RP2A 4AX9H 3MU4A 4MPWA 3VB4A 1ZZZA 3NK8A 4CRAA 2QF5A 1C5RA 5F8XA 2V3OH 3P6ZB 4I8GA 1IAUA 2Y6TA 2RDEA 1TOCB 5G4BA 5AFYH 1ESBA 3KL6A 3GCNA 1C1WH 1A3BH 4DIIH 4FUJA 2G55A 3KHVA 3TK6A 5TJXA 2HLDD 3H09A 1E38B 3Q3KA 4GCHG 5KECA 1PFXC 2BDHA 2VWLA 2FOCA 3BTQE 3LC5A 1KDQB 4UD9H 1W7GH 1G3EA 4YT7H 2TIOA 1CE5A 3MOCA 2QC2A 1OKXA 1DX5M 1ELFA 2QF0A 5L2ZH 1UVUH 2ZFSA 1PPCE 1EOJA 2I6SA 1C2IA 1HRTH 2P3TB 1E34B 2ZU3A 1DXPA 4Q63A 2L74A 1C4V2 2BD9A 3P8NA 4DG4A 3L3TA 1HUTH 2BLQA 1O31A 2VIDA 2BDYA 3GY5A 1L1JA 1P2KA 3KQ5A 3LGTA 3OSYA 4X2VA 3STIA 3ATLA 1NESE 3SBKA 4XD7D 1ZPCA 1UCYE 4FUFA 1F0TA 1FN8A 1SGQE 1QL8A 2PTNA 4TY7A 1P09A 2H1UA 2OTVA 3N99A 1C5TA 1UK2A 3SOSA 3SNAA 1Y5AT 2VVVA 1BB0B 2YMSD 4NG9H 2PV9B 4LZ1H 2YMSC 2ZDAH 3UR9A 1FY1A 1X7AC 2ZC9H 3SW2B 1GL0E 3A87A 2TBSA 3NWUA 3U1JB 4NSVA 3U9AH 4BOHA 2J94A 4WY3A 1CT2E 3OAAD 3TNSA 3BG8A 3F68H 4XBDA 1SGDE 3SNEA 2OC7A 3MYWA 4MDSA 2P59A 4KGAA 2P8OC 5IYTA 2Z9JA 1GBHA 4ZUHA 1ZPBA 1H9IE 2HPQH 1VKYA 2PTCE 3RXTA 5DG6A 1O5CB 4INKA 4MPVA 5DP7A 1E79D 3C1KA 1Y59T 4Q2KA 1ELTA 1VITF 2Z6BD 1AGJA 4Y8XA 3SV9A 1GHAF 3UTUH 1TYNA 3FN8A 4P02A 3BTGE 2AYWA 2WPIS 4ZXYH 3ITIA 3GY8A 1HLTH 3RLWH 4ZMAH 5B6OA 2ZZUH 3SI4H 5KEDA 3M3SA 3MTYA 1AFQC 1VZQH 2W3IA 3LGYA 1Z8GA 3KQDA 4ABGA 1MTNB 4UDWH 1W14U 2ZO3H 2ZFTA 2OC0A 5DN6D 4ASHA 1B7XB 3RXQA 3RU4D
chains in the Genus database with same CATH topology
1XX9A 2FLRH 2FP7B 1AE5A 3G01A 3UOPA 3Q76A 2GP9B 2XWBI 2LNCA 1XXFA 1L1NA 3BG4C 1GCTB 2R9PA 3RUOA 1AVXA 1SB1H 3KN2A 3O8CA 2M5TA 1DOJA 1M9UA 1P10A 1O3PB 2JH5D 1BHXF 1K1PA 1HIAA 1V2OT 1LDTT 1F0UA 2GDEH 3RM2H 1G3BA 1HJ9A 3ZVFA 4NIXA 1KY9A 2A5IA 2A32A 1FONA 2OBOA 1TMBH 2AGEX 4FVDA 2HVXA 5DGJA 1UTMA 1O3NA 1TGBA 2V35A 2BD7A 1YYY1 2OLGA 2BQ6B 4J2YB 2VJ1A 3MH6A 2Q1JA 3LC3A 3PYHA 2Z94A 1UVPA 1MTUA 1NRSH 1F2SE 3BN9A 4JYUH 3SO3A 1SQOA 1DVAH 2ZECA 5LGOA 