2GZ7A

Structure-based drug design and structural biology study of novel nonpeptide inhibitors of sars-cov main protease
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title Structure-Based Drug Design and Structural Biology Study of Novel Nonpeptide Inhibitors of Severe Acute Respiratory Syndrome Coronavirus Main Protease
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 84
structure length 306
sequence length 306
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2gz7A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gz7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gz7A02
4FUDA 3SV2H 2YNBA 1HLTH 4D8NA 3SJKA 1CGHA 2FI4E 1G2LA 1H1BA 1V2UT 3KQEA 1BMAA 1KLJH 4TPYA 2A2QH 3TVJB 2J92A 1T4VH 1F0RA 2THFB 2XCNA 3RLYH 2HNTE 3RXHA 1K1OA 2GDDA 1L0ZA 3MNBA 3TJUA 4IW4E 1SLXB 4MNWA 1O5FH 3UY9A 1YBWA 2ZHQH 2BYAX 2CF8H 6CHAC 2W7SA 1V3XA 1O2ZA 2TPIZ 5K0HA 1V2TT 4CHAB 5A0BA 3PTBA 2GDEH 1P02A 1TBZH 2BVSH 3MHWU 4GAWA 5SGAE 4ABEA 3LONA 1H4WA 3D62A 2UUKB 1G32B 1LKAA 1Z1JA 1EPTB 1GBBA 1RTKA 1AZZA 3QGJA 2ZU2A 2BY5X 1QL9A 4ZUHA 3L3TA 4F4OC 5JBBS 2Y82A 1OKXA 1XM1A 1K2I1 2NU1E 1SPJA 3D23A 1SLVB 1C4V2 3A86A 4AOQA 2A4QA 3M36A 1UTPA 4X2YA 1LPZB 3V12A 4WXVA 1EB2A 3UWIA 4X1NU 5JB8S 1NN6A 2AEIH 4MLFB 2HPPH 2ANWA 3FZDA 4E7NA 1AWFH 1HAZB 1SLUB 1UCYE 1CQQA 2BD2A 3M5MA 3GCOA 5EXLA 2PSYA 1GL0E 1VITG 1AVWA 4MNXA 1PPZA 3U69H 4D9QA 1HIAB 1C1SA 3RXLA 3U98H 3U8TH 1NFXA 2BVXH 5HXFA 1SGRE 2Z9JA 4DCDA 5JDUB 2OD3B 3E8LA 2GGVB 2GMTC 5E0HA 1ABJH 1ZJDA 1GGDB 1C1RA 2UWOA 5FPSA 1S82A 2ZIQH 1PYTC 3FFGA 1NC6A 2OLGA 1K1IA 1J9CH 2I6QA 1J14A 4WH6A 5E0GA 1EZXC 3MU1A 1ANDA 1ANCA 2VGCC 2OTVA 4X0WU 1IAUA 3SV6A 1HAYB 4ZAEA 3SNCA 1HDTH 3GCTF 5LPRA 1BRUP 4MNVA 2PR3A 2FLBH 4FU7A 1C2GA 3S7KB 3FVFB 5PTPA 1GJ9B 3P92A 5E2PA 1GJ7B 5FBIA 5DP7A 1ELGA 1V2RT 2WPIS 2Y7ZA 2GVFA 2F3CE 2VIQA 1YCPH 4K8BA 1GDNA 1TGCA 4XBDA 1NESE 1H8IH 4AYYB 1L1JA 1PQ7A 3BEFB 4B75A 1BRBE 5DPAA 2AMPA 1MCTA 1IOEA 2A31A 3LU9B 1K1PA 1PPCE 3EYDA 2ZECA 5EG4A 5F8XA 1AFQB 1D3TB 1FY8E 1UHBB 3UNSA 4CRGA 1VJ9U 1IQLA 2QF0A 1AKSB 5C1XA 1FN8A 5H4IB 1ZSKA 2ZTYA 1O3GA 3E16B 5JBCS 1G36A 1UVSH 1IQEA 3A85A 3MU0A 5T6DA 1P8VC 1QTFA 5EW2H 2PLXA 2FOBA 3ODDA 3VB7A 2BDAA 4IBLH 3TNTA 1KLTA 1TLDA 1ZMJA 4B76A 3LH3A 1AE8H 3HPTB 1MTNC 4WY3A 3LJJA 4DOQA 2PKAA 3VGCB 3LGWA 3MU8A 1BJUA 1RRKA 1EAIA 3TJNA 1GBJA 3BTDE 1V6DA 3BTEE 1OP0A 1P10A 1ZMLA 4NWLA 5GXPA 4HZHA 4H4FA 1NRSH 3RU4T 1C2KA 1CU1A 4CR9A 3VB3A 1CA0C 1NU7B 1YM0A 2WUBA 4ZROA 1AB9C 1Z8RA 1TE0A 3RXVA 2HALA 2VH0A 2FYRA 1VJAU 4INHA 2BHGA 4O3UA 1D6WA 2R2WU 3PYHA 1O39A 4Y76A 1ZYOA 1EB1H 2FOCA 2UUJB 1JBUH 3ZVDA 4NFFA 1LHCH 1A5GH 4AFUA 3S9BA 3RXCA 1IQKA 1O5BB 3KNXA 1TGSZ 3BIUH 4IS5A 1KSNA 3S7HB 2BDGA 1FI8A 2V35A 5A8ZA 2GCTB 2ZEBA 2C8YB 2C8ZB 1G3DA 2VWNA 1O3AA 1BJVA 1O3MA 2D2DA 1K28D 1TGBA 2J95A 2WPMS 1P2NA 5LGOA 2EEKA 4WMEA 3A82A 3SU3A 1ZOMA 4JYVH 3A84A 3TIUA 1D3QB 3TGJE 2ZFTA 3JZ1B 4FUHA 1D9IA 4K1EA 3MMGA 5EPNA 4JZ1A 1EJNA 1GBLA 4ZXYH 2XC4A 1BBRH 9ESTA 1VR1H 1BUIA 1ELVA 3KQDA 1HYLA 1SGEE 1C2FA 1DANH 1T8NA 1EAUA 4UFEH 5DO4H 2J94A 4A1TA 1C1MA 4NIVA 8GCHG 1DOJA 1O2KA 9LPRA 1NROH 1FAKH 4WMFA 3FP7E 1GJBB 1S83A 2Y5HA 2FTMA 2KAIA 1PJPA 3NKKA 1THPB 3IWMA 2H9TH 2ZGJA 1P04A 3RXOA 2HNTF 3Q77A 2JETC 4BAMB 1ZSLA 3EA8A 1QJ7B 2FTLE 3ZVAA 1TRMA 1NPMA 2BD4A 4TPIZ 3A80A 1CE5A 1EOJA 5IDKA 4Y10E 1DICA 4IN2A 4DJZB 1JIMA 1HJ9A 1C5ZB 1ETTH 2FPZA 1UVOA 3K9XB 2SGFE 1CT2E 2B9LA 1A4WH 3LGUA 4NSVA 3A89A 3VB4A 1BITA 1MKWH 2B0FA 4Y0ZE 3BG4B 2ZCHP 3PMAB 1W10U 1QBOA 2Q6DA 3SOSA 3RXFA 2FIRH 4AG1A 3Q3KA 1DLKB 1FMGA 4KTSA 4NZQA 3RXBA 4ZHMU 4CHAC 4HTCH 5CHAB 3V0XA 5LPFA 1ZR0A 1KXDA 3BTKE 5L30H 2VNTA 3QTVH 2A1DB 1TIOA 2FP7B 1QJ1B 2BY6X 2P3UB 1GDQA 1NO9H 2A4GA 4I33A 4ABGA 1T8OA 1EPTC 3RXIA 1ZRBA 2SGQE 2G81E 3GY3A 3VXFH 5EW1H 2Z3CA 1K1MA 4NIYA 2Z9KA 1ANBA 1KXFA 2VIWA 4AFSA 1AMHA 4GHTA 1O30A 3MO9A 1GPZA 1QBNA 3BN9A 3RXSA 2Z94A 3H7OA 3QWCH 3HKJB 4LZ4B 3E3TA 4XBBA 1W11U 2RA3A 1M9UA 2FO9A 2ZU1A 4A5TS 1C5XB 1KY9A 3IG6B 2Z9GA 1GBKA 2A4OA 1FZZA 1NT1A 3MFJA 2NU3E 1BHXF 4BTUB 1INCA 1RS0A 2XBWA 4ZKSU 1P9SA 1B5GH 3EE0B 4JK6A 1C9TA 1D6RA 1GMHG 1P2QA 4K1SA 5FAHA 3L33A 5F6MA 1BQYA 3GY2A 4MG3A 1QNJA 2A45B 1O2OA 1VITH 2BB4A 1K21H 2PKAB 2XNIA 2ZU4A 1BTHH 1C4Y2 1GGDC 1J15A 3QN7A 3ZZ6A 1TX7A 1DWBH 4BXSA 2WPHS 1P57B 4NG9H 1C1WH 1HAHH 4CH2B 4O97A 3P6ZB 3RXGA 4AG2A 4ISOA 1GMCG 2OBOA 3BV9B 2RA0A 2QV1A 1V2VT 4DIIH 1P12E 3EAJA 2B5TB 1E35B 2BZAA 2FX6A 3W95A 4YTAA 1CGJE 1C9PA 1O2HA 2C90B 4FUCA 2R3UA 4IN1A 4ABJA 3QUMP 2K7XA 2BLQA 2FEQH 5JYIA 3TH2H 1EXFA 2G5NA 3SNBA 1L4ZA 2XBVA 2ULLA 4OS7A 3EA9A 3P95A 1EASA 1NFYA 3MO6A 1N6YA 4TWWA 1GHBF 2FM2A 4CR5A 5JBTA 2AERH 2OUAA 1EZUC 1V2PT 2VIVA 3Q3XA 4X2WA 1C5QA 4M7GA 2AS9A 3D65E 3MWIU 1AFQC 3RXUA 3LDXH 1HCGA 4JK5A 3ITIA 1MTWA 1UTNA 1P3EA 2WINI 3NPSA 4UEHH 1A61H 1TQ7B 3TH4H 1ZRKA 2BDCA 5F03A 1O2PA 1V2MT 3M3SA 4PROA 1A1RA 1EAXA 1HAVA 4WJG2 1GVZA 3SV9A 1O2TA 1S0QA 2ZGHA 5ESBA 3ZYDA 3C1KA 3P8FA 6LPRA 2CJIA 2ZCLP 2FI5E 3U1IB 2ZHEH 1QHRB 3VGCC 3SNAA 2F9PA 4Q7YA 1F5RA 7KMEH 2KAIB 1G3EA 1LPKB 3STIA 2C8WB 1KXEA 1FQ3A 3EGKH 2XYAA 1GI2A 1W7XH 2H9HA 1P3CA 2ZTXA 4FU9A 1JOUB 1QB1A 1FIWA 1WCZA 4LOYH 3A7XA 1C5YB 3AW1A 2PWXA 2ZU5A 1P11E 3SW2B 2PV9B 3A8CA 1YPJH 3V13A 1S85A 1Z8IB 1OWEA 5T6GA 4NSYA 5HYOA 1V2JT 1W8BH 2G51A 1PFXC 2VVUA 3RXRA 4F49A 4RKJB 2FYQA 2QXHA 1SGDE 3PLPA 3MH6A 2GCTC 1LCYA 1GJ8B 1OPHB 2P59A 5BPEA 4OGYA 2FOHA 3QTOH 3F9GA 1QA7A 2Y5FA 4B2AA 3O8RA 2BY9X 4FXGH 3UNRA 1LVBA 3LKWA 1PPHE 3M7QA 4JZEH 3SHCH 1QBVH 2QY0B 1IQIA 1GI5A 2BXUH 3LC3A 1O33A 1OS8A 1VCWA 1W13U 1YGCH 3SJOA 1V2WT 1MBQA 3BIVH 2WPJS 3DD2H 1LKBA 4J1YA 5T6FA 1C1UH 4AYVB 1F0SA 4NWKA 3VPKA 1FUJA 1MU8B 3G01A 3T62A 1NRQH 1O36A 3TK5A 3V7TA 1BZXE 1O2UA 2OXSA 2AGEX 3GISB 3RU4E 4AGJA 5G4BA 3RC4A 3H5CB 1MH0A 4XSKU 1ELCA 2OC7A 1MAXA 1HAXB 1Y8TA 1GHVH 3PMBB 5GDSH 4BAHB 2GD4B 3KF2A 2A2XH 4JZFH 8KME2 2BY8X 3LGYA 2ZPQA 1GMCF 4I8KA 2XWBI 2BXTH 5B6OA 1X7AC 1N8OB 2PUXB 1FJSA 3UNQA 1C2IA 3UQOA 3SUEA 1GHYH 1FPCH 1TAWA 1S0RA 4FUIA 1ZSJA 1EUFA 7LPRA 2OQ5A 4BAKB 4A7IB 2H6MA 3RXPA 2TBSA 2QC2A 2ZFSA 1LTOA 3SV7A 4MPXA 2ZGXH 1DX5M 3DUXH 3SORA 2ZDMA 2ZFPH 1GG6B 3ZZDA 1G3CA 1QIXB 2WV4A 4H42U 1V2NT 1HGTH 1YCPM 2TGTA 1RJXB 3BG4C 1FIZA 2JKHA 2A7HA 1RTLA 1J8AA 1CSOE 4FU8A 1C5OH 3NXPA 1FAXA 1MQ6A 3PROA 2DUCA 2OC8A 4CREA 3MH5A 2XWAA 1C5RA 4X1QU 1TONA 2JH0D 1Z71A 1Y3UA 4AZ2B 2ZZUH 5CHAC 3UTUH 1BB0B 1FY3A 4WMDA 3ZZ5A 1AU8A 1YPHC 1C1QA 1DXPA 2AMDA 3M5LA 2ZPRA 1W7GH 1UTQA 1MCVA 1DUAA 4LXBH 3MO3A 1ZHPA 2HLCA 2ZDVH 3ZVGA 3NK8A 1DPOA 4OS1A 1SR5C 3Q3YA 3GDSA 4XOJA 3DHKH 2C93B 1YCPK 1C5NH 3ZZBA 4WWYA 1SVPA 4AFQA 1KDQB 1TB6H 2XBXA 4GSOA 1C2EA 1O35A 4CH8B 1GBIA 1HAPH 2VIOA 1BMNH 1TNLA 2W5EA 3RXJA 1AWHB 2NWNA 2W7UA 4TWYA 5A2MH 1BHXB 1HAVB 1FLEE 1RTFB 2ANKH 3SUGA 3ZVBA 4CRBA 1LQEA 1SHHB 2PTNA 1HUTH 2UUYA 1PYTD 1Q3XA 1Y59T 1H9LB 1GCTB 1XUJA 2FESH 2BD8A 4Q7ZA 4YO9A 4SGAE 4Y79A 4CBNA 3P8GA 1OOKB 2ZC9H 1AIXH 5EGMA 1SC8U 4YESB 2VWLA 1YP9A 4D76A 5TCCA 3TGKE 1O3BA 1DT2A 1IQGA 2QF3A 5LPEA 1VZQH 1BMMH 1D4PB 3NCLA 2QGRA 4NA7A 3NZIA 4XE4A 1UTOA 1XUFA 2Z9LA 1SGFG 3FZZA 1C2JA 2CV3A 4Y0YE 1DDJA 1JXPA 3ESTA 2WPKS 2O8TA 3RMMH 3UQVA 4I8GA 2PKSB 2ZGBH 1UO6A 1IHTH 4YOJA 1KXAA 2XC5A 4IMQA 3MTYA 1ELEE 1OSSA 1LDTT 2GZ9A 3SNDA 2UWPA 5I46H 1NZQH 1F0UA 2Y7XA 2D1JA 4I8HA 1G2MA 4HFPB 1B7XB 3KGPA 2K1QA 3AASA 4A1XA 4ASHA 4YLUA 3HATH 3RMNH 3QZQA 4O03A 1O2WA 4KKDA 1UJ1A 1LPGB 2F9UA 1C5UA 3TJOA 5A8YA 1IQMA 1UK4A 1TRNA 2ZKSA 4Q2KA 2ANMH 4MPWA 2BTCE 5EU8A 4DIHH 1ELTA 1AFEH 2GKVE 3ATMA 3RLWH 2XRCA 3RXAA 4X6OA 3FP8E 2ZQ1A 1LHDH 1T31A 1WTHD 1HPGA 1WBGB 1DSUA 1G30B 1BBRK 4X1PU 1F0TA 3BEUA 1XUHA 1GJ5H 2ZHFH 1EAWA 3UIRA 1OP2A 3A7WA 1GBTA 1YPLH 1D3PB 4NZLA 1DY9A 1BDAA 2XC0A 2AMQA 2ESTE 5JB9S 1A0HB 1ETSH 1H8DH 1S84A 1SSXA 4IGDA 2B8OH 2SGPE 3LH1A 4AB9A 1W3CA 1AO5A 2ZG0H 3B9FH 1ETRH 1GBMA 3UOPA 1BCUH 2EI6A 3SQEE 4ABBA 1KIGH 3KQBA 1LHFH 2WYJA 3HGNA 2QIQA 2F9NA 1XX9A 1C2MA 4NFEA 2BLOA 3WY8A 1QRWA 4UONA 1FPHH 1SQAA 3HK6B 3AAUA 2FXRA 3PLKA 1L1GA 3D49H 2ZHWH 1MKWK 4AFZA 4BOHA 5A0CA 4E05H 1E38B 4MDSA 1K9OE 2SGDE 5LH8A 1V2ST 4YT7H 3TNSA 2Z6BD 2QA9E 2H1UA 1FV9A 1XUKA 2PTCE 1GHBG 2A7JA 4BNRA 1NY22 2J4IA 3LT3A 2EI7A 5J4SA 2GT8A 1DUEA 1YF4A 3MOCA 3SJ8A 1P09A 4ZXXH 1TNHA 2F91A 5DP3A 1EKBB 4J2YB 1TX6A 2O8UA 4MQAA 1W0YH 2BOKA 2ASUB 3RU4D 3GY4A 4MTBA 1E36B 1QURH 1SQTA 3LOXA 4WH8A 1K1NA 4CRFA 1RXPA 1MTVA 5C1UA 1ZPBA 1MKXK 3CS7A 5I25A 3VEQB 1A5HA 4Y6DA 2WYGA 1TMTH 2WV5A 2G4TA 2BD9A 4NCYA 3URCA 3ZZ3A 3T2NA 2O9QA 3T27A 1OWJA 1N8OC 1TWXB 4MNYA 4ABHA 1C1TA 1V2QT 2CF9H 4O3TA 2Z3DA 3BTFE 4HI3A 1TPAE 2D8WA 2P93A 5DKMA 1HAIH 4RN6A 3EA7A 1ZGIA 2SNWA 1QQUA 3K6ZA 2PUQH 1OYTH 4CRAA 1O5AB 1TOCB 1QRXA 3GICB 1PPGE 2GT7A 5E0JA 3E6PH 2O8LA 3SZNA 1GG6C 2EC9H 1FONA 5FXLA 3KHVA 3RUOA 1ANEA 2ZU3A 1O2GH 1ZTJA 2FDAA 3LGIA 4R0IA 2OBQA 5C5NA 2OCVB 2A0QB 2NU2E 3GY7A 5E2OA 1SOTA 1MD8A 1V2KT 4UD9H 3HKIB 1YPHE 4BTIB 4FUEA 1MKXH 1OWKA 1E0FD 1BRCE 1EZSC 3ATWA 2HPQH 5FX5A 2BY7X 1AQ7A 3AVZA 3LIWA 1P06A 3BTQE 3PLBA 4VGCB 2VWOA 1DITH 1ARCA 1TMUH 1EX3A 3VFEA 4GUXA 1BIOA 2QAAA 2HOBA 1PPBH 2VVVA 3SU0A 7ESTE 1GI7B 1TQ0B 2WUCA 3F6UH 2SNVA 4X8SH 4K5ZA 5EPYA 1Z1IA 5FBEA 2ZPSA 1RGQA 2AFQB 3QO6A 1ZPCA 1O3OA 1W2KH 3GY6A 1P05A 2VJ1A 1NU9A 5GCHG 1S6FA 1WTGH 3U9AH 4BTTB 2R9PA 1QQ4A 1XUGA 3GDUA 3SU2A 1ZPZA 3N7OA 3C27B 2FLRH 2O8WA 1KXCA 1O2RA 1LHEH 1ZTKA 3ZVFA 2IPHA 4MPVA 3UREA 1BRAA 1WV7H 2ZF0H 3UOUA 1CBWB 1IQHA 1GI8B 1UTMA 3BEIB 4CRDA 4GHQA 3GCHB 3S9AA 5A0AE 2P3FH 1SGFA 3OU0A 1SFQB 1TYNA 1XKBC 2VH6A 5FCKA 1O0DH 1GJCB 3A7YA 3STJA 2P94A 3GYLB 1NFWA 2TRMA 1O38A 1BT7A 4KTUA 1GCTC 3ODFA 1LVYA 3T28A 3VB6A 4ISIH 3A87A 4X6MA 4AN7A 2O8MA 3L6PA 1LO6A 4ZKRU 2ZFQH 