1C5NH 4BAOB 5EODA 1GVKB 1QA0A 6GCHF 3N7OA 1SFIA 4RN6A 3P8GA 5DP5A 1A4WH 4AORA 3GDUA 2H5CA 1KLJH 4K1EA 1O3IA 4MG3A 1DWEH 3LJOA 2G52A 1TALA 2R3YA 1GMHF 2I6QA 1K1LA 4KTCA 1GHVH 2F91A 1RD3B 1A0JA 2VIPA 3DA9B 3SUDA 1ORFA 1DLEA 4DURA 3SGBE 3VB3A 2IJOB 3SU4A 5C1XA 1AU8A 1H8IH 2G51A 1ZSLA 2EI8A 1W13U 3NKKA 2SFAA 2XWAA 2V0BA 1AUJA 4OS1A 2AMPA 1C2HA 2BD4A 2J34A 3QTVH 1T8LA 4AFQA 1YBWA 4A7IB 3M5LA 4Z0KA 2FOBA 2FX4A 1HAXB 3A86A 2ZCKP 1L1GA 5DP9A 1FPHH 1P12E 3RXKA 3ATKA 2A7JA 3UOUA 3ZZ6A 3D62A 1F92A 1TRMA 1RTKA 2OINA 2R0LA 2GX4A 1QJ7B 1GBIA 4UFEH 1YP9A 1E0FD 2XXLA 1GJ5H 3OY6U 1GBKA 3BTTE 2P3FH 1O3EA 1V3XA 2PFEA 3S9AA 1C5MD 2KAIA 5F03A 3BIVH 1PYTD 1B0EA 1O2MA 1CU1A 1S83A 1LCYA 3TNTA 2ZKSA 3SGAE 1PYTC 1LO6A 3RLYH 1O35A 2FO9A 1MU6B 2XYAA 3VB5A 3A88A 2Y5GA 1IQLA 4B75A 1TNJA 1BTWA 1MKWK 2WPLS 5T6FA 4I8KA 4GSOA 3SGQE 4I8HA 1L4ZA 1VCQA 1NFUA 1KTSB 4BTIB 1YLCA 4A1TA 2EI6A 2R2MB 3SJIA 3P92A 3UWIA 1DY8A 3SV2H 1BMNH 3RXUA 2ZGHA 4HTCH 2YNAA 3M61U 3AASA 3SUGA 2BY7X 1GHBG 5L30H 4TPIZ 5SGAE 1RTFB 1D6RA 1OWJA 1T8OA 2ZWLH 1O3JA 8KME2 4GHQA 1AZ8A 4BAMB 1BJUA 2LPRA 1AKSA 2FOHA 4ZROA 3U8RH 4K2YA 3F1SB 3E91A 1DITH 4B1TA 1PQ7A 6CHAC 3KEEA 1HJAC 5FX5A 1DY9A 1LHGH 3AW1A 3R0FA 2D26C 4FUEA 4YLQH 2OP9A 3SU1A 1MQ6A 1ZSJA 3KQBA 2H9HA 1HIAB 2VIVA 1V2NT 5C3NA 3NPSA 1G30B 2F9UA 4D9RA 1IQEA 4ZHLU 1Q31A 4K1TA 1A5HA 5AVDA 1S0RA 3BTFE 2HNTF 2VIWA 3QZRA 1O2NA 1QQ4A 3FVFB 3GYLB 1LVOA 2G5VA 1BJVA 1TWXB 3QO6A 2PUXB 3F9GA 1ARBA 1C5VA 2SGFE 2BD2A 2AIPA 2O8UA 5FBIA 1NC6A 1V2UT 4YO9A 2C93B 4D7GA 1AVWA 4UONA 2O8TA 1GBAA 1IHTH 1NT1A 2A4RA 4NA9H 3TK9A 6LPRA 4WXVA 4D7FA 2CV3A 4DOQA 3GCTG 4ZXXH 1EQ9A 1GG6B 4Y0YE 1MMJN 3FP6E 5K7RA 1RTLA 4AG1A 4R8TB 2VINA 4NIWA 1IQHA 2RA3A 1PPZA 4ABDA 1AQ7A 2QCYA 3T5FH 3ZZ8A 4OS4A 3ZZDA 2HWLB 9LPRA 4K5ZA 1VGCC 2WPHS 5C5OA 3NCLA 3I29A 1D9IA 3UUZA 1KXEA 