4Y71A 5DK1A 1ORFA 3E91A 1O3FA 2BD3A 4ZKOU 2FX4A 4YM9A 4X8UH 3A7ZA 1BBRE 1TGTA 3ATIA 2SGAA 2R0LA 3SI4H 1Y3YA 1UCYK 1QJ6B 5L6NH 2V3OH 1O2JA 4ISNA 1DY8A 1ELFA 4I32A 4K1TA 3B23B 5L2YH 2M5TA 4K8YA 2PKSC 3O8CA 1C4U2 2A5AA 4FVDA 2JH6D 3MU5A 5AVDA 1O3PB 1ZLRA 3ENSB 1SHYA 4OS5A 6GCHF 1P2MA 3RXEA 1DXWA 1DWCH 1ESTA 1O2SA 1ESAA 1VGCB 4U2WA 2OC1A 3SN8A 1O2NA 1C5WB 4JMYA 5C67A 1Q31A 1V2LT 2GZ7A 1EP6A 3F1SB 1C2HA 1MD7A 8LPRA 1SB1H 1WYKA 3PMHB 1C5SA 2Y6TA 1DM4B 2VVCA 1SLWB 3EDXB 1VCQA 2F9VA 4Z0KA 1CHOG 3PTNA 1GI9B 3KN2A 2FS9A 2EI8A 2ZGCA 5HM2A 1KTSB 5HM9A 1YPGH 1SGTA 1TRYA 3I29A 3EBNA 3ZYEA 1UCYH 2Z7FE 4TYDA 4K3JA 1OWHA 4DT7B 4YT6H 3SGBE 3S0NA 1LVOA 3U1JB 1YPMH 1GBFA 2OC0A 3M61U 1F92A 1P01A 3OYPA 1Z7KA 1GVLA 5DP4A 3OY6U 1GJDB 3CENA 1G9IE 3SGAE 4WVPE 1DSTA 4THNH 1NRRH 4ABIA 5IYTA 2BDYA 1UTJA 1GJ6A 4YOGA 3FANA 2RCEA 4FUBA 1P9UA 1ARBA 3M5NA 4Y7AA 1T32A 3GOVB 1TPPA 4B71A 2GX4A 3SGQE 1ABIH 5GWZA 1QCPA 3ZV8A 2I6SA 3JZ2B 1SGCA 2BQ7B 2PGQB 2R0KA 3PO1B 1MBMA 1V2OT 5CE1A 3DA9B 2ODYB 2ZHDA 2UUFB 5F8TA 4DG4A 4GCHF 1F5LA 1CVWH 1IQFA 3K2UA 1ZGVA 1TNJA 1TA6A 1Y5BT 3RC6A 2G5VA 5C1YA 1KYNA 1UK2A 1F5KU 3LPRA 3RC5A 1HB0B 4X1RU 5GCHF 3KL6A 3FP6E 1WU1A 3SV8A 1CT4E 2OINA 1QR3E 1A0JA 3PWCA 2VWMA 4ZH8A 2V0BA 1C1OA 2AH4X 3SJIA 2BX4A 1OXGA 1PPEE 6ESTA 2CXVA 4WF8A 1C5PA 4SGBE 1BTYA 1KLIH 1GBCA 3ZZ4A 3SBKA 4DURA 1SBWA 3H7TA 2H2ZA 3PWBA 1QB9A 4Y7BA 4U30A 4R8TB 2ZP0H 2BZ6H 1TBQH 3ZVCA 3OTJE 4CRCA 4AORA 5HGGA 1K1JA 2QN5T 5FPTA 2SFAA 3P17H 3RXKA 1GI3A 3HK3B 1OWIA 1A7SA 5ETXA 2TIOA 1O37A 1TOMH 4GVUA 1YLDA 2J2UA 4I8JA 1TX8A 1QL8A 1VCPA 3Q00A 4A92A 1YPKH 2ZDNA 1QFKH 1WQVH 5DP9A 3MU4A 2R3YA 5CMXH 4NA9H 4BAQB 2V6NA 4IC6A 2Z9IA 1FXYA 1GI1A 1AN1E 1XXDA 2GV6A 1SMFE 4H6SB 1O5DH 2GCHF 5AHGH 2VIPA 2XXLA 4AGKA 2CGAA 2RDLA 1KTTB 4Y8ZA 1DS2E 5C20A 3QDZB 3I77A 3KIDU 2AYWA 2Z3EA 1GCDA 2RG3A 4INLA 2UWLA 5DP8A 3M7UA 1J17T 1MTUA 3P8NA 1XXFA 2EA3A 3UR6A 4DW2U 2VINA 2F9BH 4UFDH 3U8RH 1OP8A 1CHOF 1XKAC 2JH5D 1AZ8A 2A7CA 3U8OH 1GBEA 4ESTE 1SGNE 4HGCA 4OS2A 1O2LA 2DE8A 1TABE 1EQ9A 1JRTA 1NRNH 2AIQA 4B2BA 3I78A 3KEEA 1E37B 4VGCC 4Y8YA 3TPIZ 2P95A 1C1PA 3GYMA 1RFNA 1OWDA 1H9IE 2FWWA 1IHSH 3QX5H 1YLCA 2BMGB 1AVXA 4K60A 4JCNA 1L2EA 2OQUA 1O3NA 2IOTA 5EXMA 1B0EA 3MNSA 5E8EH 2BLWA 1U6QA 3QLPH 1NRPH 1BOQA 1Z8JB 1C5VA 3MH4A 3RXTA 2ZTZA 1QA0A 2AGGX 2TGDA 1FY1A 4BAOB 1FY4A 1C5MD 4KTCA 2CHAB 3A8DA 4X2VA 2ZO3H 2GV7A 7GCHG 3DFLA 1D3DB 1CBWC 2QXJA 5GIBA 3GCHC 4IMZA 3FAOA 1G3BA 3MNCA 1O3JA 1BMLA 2BD5A 2J9NA 2ZWLH 1NM6A 1TNGA 2P16A 1ID5H 1LQDB 5EQRA 1AHTH 3ZZCA 3GDVA 4ZHLU 4INKA 4DY7B 1EZQA 1GHAG 3BTHE 3MI4A 2C4FH 2P8OB 3LJOA 1GBAA 4D7GA 1K1LA 4K2YA 3T25A 1XMNB 1O31A 2WPLS 1MZDA 3RMLH 5C5OA 1A0LA 4H6TA 1C5TA 1HXEH 3BTGE 2LPRA 1GMDF 1DVAH 4BXWA 4ZMAH 3RMOH 4WXIA 1O3KA 1THRH 1WUNH 1JRSA 1O2MA 5EOKA 2ANYA 1W14U 1NS3A 1MQ5A 1SGPE 1DWDH 2BD7A 1N6XA 4I7YH 2XW9A 1HXFH 1OYQA 1HJAB 4DVAU 3QGNB 1WSSH 1EATA 1AY6H 4Y8XA 1S81A 1QB6A 1ZHRA 3A88A 4ISHH 2BDIA 1BTWA 1VGCC 3QZRA 3KQCA 2ZQ2A 3M3TA 3F68H 3OSYA 4RSPA 4X2XA 1UVTH 5FPYA 3V3MA 2G8TA 5HMAA 1BTZA 5F8ZA 1WAYB 1A5IA 4X8TH 3TITA 1AUTC 2VU8E 1A3EH 2HVXA 4FUFA 2CN0H 1O3HA 4X6PA 1C5LH 1P2OA 2ZFRH 4YZUA 5FCRA 4E7RG 1T4UH 2A5KA 5FX6A 2Y80A 1XVOA 2OP9A 1TALA 1O3DA 1GWAA 1MUEB 1MAYA 3E0PB 2BDHA 1JWTA 1O32A 3E1XB 4KELA 1P2IA 4U01A 5TJXA 2A4RA 2FOMB 3ZVEA 3HGPA 1GHXH 2BX3A 2ZFFH 3LGTA 2R2MB 1HAOH 1KXBA 3MYWA 3RXMA 5K7RA 4U32A 1ZMNA 1AI8H 1RIWB 1GL1A 1SGQE 3ATLA 3BTWE 3PB1E 1OX1A 4O9VA 1UTKA 4Y11E 3RXQA 2IN2A 1Z6EA 1O3EA 1O5CB 4X6NA 1TMBH 3BTME 4OS4A 5DP6A 3ZZ7A 3GY8A 3PO1C 2V3HH 4B1TA 2LIZA 4YLQH 2Q6FA 1QGFA 2FMJA 3TK6A 3TLOA 2CMYA 1VITF 4FUGA 3RM2H 2C8XB 2A32A 2QYIA 1EOLA 4ABDA 8ESTE 2TGPZ 4I8LA 3SUDA 1HV7A 1O5GH 1Y3XA 4UFGH 3A8AA 1O3CA 2H9EH 7GCHF 2STAE 4FVBA 2BLVA 4GLYA 4A6LA 5C2ZA 1A3BH 1ELBA 3T29A 1MMJN 1TPSA 2ALPA 4NGAH 4RKOB 3K6YA 1O2YA 6GCHG 1Q2WA 1GJ4H 3OX7U 4B73A 5AFZH 3ZZ8A 2W3KA 2HGTH 1BTXA 2GP9B 2HRVA 2NU0E 3RP2A 2G4UA 3SU5A 1O3IA 2FOGA 1GHAF 4NIXA 1Y3WA 1Z6JH 2J38A 1RD3B 1Z8GA 4KGAA 6CHAB 3M3VA 1YC0A 2HNTC 1H9HE 5JPMH 1QRZA 3SHAH 2ODPA 2AGIX 2PGBB 1P03A 1LHGH 1JIRA 4JZDH 2A5IA 1SGYE 1Y5UT 2F83A 1Y5AT 1TNKA 1TBRH 4K69A 3CS0A 3IITA 1SG8B 1GI0A 1O2IA 1QY6A 1BTPA 3K65B 1AUJA 1ZZZA 1SGIB 1ELDE 1EP5A 4LZ1H 5DG6A 1UVPA 1HJ8A 3ATKA 1CO7E 2D26C 2Q6GA 3BSQA 5EQSA 5L2ZH 1P2KA 1GDUA 1O2QA 2YOLA 1P0SH 3M5OA 1MZAA 3EQ0H 1BTUA 1GJAB 1FY5A 3Q76A 1DE7H 3DT0H 3SJ9A 3ELAH 4JYTA 3SU4A 2STBE 1P2JA 3AW0A 4NA8A 1AE5A 2QCYA 5FHTA 3F9FA 2PFEA 1B0FA 4GCHG 1ESBA 1S5SA 3E0NB 4X8VH 1UMAH 3SU6A 4ZKNU 1CHGA 2ZCKP 1HNEE 1PQAA 5AFYH 4LK4A 1YKTA 2G55A 1ACBE 1NTPA 1CA8B 3LGVA 2BVRH 3ZV9A 3R3GB 2GMTB 1PPFE 4JZIA 2BDBA 3OY5U 2ZDKA 5JBAS 1E34B 1W12U 3UR9A 1GBDA 2XBYA 3A7VA 2FOAA 2B7DH 4AX9H 2VB0A 5TCAA 1SFIA 2FS8A 1YPEH 2BQ6B 4KP0A 5C3NA 2W3IA 1DWEH 3URDA 2ZNKH 2VGCB 1HFDA 2Q1JA 1TA2A 4ABAA 3BF6H 2FI3E 3A7TA 1FNIA 2P3TB 3ZZAA 1ELAA 2CHAC 2ODQA 1PQ5A 3MH7A 1ZJKA 2FODA 3W94A 3VXEH 1S6HA 3B8JA 5T3HA 3NUMA 1PQ8A 1TFXA 1ZHMA 3VB5A 2HWLB 5GPIB 3AAVA 1EPTA 4OGXA 2XCFA 4UDWH 1T8MA 4MVNA 3T5FH 4UFFH 4I31A 4TY6A 1G37A 5EODA 1HAGE 1CGIE 1TGNA 4OS6A 1L4DA 1ZTLA 5J4QA 1SOZA 1UTLM 3SU1A 1EJAA 3SUFA 2P8OC 3P70B 4ZHAA 2LNCA 4XDEA 1FN6A 1C2LA 2VIDA 3S69A 2DE9A 2GTBA 2GCHG 2ALVA 8GCHF 4TY7A 3TH3H 3UUZA 1C2DA 3DFJA 5EXNA 3TGIE 3NWUA 1HBTH 1LMWB 2PW8H 3PMJA 1FDPA 4QT8C 5A8XA 1UK3A 1QL7A 3P8OA 1A46H 1W0ZU 5ABWA 2QXIA 1HIAA 3CP7A 2PSXA 4D9RA 1KDQA 1MTNB 3BG8A 4MPUA 3A83A 1DLEA 3MNXA 4FUJA 3T26A 1O5EH 3GY5A 1TPOA 3UPEA 4D7FA 2Y81A 5AF9H 1TNIA 1F2SE 1HJAC 1T7CA 4XBCA 2C3SA 1XUIA 1GI6A 1GHZA 4GPGA 3RDZA 2ZDAH 3TU7H 1CT0E 1XVMA 1LVMA 4XFQA 2BOHB 2FOFA 2W26A 4JYUH 1CA0B 1IQNA 1AB9B 2G00A 1MU6B 3S9CA 1MTSA 2H5CA 2IJOB 1GHWH 1THSH 3KCGH 1EJMA 3GCNA 2J34A 1AD8H 1A2CH 2ILNA 3SI3H 4IC5A 1N1LA 4A1VA 1O2XA 2SGEE 5DJ7A 1L1NA 3TJVA 2FZZA 1IQJA 3F9HA 2YNAA 1F7ZA 1BA8B 3PV4A 1Y3VA 5DP5A 4BANB 3ZZ9A 1T8LA 5A09A 3QK1A 4X1SU 2G52A 2ZI2H 1GI4A 3UFAA 2XTTB 3SO3A 3UWJH 2BQWB 1DFPA 1O34A 3RXDA 5BRRE 4B2CA 4CBOA 1UHBA 4DGJA 3A8BA 1GVKB 1SI5H 2ZA5A 3M35A 1O3LA 4AB8A 1UVUH 3GCTG 3RM0H 1RIWC 1J16A 1AKSA 1K22H 5ESTE 2GZ8A 3LC5A 1NFUA 3M37A 3O8DA 3A81A 3PM3A 2TGAA 2PHBA 3TK9A 1WOFA 1SQOA 1JMOH 2NU4E 4YOIA 1O2VA 1HRTH 4Q7XA 2FOEA 1AVGH 2BM2A 3O8BA 2QXGA 3F9EA 5DGJA 2F9OA 3R0FA 4ABFA 4Q80A 4E06H 1GMHF 3SQHE 2AIPA 2H5DA 5EQQA 5GJ4B 3M7TA 4B74A 1GMDG 1C1NA 1YYY1 1WQSA 2Y5GA 4ISLA 2ZDLA 1C1VH 4NIWA 1SL3A 3BTTE 2JETB 3SNEA 4UE7H 3E90B 1GBHA 4Z6AH 1AGJA
chains in the Genus database with same CATH superfamily
2QF4A 4FUDA 3SV2H 2YNBA 1HLTH 4D8NA 3SJKA 1CGHA 2FI4E 1G2LA 1H1BA 1V2UT 3KQEA 1BMAA 1KLJH 4TPYA 2A2QH 3TVJB 2J92A 1T4VH 1F0RA 2THFB 2XCNA 3RLYH 2HNTE 3RXHA 1K1OA 2GDDA 1L0ZA 3MNBA 3TJUA 4IW4E 1SLXB 4MNWA 1O5FH 3UY9A 1YBWA 2ZHQH 2BYAX 2CF8H 6CHAC 2W7SA 1V3XA 1O2ZA 2TPIZ 1VKYA 5K0HA 1V2TT 3F2HA 4CHAB 2JDID 5A0BA 3PTBA 2GDEH 1P02A 1TBZH 2BVSH 3MHWU 4GAWA 5SGAE 4ABEA 3LONA 1H4WA 3D62A 2UUKB 1G32B 1LKAA 1Z1JA 1EPTB 1GBBA 1RTKA 1AZZA 3QGJA 2ZU2A 2BY5X 1QL9A 4ZUHA 3L3TA 4F4OC 5JBBS 2Y82A 1OKXA 1XM1A 1K2I1 2NU1E 1SPJA 3D23A 1SLVB 1C4V2 3A86A 4AOQA 2A4QA 3M36A 1UTPA 4X2YA 1LPZB 3V12A 4WXVA 1EB2A 3UWIA 4X1NU 5JB8S 3PRDA 1NN6A 2AEIH 4MLFB 2HPPH 2ANWA 3FZDA 4E7NA 1AWFH 1HAZB 1SLUB 1UCYE 1CQQA 2BD2A 3M5MA 3GCOA 5EXLA 2PSYA 1GL0E 3MQKC 1VITG 1AVWA 4MNXA 1PPZA 3U69H 4D9QA 1HIAB 1C1SA 3RXLA 3U98H 3U8TH 1NFXA 2BVXH 5HXFA 1SGRE 2Z9JA 5GNDA 4DCDA 5JDUB 2OD3B 3E8LA 2GGVB 2GMTC 5E0HA 1ABJH 1ZJDA 1GGDB 1C1RA 2UWOA 5FPSA 1S82A 2ZIQH 1PYTC 3FFGA 1NC6A 2OLGA 1K1IA 1J9CH 2I6QA 1J14A 4WH6A 5E0GA 1EZXC 3MU1A 1ANDA 1ANCA 2VGCC 2OTVA 4X0WU 1IAUA 3SV6A 1HAYB 4ZAEA 3SNCA 1HDTH 3GCTF 5LPRA 1BRUP 4MNVA 2PR3A 4M9FA 2FLBH 4FU7A 1C2GA 3S7KB 3FVFB 5PTPA 1GJ9B 3P92A 5E2PA 1GJ7B 5FBIA 5DP7A 1ELGA 1V2RT 2WPIS 2Y7ZA 2GVFA 2F3CE 2VIQA 2K8IA 1YCPH 4K8BA 1BMFD 1GDNA 1TGCA 4XBDA 1NESE 1H8IH 4AYYB 1L1JA 1PQ7A 3BEFB 4B75A 1BRBE 5DPAA 2AMPA 1MCTA 1IOEA 2A31A 3LU9B 1K1PA 1PPCE 3EYDA 2ZECA 5EG4A 5F8XA 1AFQB 1D3TB 1FY8E 1UHBB 3UNSA 3EE7A 4CRGA 1VJ9U 1IQLA 2IJD1 3SYJA 2QF0A 1AKSB 2WPDD 5C1XA 1FN8A 5H4IB 1ZSKA 2ZTYA 1O3GA 3E16B 5JBCS 1G36A 1UVSH 1IQEA 3A85A 2L74A 3MU0A 5T6DA 1P8VC 1QTFA 5EW2H 2PLXA 2FOBA 3ODDA 3VB7A 2BDAA 4IBLH 3TNTA 1KLTA 1TLDA 1ZMJA 4B76A 3LH3A 1AE8H 3HPTB 1MTNC 4P00A 4WY3A 3LJJA 4DOQA 2PKAA 3VGCB 2KZ4A 3LGWA 3N7EA 3MU8A 1BJUA 1RRKA 1EAIA 3TJNA 1GBJA 3BTDE 1V6DA 3BTEE 1OP0A 1P10A 1ZMLA 4NWLA 5GXPA 4HZHA 4H4FA 1NRSH 5C94A 3RU4T 1C2KA 1CU1A 4CR9A 3VB3A 1CA0C 1NU7B 1YM0A 2WUBA 4ZROA 1AB9C 1Z8RA 1TE0A 3RXVA 2HALA 2VH0A 2FYRA 1VJAU 4INHA 2BHGA 4O3UA 1D6WA 2R2WU 3PYHA 1O39A 4Y76A 1ZYOA 1EB1H 2FOCA 2KCPA 2UUJB 1JBUH 3ZVDA 2HLDD 4NFFA 3KYFA 1LHCH 1A5GH 4AFUA 3S9BA 3RXCA 1IQKA 1O5BB 3KNXA 1TGSZ 3BIUH 4IS5A 1KSNA 3WWFA 2KCAA 3S7HB 2BDGA 1FI8A 2V35A 5A8ZA 2GCTB 2ZEBA 2C8YB 2C8ZB 1G3DA 2VWNA 1O3AA 1BJVA 1SKYE 1O3MA 4OM9A 2D2DA 1K28D 1TGBA 2J95A 2WPMS 1P2NA 3VG8A 2KCYA 5LGOA 2EEKA 4WMEA 3A82A 2JJ1D 3SU3A 1ZOMA 4JYVH 3A84A 3TIUA 1D3QB 5DN6D 3TGJE 2ZFTA 3JZ1B 4FUHA 1D9IA 4K1EA 2CK3D 3MMGA 5EPNA 4JZ1A 1EJNA 1GBLA 4ZXYH 2XC4A 1BBRH 9ESTA 1VR1H 1BUIA 1ELVA 3KQDA 1HYLA 1SGEE 1C2FA 1DANH 1T8NA 1EAUA 4UFEH 5DO4H 2J94A 4A1TA 1C1MA 4NIVA 8GCHG 1DOJA 1O2KA 4Q4LA 9LPRA 3KQ5A 1NROH 1FAKH 4WMFA 2VBCA 3FP7E 1GJBB 1S83A 2Y5HA 5EJLA 2FTMA 2KAIA 1PJPA 3NKKA 1THPB 3IWMA 2H9TH 2ZGJA 1P04A 5KGOA 3RXOA 2W6ID 2HNTF 3Q77A 2JETC 4BAMB 1ZSLA 3EA8A 1QJ7B 2FTLE 3ZVAA 1TRMA 1NPMA 2BD4A 4TPIZ 3A80A 1CE5A 1EOJA 5IDKA 4Y10E 1DICA 4IN2A 4DJZB 1JIMA 1HJ9A 1C5ZB 1ETTH 2FPZA 1UVOA 3K9XB 2SGFE 1CT2E 2B9LA 1A4WH 3LGUA 4NSVA 3A89A 3VB4A 1BITA 1MKWH 2B0FA 4Y0ZE 3BG4B 2ZCHP 3PMAB 1W10U 1QBOA 2Q6DA 