1VR1H 2Y81A 1EB1H 3BEUA 4YESB 2FLBH 2RA0A 3ZZ5A 1TNHA 4IC5A 3SZNA 1ZMNA 1HJAB 1GDNA 1DLKB 1P0SH 1GHXH 1MKWH 4ZHMU 1ZMJA 4WJG2 5AF9H 1LPGB 2PKSB 1TABE 1PJPA 1SHHB 4K8YA 3RXMA 1K1IA 1K1NA 1PQAA 1XM1A 3MH4A 1BTXA 3R3GB 2FOMB 1HAVA 1W7XH 4Y0ZE 1O2XA 3MU0A 3PLBA 1Z71A 3L33A 2SGDE 3ZZAA 2B9LA 2V3HH 3Q77A 2D1JA 1MUEB 4ABHA 1SLVB 1BCUH 4Y8YA 2BDCA 2FDAA 4X8UH 1TPSA 1WTHD 2TGDA 4INHA 1GL1A 3O8DA 1XVOA 1P2MA 1O2KA 1QRWA 3E1XB 1TRNA 1XXDA 1J16A 4OS6A 1UHBA 1P2JA 4X6OA 2ZFRH 5FX6A 4KELA 3SJOA 3GDSA 3E6PH 1OWDA 1TAWA 3GCOA 1GBTA 4LOYH 5FPSA 4IGDA 1ZR0A 2WYGA 1TONA 2AS9A 1GBCA 1K28D 4CR5A 1V2VT 4FU8A 6ESTA 1C1MA 2A5KA 2WPKS 1OXGA 1Y3VA 2ZU2A 2ODYB 1JIMA 1THPB 2PHBA 2QXJA 3ATIA 2AGIX 4ZKNU 1AO5A 2FODA 1CQQA 1FAXA 1GWAA 3FAOA 1CHOF 1RS0A 1DWCH 4UE7H 2EI7A 1MTWA 2HLCA 1ZTKA 3MH5A 4BNRA 5ESBA 1HYLA 2ZPSA 5FPTA 3BIUH 1ZLRA 1EZQA 4I31A 3BEIB 4DJZB 3U98H 3RXFA 1H8DH 1ZTLA 4CH8B 2BOKA 2QXGA 5E2PA 1GI5A 1LQDB 1GI3A 1P2OA 3T62A 3UY9A 2CF9H 4ZKSU 2ZGJA 2ZTZA 3A8CA 2D2DA 1GJAB 1BMAA 2Y7ZA 3QWCH 1THSH 4H42U 4JZIA 2SGEE 4DVAU 4U01A 1Z6JH 3KCGH 3UFAA 4Y6DA 1W0ZU 2TPIZ 2ZA5A 4O97A 2PKAB 3BSQA 1EAUA 2PLXA 3RMNH 1NFXA 1H4WA 1QY6A 1GBFA 1QB6A 5DK1A 1O2YA 2GTBA 4NA8A 1ANEA 1DWDH 3RU4T 2FWWA 1AE8H 3PLPA 1BTZA 1JIRA 2F9OA 2IOTA 1C1NA 3E16B 3SU5A 2BDIA 3UR6A 3HK3B 4Y8ZA 3Q3YA 2BQWB 2XC0A 3ZZBA 1Y3WA 1SGNE 4VGCB 1UK4A 5A8YA 1ZJKA 2ZPRA 2TGPZ 1UTLM 2ESTE 3ELAH 1MKXH 2B5TB 2PGBB 3LGWA 1EPTA 2GD4B 1QTFA 1DT2A 1ZPZA 1SMFE 2BDGA 5J4SA 1LVMA 3RM0H 1ACBE 4BTTB 1OOKB 3LKWA 2VGCC 1Y5BT 4Y10E 1HCGA 3U8OH 2AERH 1FIWA 1FUJA 1TGNA 1P06A 2CN0H 5HYOA 3UNSA 5EQSA 4TWYA 1S5SA 3T2NA 3ZV9A 1O2QA 1OSSA 1SOTA 1GMDG 2G8TA 1KXDA 3QGNB 1MQ5A 2STBE 2OQUA 4PROA 1WUNH 1SGRE 1AFEH 3BV9B 3KNXA 3TJVA 4ABFA 3GCTF 5A0BA 1FMGA 5LPEA 2Z9KA 4GVUA 1OYQA 3A89A 1TMTH 1A0HB 3K2UA 3SHAH 3H7OA 1KYNA 