3SOSA 3RXFA 2FIRH 4AG1A 3Q3KA 1DLKB 1FMGA 4KTSA 2AHME 4NZQA 3RXBA 4ZHMU 4CHAC 4HTCH 5CHAB 3V0XA 5LPFA 1ZR0A 1KXDA 3BTKE 5L30H 2VNTA 3QTVH 2A1DB 1TIOA 2FP7B 1QJ1B 2BY6X 2P3UB 1GDQA 1NO9H 2A4GA 4I33A 4ABGA 1T8OA 1EPTC 3RXIA 1ZRBA 2SGQE 2G81E 3GY3A 3VXFH 5EW1H 2Z3CA 1K1MA 3F3BA 4NIYA 2Z9KA 1ANBA 1KXFA 2VIWA 4AFSA 1AMHA 4GHTA 1O30A 3MO9A 1GPZA 1QBNA 3BN9A 3RXSA 2Z94A 3H7OA 3QWCH 3HKJB 4LZ4B 3E3TA 4XBBA 1W11U 1OHHD 2RA3A 2K0QA 1M9UA 2FO9A 2ZU1A 4A5TS 1C5XB 1KY9A 3IG6B 2Z9GA 1GBKA 2A4OA 1FZZA 1NT1A 3MFJA 2NU3E 1BHXF 4BTUB 1INCA 1RS0A 2XBWA 4ZKSU 1P9SA 3U28C 1B5GH 3EE0B 4JK6A 1C9TA 1D6RA 1GMHG 1P2QA 4K1SA 5FAHA 3L33A 5F6MA 2PP6A 2JIZD 1BQYA 3GY2A 4MG3A 1QNJA 2A45B 1O2OA 1VITH 2BB4A 1K21H 2PKAB 4FETA 2XNIA 2ZU4A 1BTHH 1C4Y2 1GGDC 1J15A 3QN7A 4HG6A 3ZZ6A 1TX7A 1DWBH 4BXSA 2WPHS 3PV5A 1P57B 4NG9H 1C1WH 1HAHH 4CH2B 4O97A 3P6ZB 3RXGA 4AG2A 4ISOA 1GMCG 2OBOA 3BV9B 2RA0A 2QV1A 1V2VT 4DIIH 1P12E 3EAJA 2B5TB 1E35B 2BZAA 2FX6A 3W95A 4YTAA 1CGJE 1C9PA 1O2HA 2C90B 4FUCA 2R3UA 4IN1A 4ABJA 3QUMP 2K7XA 2BLQA 2FEQH 5JYIA 3TH2H 1EXFA 2G5NA 3SNBA 1L4ZA 2XBVA 2ULLA 4OS7A 3EA9A 3P95A 4RT0A 1EASA 1NFYA 3F0PA 3MO6A 1N6YA 2KFWA 4XD7D 4TWWA 1GHBF 2FM2A 4CR5A 5JBTA 2AERH 2OUAA 1EZUC 1V2PT 2VIVA 3Q3XA 4X2WA 1C5QA 4M7GA 2AS9A 3D65E 3MWIU 1AFQC 4RI0A 3RXUA 3LDXH 1HCGA 4JK5A 3ITIA 1MTWA 1UTNA 1P3EA 2WINI 2V3MA 3NPSA 4UEHH 1A61H 1TQ7B 3TH4H 1ZRKA 2BDCA 5F03A 1O2PA 1V2MT 3M3SA 2QE7D 4PROA 1A1RA 1EAXA 1HAVA 4TT3D 4WJG2 1GVZA 5HKKD 3SV9A 1O2TA 1S0QA 2ZGHA 5ESBA 3ZYDA 3C1KA 3P8FA 6LPRA 2CJIA 2ZCLP 2FI5E 3U1IB 2ZHEH 1QHRB 3VGCC 3SNAA 4ASUD 2F9PA 4Q7YA 1F5RA 7KMEH 2KAIB 1G3EA 1LPKB 3STIA 2C8WB 1KXEA 1FQ3A 3EGKH 2XYAA 1GI2A 1W7XH 2H9HA 1P3CA 2ZTXA 4FU9A 1JOUB 1QB1A 1FIWA 1WCZA 4LOYH 3A7XA 1C5YB 3AW1A 2PWXA 2ZU5A 1P11E 3SW2B 2PV9B 3A8CA 1SQRA 1YPJH 3V13A 1S85A 1Z8IB 1OWEA 5T6GA 4NSYA 5HYOA 1V2JT 1W8BH 2G51A 1PFXC 2VVUA 3PRBA 3RXRA 4F49A 4RKJB 2J5UA 3UAIC 2FYQA 2QXHA 1SGDE 3PLPA 3MH6A 2GCTC 1LCYA 1GJ8B 1OPHB 2P59A 5BPEA 4OGYA 2FOHA 3QTOH 3F9GA 1QA7A 2Y5FA 4B2AA 3O8RA 2BY9X 4FXGH 3UNRA 1LVBA 3LKWA 1PPHE 3M7QA 4JZEH 3SHCH 1QBVH 2QY0B 1IQIA 1GI5A 2BXUH 3LC3A 1O33A 1OS8A 1VCWA 1W13U 1YGCH 3H09A 3SJOA 1V2WT 1MBQA 3BIVH 2WPJS 2IPQX 3DD2H 1LKBA 4J1YA 5T6FA 1C1UH 4AYVB 1F0SA 4NWKA 3VPKA 1FUJA 1MU8B 2L6OA 3G01A 3T62A 1NRQH 1O36A 3TK5A 3V7TA 1BZXE 1O2UA 2OXSA 2AGEX 3GISB 3RU4E 4AGJA 5G4BA 3WWBA 3RC4A 3H5CB 3SZEA 1MH0A 4XSKU 1ELCA 2OC7A 1MAXA 1HAXB 1Y8TA 1GHVH 3PMBB 5GDSH 4BAHB 2GD4B 3KF2A 2A2XH 4JZFH 8KME2 2BY8X 3LGYA 2ZPQA 1GMCF 4I8KA 2XWBI 2BXTH 5B6OA 1X7AC 1N8OB 2PUXB 1FJSA 3UNQA 1C2IA 3UQOA 3SUEA 1GHYH 1FPCH 1TAWA 1S0RA 4FUIA 1ZSJA 1EUFA 7LPRA 2OQ5A 4BAKB 4A7IB 2H6MA 3RXPA 2TBSA 2QC2A 2ZFSA 1LTOA 2GJGA 3SV7A 4MPXA 2ZGXH 1DX5M 3DUXH 3SORA 2ZDMA 2ZFPH 1GG6B 3ZZDA 1G3CA 1QIXB 2WV4A 4H42U 1V2NT 1HGTH 1YCPM 2TGTA 1RJXB 3BG4C 1FIZA 2JKHA 2YMSB 2A7HA 2EY4C 1RTLA 1J8AA 3WW7A 1CSOE 4FU8A 1C5OH 3NXPA 1FAXA 2RDEA 1MQ6A 3PROA 2DUCA 2OC8A 4CREA 3MH5A 2XWAA 1C5RA 4X1QU 1TONA 2JH0D 1Z71A 1Y3UA 4AZ2B 2ZZUH 5CHAC 3UTUH 1BB0B 1FY3A 1QZ8A 4WMDA 3OEED 3ZZ5A 1AU8A 1YPHC 1C1QA 1DXPA 2AMDA 3M5LA 2ZPRA 5IK2D 1W7GH 1UTQA 1MCVA 1DUAA 4LXBH 3MO3A 1ZHPA 2HLCA 2ZDVH 3ZVGA 3NK8A 1DPOA 4OS1A 1SR5C 4TSFD 3Q3YA 3GDSA 4XOJA 3DHKH 2C93B 1YCPK 1C5NH 3ZZBA 4WWYA 1SVPA 4AFQA 1KDQB 1TB6H 2XBXA 4GSOA 1C2EA 1O35A 4CH8B 1COWD 1GBIA 1HAPH 2VIOA 3NRLA 1BMNH 1TNLA 2W5EA 3RXJA 1AWHB 2NWNA 2W7UA 4TWYA 5A2MH 1BHXB 1HAVB 1FLEE 1RTFB 2ANKH 3SUGA 3ZVBA 4CRBA 1LQEA 1SHHB 2PTNA 1HUTH 2UUYA 1PYTD 1Q3XA 1Y59T 1H9LB 1GCTB 1XUJA 2FESH 3KYGA 2BD8A 4Q7ZA 4YO9A 2J97A 4SGAE 4Y79A 4CBNA 3P8GA 1OOKB 2ZC9H 1AIXH 5EGMA 1SC8U 4YESB 2F4LA 2VWLA 1YP9A 4D76A 5TCCA 3TGKE 1O3BA 4Q63A 1DT2A 1IQGA 2QF3A 5LPEA 1VZQH 1BMMH 1D4PB 3NCLA 2QGRA 4NA7A 5C17A 3NZIA 4XE4A 1UTOA 1XUFA 3DSOA 2Z9LA 1SGFG 3FZZA 1C2JA 2CV3A 4Y0YE 1DDJA 1JXPA 3ESTA 4XRNA 2WPKS 2O8TA 3RMMH 3UQVA 4I8GA 2PKSB 2ZGBH 1UO6A 1IHTH 4YOJA 1KXAA 2XC5A 4IMQA 3MTYA 1ELEE 1OSSA 1LDTT 2GZ9A 3SNDA 2UWPA 5I46H 1NZQH 1F0UA 2Y7XA 2D1JA 4I8HA 1G2MA 4HFPB 1B7XB 3KGPA 2M2AA 2K1QA 3AASA 4A1XA 4ASHA 4YLUA 3HATH 3RMNH 3QZQA 4O03A 1O2WA 4KKDA 1UJ1A 1LPGB 2F9UA 1C5UA 3TJOA 5A8YA 1IQMA 1UK4A 1TRNA 2ZKSA 4Q2KA 2ANMH 4MPWA 2BTCE 3OEHD 5EU8A 4DIHH 1ELTA 1AFEH 2GKVE 1W0JD 3ATMA 3RLWH 2XRCA 3RXAA 4X6OA 3FP8E 2ZQ1A 1LHDH 1T31A 1WTHD 1HPGA 1WBGB 1DSUA 1G30B 1BBRK 4X1PU 1F0TA 3BEUA 1XUHA 1GJ5H 2ZHFH 1EAWA 3UIRA 1OP2A 3A7WA 1GBTA 1YPLH 1D3PB 4NZLA 1DY9A 1BDAA 2XC0A 2AMQA 2ESTE 5JB9S 1A0HB 1ETSH 2EQNA 1H8DH 3FN8A 1S84A 1SSXA 4IGDA 2B8OH 2SGPE 3LH1A 4AB9A 1W3CA 1AO5A 2ZG0H 2JJ2D 3B9FH 1ETRH 1GBMA 3UOPA 1BCUH 2EI6A 3SQEE 4ABBA 1KIGH 3KQBA 1LHFH 2WYJA 3HGNA 2QIQA 2F9NA 1XX9A 1C2MA 4NFEA 2BLOA 3WY8A 1QRWA 4UONA 1FPHH 1SQAA 3HK6B 3AAUA 1WXRA 2FXRA 3PLKA 1L1GA 3D49H 2ZHWH 1MKWK 4AFZA 4BOHA 5A0CA 4E05H 1E38B 4MDSA 1K9OE 2SGDE 5LH8A 1V2ST 4YT7H 3TNSA 2WV9A 2Z6BD 2QA9E 2H1UA 1FV9A 1XUKA 2PTCE 1GHBG 2A7JA 4BNRA 5CDFE 1NY22 2J4IA 3LT3A 2EI7A 5J4SA 2GT8A 1DUEA 1YF4A 2F43B 3MOCA 3SJ8A 1P09A 4ZXXH 1TNHA 2F91A 5DP3A 1EKBB 4J2YB 1TX6A 2O8UA 4MQAA 1W0YH 5C0TA 2BOKA 2ASUB 3RU4D 3GY4A 4MTBA 1E36B 1QURH 1SQTA 3LOXA 4WH8A 4ACBA 5F53A 1K1NA 4CRFA 1RXPA 1MTVA 5C1UA 1ZPBA 1MKXK 3CS7A 5I25A 3VEQB 1A5HA 4Y6DA 2WYGA 1TMTH 2WV5A 2G4TA 2BD9A 4NCYA 3URCA 3ZZ3A 3T2NA 2O9QA 3T27A 1OWJA 1N8OC 1TWXB 4MNYA 4ABHA 1C1TA 3FKSD 1V2QT 2CF9H 4O3TA 2Z3DA 4F48B 3BTFE 4HI3A 1TPAE 2D8WA 2P93A 5DKMA 1HAIH 2RFKC 4RN6A 3EA7A 1ZGIA 2SNWA 1QQUA 3K6ZA 2PUQH 1OYTH 4CRAA 1O5AB 1TOCB 1QRXA 3GICB 1PPGE 2GT7A 5E0JA 3E6PH 2O8LA 3SZNA 1GG6C 2EC9H 1FONA 5FXLA 3KHVA 3RUOA 1ANEA 2ZU3A 1O2GH 1ZTJA 2FDAA 2YMSC 3LGIA 4R0IA 2OBQA 5C5NA 2OCVB 2A0QB 2NU2E 3GY7A 5E2OA 1SOTA 1MD8A 5B6LA 1V2KT 4UD9H 3HKIB 1YPHE 4BTIB 4FUEA 1MKXH 1OWKA 1E0FD 1BRCE 1EZSC 3ATWA 2HPQH 5FX5A 3FO8D 2BY7X 1AQ7A 3AVZA 3LIWA 1P06A 1YLNA 3BTQE 3PLBA 4VGCB 2VWOA 1DITH 1ARCA 1TMUH 1EX3A 4DT4A 3VFEA 4GUXA 3DSPA 1BIOA 2QAAA 2HOBA 1PPBH 2VVVA 2OK5A 3SU0A 1GI7B 7ESTE 1TQ0B 2WUCA 3F6UH 2SNVA 4X8SH 4K5ZA 5EPYA 1Z1IA 5FBEA 2ZPSA 1RGQA 2AFQB 3QO6A 1ZPCA 1O3OA 1W2KH 3GY6A 1P05A 2VJ1A 1MABB 1NU9A 5GCHG 1S6FA 1WTGH 3U9AH 4BTTB 2R9PA 1QQ4A 1XUGA 3GDUA 3SU2A 1ZPZA 3N7OA 3C27B 2FLRH 3CNRA 2O8WA 1KXCA 1O2RA 1LHEH 2J98A 1ZTKA 3ZVFA 2IPHA 4MPVA 3UREA 1BRAA 1WV7H 2ZF0H 3UOUA 1CBWB 1IQHA 1GI8B 1UTMA 3BEIB 4CRDA 4GHQA 3GCHB 3S9AA 5A0AE 2P3FH 1SGFA 3OU0A 1SFQB 1TYNA 1XKBC 2VH6A 5FCKA 1O0DH 1GJCB 3A7YA 3GS9A 3STJA 2P94A 3GYLB 1NFWA 2TRMA 1O38A 1BT7A 4KTUA 1GCTC 3ODFA 1LVYA 3T28A 3VB6A 4ISIH 3A87A 4X6MA 4AN7A 2O8MA 3L6PA 1LO6A 4ZKRU 2ZFQH 4Y71A 5DK1A 1ORFA 3E91A 1O3FA 2BD3A 4ZKOU 5EJ1A 2FX4A 4YM9A 4X8UH 3A7ZA 1BBRE 1TGTA 3ATIA 2SGAA 5HIZA 2R0LA 3SI4H 1Y3YA 3W1EA 1UCYK 1UW7A 1QJ6B 5L6NH 2V3OH 1O2JA 4ISNA 1DY8A 1ELFA 4I32A 4K1TA 3B23B 5L2YH 2M5TA 4K8YA 2PKSC 3O8CA 1C4U2 2A5AA 4ZCNA 4FVDA 2JH6D 3MU5A 5AVDA 1O3PB 1ZLRA 3ENSB 1SHYA 4OS5A 6GCHF 1P2MA 3RXEA 1DXWA 1DWCH 1ESTA 1O2SA 1ESAA 1VGCB 4U2WA 2OC1A 3SN8A 1O2NA 1C5WB 4JMYA 5C67A 1Q31A 1V2LT 2GZ7A 1EP6A 3F1SB 1C2HA 1MD7A 8LPRA 1SB1H 1WYKA 3PMHB 1C5SA 2KM0A 1DM4B 2Y6TA 2VVCA 1SLWB 3EDXB 1VCQA 3FOAA 2F9VA 4Z0KA 1CHOG 3PTNA 1GI9B 3KN2A 2FS9A 5HIYA 2EI8A 2ZGCA 5HM2A 1KTSB 5HM9A 1YPGH 1SGTA 1TRYA 3I29A 3EBNA 3ZYEA 1UCYH 2Z7FE 4TYDA 4K3JA 1OWHA 4DT7B 4YT6H 3SGBE 3S0NA 1LVOA 3U1JB 1YPMH 1GBFA 2OC0A 3M61U 1F92A 1P01A 3OYPA 1Z7KA 1GVLA 5DP4A 3OY6U 2XNDD 1GJDB 3CENA 1G9IE 1FX0B 3SGAE 4WVPE 1DSTA 4THNH 1NRRH 4ABIA 5IYTA 2BDYA 1UTJA 1GJ6A 4YOGA 3FANA 2RCEA 4FUBA 1P9UA 1ARBA 3M5NA 4Y7AA 1T32A 2W6JD 3GOVB 1TPPA 4B71A 2GX4A 3SGQE 1ABIH 5GWZA 1QCPA 3ZV8A 2I6SA 3JZ2B 1SGCA 2BQ7B 2PGQB 2R0KA 3PO1B 1MBMA 1V2OT 5CE1A 3DA9B 2ODYB 2ZHDA 2UUFB 5F8TA 4DG4A 4GCHF 1F5LA 1E1RD 1CVWH 1IQFA 3K2UA 1ZGVA 1TNJA 1TA6A 1Y5BT 3RC6A 2G5VA 5DSFA 5C1YA 1KYNA 1UK2A 1F5KU 3LPRA 3RC5A 1HB0B 4X1RU 5GCHF 3KL6A 3FP6E 1WU1A 3SV8A 1CT4E 2OINA 1QR3E 4RT1A 1A0JA 1YY3A 3PWCA 2VWMA 4ZH8A 4ACAA 1KMHB 2V0BA 1C1OA 1YWUA 2AH4X 3SJIA 2BX4A 1OXGA 1PPEE 6ESTA 2CXVA 4WF8A 1C5PA 4SGBE 1BTYA 1KLIH 1GBCA 3ZZ4A 3SBKA 4DURA 1SBWA 3H7TA 2H2ZA 3PWBA 1QB9A 4Y7BA 4U30A 4R8TB 2ZP0H 2BZ6H 1TBQH 3ZVCA 3OTJE 4CRCA 4AORA 5HGGA 1K1JA 2QN5T 5FPTA 2SFAA 3P17H 3RXKA 1GI3A 3HK3B 1OWIA 1A7SA 5ETXA 2TIOA 1O37A 1TOMH 4GVUA 1YLDA 2J2UA 2J98B 4I8JA 1TX8A 1QL8A 4I86A 1VCPA 3Q00A 4A92A 1YPKH 2ZDNA 1QFKH 1WQVH 5DP9A 3MU4A 2R3YA 5CMXH 4NA9H 5CHBA 4BAQB 2V6NA 4IC6A 2Z9IA 1FXYA 1GI1A 1AN1E 1XXDA 2GV6A 2WSSD 1SMFE 4B6FA 4H6SB 1O5DH 2GCHF 5AHGH 2VIPA 2XXLA 4AGKA 2CGAA 2RDLA 1KTTB 4Y8ZA 1DS2E 5C20A 3QDZB 5EIYA 3I77A 3KIDU 2AYWA 2Z3EA 1WDIA 1GCDA 2RG3A 4INLA 2UWLA 5DP8A 3M7UA 3F2FA 1J17T 1MTUA 3P8NA 1XXFA 2EA3A 3UR6A 4DW2U 2VINA 2F9BH 4UFDH 3U8RH 1OP8A 1CHOF 1XKAC 2JH5D 1AZ8A 2A7CA 3U8OH 3AK5A 1GBEA 4ESTE 1SGNE 4HGCA 4OS2A 1O2LA 2DE8A 1TABE 3N99A 1EQ9A 1JRTA 1NRNH 2AIQA 4B2BA 3I78A 3KEEA 1E37B 1S6LA 4VGCC 4Y8YA 3TPIZ 2P95A 1C1PA 3GYMA 1RFNA 1OWDA 1H9IE 2FWWA 1IHSH 3QX5H 1YLCA 2BMGB 1AVXA 4K60A 4JCNA 1L2EA 2OQUA 1O3NA 2IOTA 5EXMA 1B0EA 3MNSA 5E8EH 2BLWA 1U6QA 3QLPH 1NRPH 1BOQA 1Z8JB 1C5VA 3MH4A 3RXTA 2ZTZA 1QA0A 2AGGX 2TGDA 1FY1A 4BAOB 1FY4A 1C5MD 4KTCA 2CHAB 3A8DA 4X2VA 2ZO3H 2GV7A 7GCHG 3DFLA 1D3DB 1CBWC 2QXJA 5GIBA 4FOUC 3GCHC 4IMZA 3FAOA 1G3BA 3MNCA 1O3JA 1BMLA 2BD5A 2J9NA 2ZWLH 1NM6A 1TNGA 2P16A 1ID5H 1LQDB 5EQRA 1AHTH 3ZZCA 2LP6A 3GDVA 1H8ED 4ZHLU 4INKA 4DY7B 1EZQA 1GHAG 3BTHE 3MI4A 2C4FH 2P8OB 3LJOA 3ZIAD 1GBAA 4D7GA 2HVYB 1K1LA 4K2YA 3T25A 1XMNB 1O31A 2WPLS 1MZDA 3RMLH 5C5OA 1A0LA 4H6TA 1C5TA 1HXEH 3BTGE 2LPRA 5KECA 1GMDF 1DVAH 4BXWA 4ZMAH 3RMOH 4WXIA 1O3KA 1THRH 1WUNH 1JRSA 3DSGA 5C0UA 1O2MA 5EOKA 2ANYA 3F0OA 1W14U 1NS3A 