2BLOA 3H5CB 1DPOA 1GJ7B 3E8LA 4SGBE 1ARCA 1E35B 2FOGA 4X2YA 1C1SA 2J92A 4WMDA 4U30A 3H7TA 1CO7E 3WY8A 3C27B 1JXPA 2FOAA 1OPHB 2Y80A 3FP8E 4GAWA 2UWPA 4UFDH 1G9IE 5GPIB 4CRGA 1YKTA 1CGJE 4YOJA 1BDAA 2PSYA 4JMYA 1W8BH 3ZVAA 1GI8B 3OYPA 5J4QA 2Z7FE 3QTOH 4X1PU 1AMHA 3PMHB 2ZGBH 1EAIA 3MNSA 1QA7A 1TNKA 1D6WA 3EYDA 1PQ5A 2FMJA 3SNBA 1V2TT 1FDPA 4KP0A 3E90B 1C5UA 1BQYA 1O2WA 5AFZH 3SQEE 2JH6D 2R0KA 1C5SA 1V2JT 2ULLA 1WBGB 4E05H 4WMFA 1SLXB 1QBVH 2GMTC 2ZGCA 1S6HA 1O3OA 1O2SA 1HXEH 2BY8X 2VU8E 2ZP0H 5A2MH 3Q3XA 2GKVE 2AEIH 1C4U2 1GJ8B 5JBAS 4CHAB 5DP3A 1O39A 1N8OB 3RMOH 1ANBA 3EAJA 1W12U 2PKAA 1TNIA 1DICA 5A8ZA 3QX5H 1QRZA 1UO6A 1WU1A 4JZEH 4SGAE 2THFB 1KLIH 1CT4E 2UWOA 1P11E 1K2I1 2QYIA 1CHGA 1ZYOA 1HNEE 1XVMA 4JZDH 3EQ0H 2SGQE 1XUFA 3GCHC 3NZIA 1BOQA 2FM2A 1YPGH 1AY6H 1EJMA 1NRRH 3BF6H 1RRKA 1UTKA 3OX7U 3JZ1B 3LIWA 2SGPE 4NSYA 1QB1A 1IQGA 3PMAB 1LKAA 3MFJA 3P17H 4YOGA 1G2LA 2P3UB 5FBEA 4CRCA 4NIYA 1TIOA 1BRAA 1GMHG 2BDAA 3E0PB 2ZEBA 3K6YA 2HRVA 1VITH 1SGFG 1A3EH 5EQRA 2VH0A 4AGKA 2J2UA 1SSXA 1SI5H 1QBNA 4UFGH 4CRFA 4X1NU 2BYAX 1PPEE 4X1RU 4A92A 1EP5A 1CGIE 4BTUB 3MI4A 7GCHF 3UIRA 1RFNA 3F6UH 3SU2A 1U6QA 3CP7A 1GJDB 5T6GA 1BMMH 3TGIE 5EPNA 5HM2A 3SV7A 3SNCA 1E37B 4I33A 2ZQ1A 1H1BA 4YOIA 5GXPA 4B71A 4I7YH 2H9TH 4Q7YA 1XMNB 2FI5E 3PTBA 2ANKH 4XOJA 1CA0B 1JRSA 1TBZH 4B2AA 1MCTA 1Z7KA 1QR3E 5EOKA 2NU2E 1WQSA 2XC4A 5F8TA 1Y3YA 5LPFA 4XE4A 3LGVA 1W10U 1NU7B 4X0WU 1OP0A 1QJ6B 2KAIB 1W11U 1O3FA 2F3CE 2C8YB 2Q6FA 2ZFPH 1DFPA 5GIBA 2O8LA 1SC8U 2OBQA 1C2EA 1GI4A 1SLWB 2HPPH 2CMYA 3A82A 3ZVCA 3ZVGA 5CE1A 4VGCC 1BTUA 1P05A 3MO3A 1FXYA 1AHTH 1T32A 1L0ZA 1HAIH 4K3JA 1GHAG 1T4UH 5JPMH 2BD5A 2H6MA 1MCVA 5EG4A 2ZF0H 4U32A 7ESTE 4D76A 3MHWU 8GCHF 5JBCS 3ODDA 1INCA 3ZV8A 2DUCA 3QZQA 2B0FA 1H9HE 3RMLH 3A8BA 3PO1B 4KTUA 1TOMH 1IHSH 2PKSC 2SGAA 4K60A 4X8SH 