1MQ5A 1SGPE 1DWDH 2BD7A 3N7DA 1N6XA 4I7YH 2XW9A 1HXFH 1OYQA 1HJAB 4F55A 4DVAU 3QGNB 1WSSH 1EATA 1AY6H 4Y8XA 3PV2A 3OAAD 1S81A 1QB6A 1ZHRA 3A88A 4ISHH 2BDIA 1BTWA 1VGCC 3QZRA 3KQCA 2ZQ2A 3M3TA 3F68H 3OSYA 4RSPA 4X2XA 1H8HD 1UVTH 5FPYA 3V3MA 2G8TA 5HMAA 1BTZA 5F8ZA 4Z1MD 1WAYB 1A5IA 4X8TH 3TITA 1AUTC 2VU8E 1A3EH 2HVXA 3DCLA 2CN0H 4FUFA 1O3HA 4X6PA 1C5LH 1P2OA 2ZFRH 4YZUA 5FCRA 4E7RG 1T4UH 2A5KA 5FX6A 2Y80A 1XVOA 2OP9A 1TALA 1O3DA 5FL7D 1GWAA 1MUEB 1MAYA 3E0PB 2BDHA 1JWTA 1O32A 3E1XB 4KELA 1P2IA 4U01A 5TJXA 2A4RA 2FOMB 3ZVEA 3HGPA 1GHXH 2BX3A 2ZFFH 3LGTA 2R2MB 1HAOH 1KXBA 2QF5A 3MYWA 3RXMA 1NBME 5K7RA 4U32A 1ZMNA 1AI8H 1RIWB 1GL1A 1SGQE 2WHXA 3ATLA 3BTWE 1OX1A 3PB1E 4O9VA 1UTKA 4Y11E 3RXQA 2IN2A 3UB0A 1Z6EA 1O3EA 1O5CB 4X6NA 1TMBH 3BTME 3OFND 4OS4A 5DP6A 3ZZ7A 3GY8A 3PO1C 2V3HH 4B1TA 2LIZA 4YLQH 2Q6FA 1QGFA 2FMJA 3TK6A 3TLOA 2CMYA 1VITF 4FUGA 3RM2H 2C8XB 2A32A 2QYIA 1EOLA 1EFRD 4ABDA 8ESTE 2TGPZ 4I8LA 3SUDA 1HV7A 1O5GH 1Y3XA 4UFGH 3A8AA 3F2GA 1O3CA 2H9EH 7GCHF 2STAE 4FVBA 2BLVA 4GLYA 4A6LA 5C2ZA 1A3BH 1ELBA 3T29A 1MMJN 1TPSA 2ALPA 4NGAH 4RKOB 3K6YA 1O2YA 2V7QD 6GCHG 1Q2WA 1GJ4H 3OX7U 4B73A 5AFZH 3ZZ8A 2W3KA 2HGTH 2XOKD 1BTXA 2GP9B 2HRVA 2NU0E 3RP2A 2G4UA 3SU5A 1O3IA 2FOGA 1GHAF 4NIXA 1Y3WA 1Z6JH 2J38A 1RD3B 1Z8GA 4KGAA 6CHAB 3M3VA 1YC0A 2HNTC 1H9HE 5JPMH 1QRZA 3SHAH 2ODPA 1E79D 2AGIX 2PGBB 1W0KD 1P03A 1LHGH 1JIRA 5T1VA 4JZDH 2A5IA 1SGYE 1Y5UT 2F83A 1Y5AT 1TNKA 1TBRH 4K69A 3CS0A 3IITA 1SG8B 1GI0A 1O2IA 1QY6A 1BTPA 3K65B 1AUJA 1ZZZA 1SGIB 1ELDE 1EP5A 4LZ1H 5DG6A 1UVPA 1HJ8A 3ATKA 1CO7E 2D26C 2Q6GA 3BSQA 5EQSA 5L2ZH 1P2KA 1GDUA 1O2QA 2YOLA 1P0SH 3M5OA 1MZAA 3EQ0H 1BTUA 4P02A 1GJAB 1FY5A 3Q76A 1DE7H 2YMSD 3DT0H 3SJ9A 3ELAH 4JYTA 3SU4A 2STBE 1P2JA 3AW0A 4NA8A 1AE5A 2QCYA 5FHTA 3F9FA 2PFEA 1B0FA 4GCHG 1ESBA 1S5SA 3E0NB 4X8VH 1UMAH 3SU6A 4ZKNU 1CHGA 2ZCKP 1HNEE 1PQAA 5AFYH 4LK4A 1YKTA 2G55A 1ACBE 1NTPA 1CA8B 3LGVA 2BVRH 3ZV9A 3R3GB 2GMTB 1PPFE 4JZIA 2BDBA 3OY5U 2ZDKA 5JBAS 1E34B 1W12U 3UR9A 1GBDA 2KCOA 2XBYA 3A7VA 2FOAA 2B7DH 4AX9H 2VB0A 5TCAA 1SFIA 2FS8A 1YPEH 2BQ6B 4KP0A 5C3NA 2W3IA 1DWEH 3URDA 2ZNKH 2VGCB 1HFDA 2Q1JA 1TA2A 4ABAA 3BF6H 2FI3E 3A7TA 1FNIA 2P3TB 3ZZAA 1ELAA 2CHAC 2ODQA 1PQ5A 3MH7A 1ZJKA 2FODA 3W94A 3VXEH 1S6HA 3B8JA 5T3HA 3NUMA 1PQ8A 1TFXA 1ZHMA 3VB5A 2HWLB 5GPIB 3AAVA 1EPTA 4OGXA 2XCFA 4UDWH 1T8MA 4MVNA 3T5FH 4UFFH 4I31A 4TY6A 1G37A 5EODA 1HAGE 1CGIE 1TGNA 4OS6A 1L4DA 1ZTLA 5J4QA 2WZQA 1SOZA 1UTLM 3SU1A 1EJAA 3SUFA 2P8OC 3P70B 4ZHAA 2LNCA 4XDEA 1FN6A 1C2LA 2VIDA 3S69A 2DE9A 2GTBA 2GCHG 2ALVA 8GCHF 4TY7A 3TH3H 3UUZA 1C2DA 3DFJA 5EXNA 3TGIE 3NWUA 1HBTH 1LMWB 2PW8H 3PMJA 1FDPA 4QT8C 5A8XA 1UK3A 1QL7A 3P8OA 1A46H 1W0ZU 5ABWA 2QXIA 1HIAA 2KR7A 3CP7A 2PSXA 4D9RA 1KDQA 1MTNB 3BG8A 4MPUA 3A83A 1DLEA 5KEDA 3MNXA 4FUJA 3T26A 1O5EH 3GY5A 1TPOA 3UPEA 4D7FA 2Y81A 5AF9H 1TNIA 1F2SE 1HJAC 1T7CA 4XBCA 2C3SA 1XUIA 1GI6A 1GHZA 4GPGA 3RDZA 2KX4A 2ZDAH 3TU7H 1CT0E 1XVMA 1LVMA 4XFQA 2BOHB 2FOFA 2W26A 4JYUH 1CA0B 1IQNA 1AB9B 2G00A 1MU6B 3S9CA 1MTSA 4B6EA 2H5CA 2IJOB 1GHWH 1THSH 3KCGH 1EJMA 3GCNA 2J34A 1AD8H 1A2CH 2ILNA 3SI3H 4IC5A 1N1LA 4A1VA 1O2XA 2SGEE 5DJ7A 1L1NA 5EJZA 3TJVA 2FZZA 1K0HA 1IQJA 4YXWD 3F9HA 1E1QD 2YNAA 1F7ZA 1BA8B 2LELA 3PV4A 4AC9A 1Y3VA 5DP5A 4BANB 3ZZ9A 1T8LA 5A09A 3QK1A 4X1SU 2G52A 2ZI2H 1GI4A 3UFAA 2XTTB 3SO3A 3UWJH 2BQWB 1DFPA 1O34A 3RXDA 5BRRE 4B2CA 4CBOA 1UHBA 4DGJA 3A8BA 1GVKB 1SI5H 2ZA5A 3M35A 1O3LA 1NBMD 4AB8A 1UVUH 3GCTG 3RM0H 1RIWC 1J16A 1AKSA 1K22H 5ESTE 2GZ8A 3LC5A 1NFUA 3M37A 3O8DA 3A81A 3PM3A 2TGAA 2PHBA 3TK9A 1WOFA 1SQOA 1JMOH 2NU4E 4YOIA 1O2VA 1HRTH 4Q7XA 2FOEA 3OTPA 1AVGH 2BM2A 3O8BA 2QXGA 3OE7D 3F9EA 5DGJA 2F9OA 3R0FA 4ABFA 4Q80A 4E06H 1GMHF 3SQHE 2AIPA 2H5DA 5EQQA 5GJ4B 3M7TA 4B74A 1GMDG 1C1NA 1YYY1 1WQSA 2Y5GA 4ISLA 2ZDLA 1C1VH 4NIWA 1SL3A 3BTTE 2JETB 3SNEA 4UE7H 3E90B 1GBHA 4Z6AH 1AGJA
chains in the Genus database with same CATH topology
4FUDA 3SV2H 2YNBA 1HLTH 4D8NA 3SJKA 1CGHA 2FI4E 1G2LA 1H1BA 1V2UT 3KQEA 1BMAA 1KLJH 4TPYA 2A2QH 3TVJB 2J92A 1T4VH 1F0RA 2THFB 2XCNA 3RLYH 2HNTE 3RXHA 1K1OA 2GDDA 1L0ZA 3MNBA 3TJUA 4IW4E 1SLXB 4MNWA 1O5FH 3UY9A 1YBWA 2ZHQH 2BYAX 2CF8H 6CHAC 2W7SA 1V3XA 1O2ZA 2TPIZ 5K0HA 1V2TT 4CHAB 5A0BA 3PTBA 2GDEH 1P02A 1TBZH 2BVSH 3MHWU 4GAWA 5SGAE 4ABEA 3LONA 1H4WA 3D62A 2UUKB 1G32B 1LKAA 1Z1JA 1EPTB 1GBBA 1RTKA 1AZZA 3QGJA 2ZU2A 2BY5X 1QL9A 4ZUHA 3L3TA 4F4OC 5JBBS 2Y82A 1OKXA 1XM1A 1K2I1 2NU1E 1SPJA 3D23A 1SLVB 1C4V2 3A86A 4AOQA 2A4QA 3M36A 1UTPA 4X2YA 1LPZB 3V12A 4WXVA 1EB2A 3UWIA 4X1NU 5JB8S 1NN6A 2AEIH 4MLFB 2HPPH 2ANWA 3FZDA 4E7NA 1AWFH 1HAZB 1SLUB 1UCYE 1CQQA 2BD2A 3M5MA 3GCOA 5EXLA 2PSYA 1GL0E 1VITG 1AVWA 4MNXA 1PPZA 3U69H 4D9QA 1HIAB 1C1SA 3RXLA 3U98H 3U8TH 1NFXA 2BVXH 5HXFA 1SGRE 2Z9JA 4DCDA 5JDUB 2OD3B 3E8LA 2GGVB 2GMTC 5E0HA 1ABJH 1ZJDA 