1TGTA 1YF4A 4WVPE 2OXSA 3URCA 1C5LH 1QURH 4B2BA 3QUMP 1D3PB 1BTPA 3OY5U 1KXCA 1GJCB 1QIXB 1VJ9U 4JK5A 8ESTE 1T8MA 3DUXH 3ZVDA 3HKIB 3F9HA 3B9FH 1C1PA 1GPZA 4X2WA 2ZCHP 3T29A 1C5ZB 1ZHMA 1C2GA 3TJUA 2AFQB 4E7RG 1T8NA 4NWLA 1AI8H 1YPLH 3PLKA 2Z9GA 1C5QA 2GZ9A 3FFGA 3MO6A 3EDXB 1RIWC 2FS9A 1F5KU 4XFQA 5FPYA 1TX8A 4M7GA 4XDEA 1HAYB 1MAXA 1FIZA 5CHAB 3M3VA 3EGKH 2D8WA 3A81A 1GHZA 4Y7AA 1NRPH 1MZDA 1IQFA 4OS7A 1FJSA 2G81E 1BBRK 1AWHB 2PR3A 1Z1JA 1ETRH 3BTME 4XBCA 1BA8B 4XSKU 1GDUA 3SQHE 2J4IA 5GCHG 1SGCA 1Y5UT 3M7UA 3SHCH 1TQ7B 3MWIU 1NY22 4YTAA 3UNQA 2BZ6H 1KXAA 1OWKA 1WSSH 4GHTA 3ZZ4A 1O0DH 1HAHH 2BMGB 2ZGXH 1KIGH 3UWJH 5T3HA 4Y11E 4NFEA 5A0CA 3S0NA 4FUDA 1Z6EA 2IN2A 4AFZA 2QN5T 5GCHF 1Y8TA 4A6LA 1V2LT 2BD3A 3NXPA 1TA6A 1N6YA 4YZUA 1YC0A 1K9OE 2G5NA 3F9FA 3A7WA 5FAHA 2ANWA 2ZTYA 1C2JA 3U69H 2O8MA 3RDZA 1Y3XA 2A2XH 1FY8E 3TH4H 1MD7A 3DD2H 4H4FA 1HDTH 2C8WB 1LMWB 5FCKA 1CVWH 1WV7H 1B0FA 1W3CA 1O3BA 1MTNC 3M5OA 3RC4A 1P04A 1LHDH 3UNRA 1O2LA 1G2MA 3K6ZA 3TGKE 3P8OA 2VNTA 2ZDVH 1G3DA 1P2IA 1VJAU 2BTCE 1BZXE 2GCHF 2GCTC 5DPAA 5A8XA 1O2UA 3T25A 2ANYA 1P3CA 2BXUH 2GGVB 1AWFH 1S0QA 4JZ1A 2HNTC 3MNXA 2PW8H 3BTKE 1XUIA 3QGJA 1TB6H 3LJJA 3KQCA 3T26A 4ABEA 5ABWA 3DHKH 3V7TA 2F83A 1HGTH 2WPMS 1Q3XA 1VITG 1GMCF 4A1VA 1O2IA 1SGEE 2BHGA 1ZSKA 1UHBB 2CXVA 4ABBA 2UUFB 3SN8A 1GI9B 4NCYA 1BHXB 1LHCH 1MTVA 2BZAA 1D3TB 1FAKH 1JBUH 4NGAH 1IQKA 1V2RT 1QFKH 2ZPQA 1GBLA 1OWEA 2A4GA 4CRDA 2P94A 2ZFQH 1O3HA 2K1QA 5JBTA 1AZZA 2G4UA 1SG8B 3MU1A 1C4Y2 1OP2A 3BTHE 1W0YH 2W3KA 2VVUA 3S69A 4DY7B 4R0IA 5JBBS 2IPHA 1AVGH 1ZOMA 2HOBA 3L6PA 3TITA 4HZHA 2XW9A 3AW0A 4YM9A 2BVSH 3VXEH 1O5DH 1TNLA 3PMBB 1Q2WA 2ZG0H 4JCNA 2C3SA 1C1RA 2P16A 4GPGA 3CS0A 2F9NA 1GBMA 1EJAA 1TE0A 1P01A 3VEQB 1BMLA 3ENSB 1EAXA 1JOUB 4B73A 1A7SA 4F49A 5E8EH 3VGCC 2J38A 3SV6A 1TGCA 1NZQH 1GMCG