1GGDB 1C1RA 2UWOA 5FPSA 1S82A 2ZIQH 1PYTC 3FFGA 1NC6A 2OLGA 1K1IA 1J9CH 2I6QA 1J14A 4WH6A 5E0GA 1EZXC 3MU1A 1ANDA 1ANCA 2VGCC 2OTVA 4X0WU 1IAUA 3SV6A 1HAYB 4ZAEA 3SNCA 1HDTH 3GCTF 5LPRA 1BRUP 4MNVA 2PR3A 2FLBH 4FU7A 1C2GA 3S7KB 3FVFB 5PTPA 1GJ9B 3P92A 5E2PA 1GJ7B 5FBIA 5DP7A 1ELGA 1V2RT 2WPIS 2Y7ZA 2GVFA 2F3CE 2VIQA 1YCPH 4K8BA 1GDNA 1TGCA 4XBDA 1NESE 1H8IH 4AYYB 1L1JA 1PQ7A 3BEFB 4B75A 1BRBE 5DPAA 2AMPA 1MCTA 1IOEA 2A31A 3LU9B 1K1PA 1PPCE 3EYDA 2ZECA 5EG4A 5F8XA 1AFQB 1D3TB 1FY8E 1UHBB 3UNSA 4CRGA 1VJ9U 1IQLA 2QF0A 1AKSB 5C1XA 1FN8A 5H4IB 1ZSKA 2ZTYA 1O3GA 3E16B 5JBCS 1G36A 1UVSH 1IQEA 3A85A 3MU0A 5T6DA 1P8VC 1QTFA 5EW2H 2PLXA 2FOBA 3ODDA 3VB7A 2BDAA 4IBLH 3TNTA 1KLTA 1TLDA 1ZMJA 4B76A 3LH3A 1AE8H 3HPTB 1MTNC 4WY3A 3LJJA 4DOQA 2PKAA 3VGCB 3LGWA 3MU8A 1BJUA 1RRKA 1EAIA 3TJNA 1GBJA 3BTDE 1V6DA 3BTEE 1OP0A 1P10A 1ZMLA 4NWLA 5GXPA 4HZHA 4H4FA 1NRSH 3RU4T 1C2KA 1CU1A 4CR9A 3VB3A 1CA0C 1NU7B 1YM0A 2WUBA 4ZROA 1AB9C 1Z8RA 1TE0A 3RXVA 2HALA 2VH0A 2FYRA 1VJAU 4INHA 2BHGA 4O3UA 1D6WA 2R2WU 3PYHA 1O39A 4Y76A 1ZYOA 1EB1H 2FOCA 2UUJB 1JBUH 3ZVDA 4NFFA 1LHCH 1A5GH 4AFUA 3S9BA 3RXCA 1IQKA 1O5BB 3KNXA 1TGSZ 3BIUH 4IS5A 1KSNA 3S7HB 2BDGA 1FI8A 2V35A 5A8ZA 2GCTB 2ZEBA 2C8YB 2C8ZB 1G3DA 2VWNA 1O3AA 1BJVA 1O3MA 2D2DA 1K28D 1TGBA 2J95A 2WPMS 1P2NA 5LGOA 2EEKA 4WMEA 3A82A 3SU3A 1ZOMA 4JYVH 3A84A 3TIUA 1D3QB 3TGJE 2ZFTA 3JZ1B 4FUHA 1D9IA 4K1EA 3MMGA 5EPNA 4JZ1A 1EJNA 1GBLA 4ZXYH 2XC4A 1BBRH 9ESTA 1VR1H 1BUIA 1ELVA 3KQDA 1HYLA 1SGEE 1C2FA 1DANH 1T8NA 1EAUA 4UFEH 5DO4H 2J94A 4A1TA 1C1MA 4NIVA 8GCHG 1DOJA 1O2KA 9LPRA 1NROH 1FAKH 4WMFA 3FP7E 1GJBB 1S83A 2Y5HA 2FTMA 2KAIA 1PJPA 3NKKA 1THPB 3IWMA 2H9TH 2ZGJA 1P04A 3RXOA 2HNTF 3Q77A 2JETC 4BAMB 1ZSLA 3EA8A 1QJ7B 2FTLE 3ZVAA 1TRMA 1NPMA 2BD4A 4TPIZ 3A80A 1CE5A 1EOJA 5IDKA 4Y10E 1DICA 4IN2A 4DJZB 1JIMA 1HJ9A 1C5ZB 1ETTH 2FPZA 1UVOA 3K9XB 2SGFE 1CT2E 2B9LA 1A4WH 3LGUA 4NSVA 3A89A 3VB4A 1BITA 1MKWH 2B0FA 4Y0ZE 3BG4B 2ZCHP 3PMAB 1W10U 1QBOA 2Q6DA 3SOSA 3RXFA 2FIRH 4AG1A 3Q3KA 1DLKB 1FMGA 4KTSA 4NZQA 3RXBA 4ZHMU 4CHAC 4HTCH 5CHAB 3V0XA 5LPFA 1ZR0A 1KXDA 3BTKE 5L30H 2VNTA 3QTVH 2A1DB 1TIOA 2FP7B 1QJ1B 2BY6X 2P3UB 1GDQA 1NO9H 2A4GA 4I33A 4ABGA 1T8OA 1EPTC 3RXIA 1ZRBA 2SGQE 2G81E 3GY3A 3VXFH 5EW1H 2Z3CA 1K1MA 4NIYA 2Z9KA 1ANBA 1KXFA 2VIWA 4AFSA 1AMHA 4GHTA 1O30A 3MO9A 1GPZA 1QBNA 3BN9A 3RXSA 2Z94A 3H7OA 3QWCH 3HKJB 4LZ4B 3E3TA 4XBBA 1W11U 2RA3A 1M9UA 2FO9A 2ZU1A 4A5TS 1C5XB 1KY9A 3IG6B 2Z9GA 1GBKA 2A4OA 1FZZA 1NT1A 3MFJA 2NU3E 1BHXF 4BTUB 1INCA 1RS0A 2XBWA 4ZKSU 1P9SA 1B5GH 3EE0B 4JK6A 1C9TA 1D6RA 1GMHG 1P2QA 4K1SA 5FAHA 3L33A 5F6MA 1BQYA 3GY2A 4MG3A 1QNJA 2A45B 1O2OA 1VITH 2BB4A 1K21H 2PKAB 2XNIA 2ZU4A 1BTHH 1C4Y2 1GGDC 1J15A 3QN7A 3ZZ6A 1TX7A 1DWBH 4BXSA 2WPHS 1P57B 4NG9H 1C1WH 1HAHH 4CH2B 4O97A 3P6ZB 3RXGA 4AG2A 4ISOA 1GMCG 2OBOA 3BV9B 2RA0A 2QV1A 1V2VT 4DIIH 1P12E 3EAJA 2B5TB 1E35B 2BZAA 2FX6A 3W95A 4YTAA 1CGJE 1C9PA 1O2HA 2C90B 4FUCA 2R3UA 4IN1A 4ABJA 3QUMP 2K7XA 2BLQA 2FEQH 5JYIA 3TH2H 1EXFA 2G5NA 3SNBA 1L4ZA 2XBVA 2ULLA 4OS7A 3EA9A 3P95A 1EASA 1NFYA 3MO6A 1N6YA 4TWWA 1GHBF 2FM2A 4CR5A 5JBTA 2AERH 2OUAA 1EZUC 1V2PT 2VIVA 3Q3XA 4X2WA 1C5QA 4M7GA 2AS9A 3D65E 3MWIU 1AFQC 3RXUA 3LDXH 1HCGA 4JK5A 3ITIA 1MTWA 1UTNA 1P3EA 2WINI 3NPSA 4UEHH 1A61H 1TQ7B 3TH4H 1ZRKA 2BDCA 5F03A 1O2PA 1V2MT 3M3SA 4PROA 1A1RA 1EAXA 1HAVA 4WJG2 1GVZA 3SV9A 1O2TA 1S0QA 2ZGHA 5ESBA 3ZYDA 3C1KA 3P8FA 6LPRA 2CJIA 2ZCLP 2FI5E 3U1IB 2ZHEH 1QHRB 3VGCC 3SNAA 2F9PA 4Q7YA 1F5RA 7KMEH 2KAIB 1G3EA 1LPKB 3STIA 2C8WB 1KXEA 1FQ3A 3EGKH 2XYAA 1GI2A 1W7XH 2H9HA 1P3CA 2ZTXA 4FU9A 1JOUB 1QB1A 1FIWA 1WCZA 4LOYH 3A7XA 1C5YB 3AW1A 2PWXA 2ZU5A 1P11E 3SW2B 2PV9B 3A8CA 1YPJH 3V13A 1S85A 1Z8IB 1OWEA 5T6GA 4NSYA 5HYOA 1V2JT 1W8BH 2G51A 1PFXC 2VVUA 3RXRA 4F49A 4RKJB 2FYQA 2QXHA 1SGDE 3PLPA 3MH6A 2GCTC 1LCYA 1GJ8B 1OPHB 2P59A 5BPEA 4OGYA 2FOHA 3QTOH 3F9GA 1QA7A 2Y5FA 4B2AA 3O8RA 2BY9X 4FXGH 3UNRA 1LVBA 3LKWA 1PPHE 3M7QA 4JZEH 3SHCH 1QBVH 2QY0B 1IQIA 1GI5A 2BXUH 3LC3A 1O33A 1OS8A 1VCWA 1W13U 1YGCH 3SJOA 1V2WT 1MBQA 3BIVH 2WPJS 3DD2H 1LKBA 4J1YA 5T6FA 1C1UH 4AYVB 1F0SA 4NWKA 3VPKA 1FUJA 1MU8B 3G01A 3T62A 1NRQH 1O36A 3TK5A 3V7TA 1BZXE 1O2UA 2OXSA 2AGEX 3GISB 3RU4E 4AGJA 5G4BA 3RC4A 3H5CB 1MH0A 4XSKU 1ELCA 2OC7A 1MAXA 1HAXB 1Y8TA 1GHVH 3PMBB 5GDSH 4BAHB 2GD4B 3KF2A 2A2XH 4JZFH 8KME2 2BY8X 3LGYA 2ZPQA 1GMCF 4I8KA 2XWBI 2BXTH 5B6OA 1X7AC 1N8OB 2PUXB 1FJSA 3UNQA 1C2IA 3UQOA 3SUEA 1GHYH 1FPCH 1TAWA 1S0RA 4FUIA 1ZSJA 1EUFA 7LPRA 2OQ5A 4BAKB 4A7IB 2H6MA 3RXPA 2TBSA 2QC2A 2ZFSA 1LTOA 3SV7A 4MPXA 2ZGXH 1DX5M 3DUXH 3SORA 2ZDMA 2ZFPH 1GG6B 3ZZDA 1G3CA 1QIXB 2WV4A 4H42U 1V2NT 1HGTH 1YCPM 2TGTA 1RJXB 3BG4C 1FIZA 2JKHA 2A7HA 1RTLA 1J8AA 1CSOE 4FU8A 1C5OH 3NXPA 1FAXA 1MQ6A 3PROA 2DUCA 2OC8A 4CREA 3MH5A 2XWAA 1C5RA 4X1QU 1TONA 2JH0D 1Z71A 1Y3UA 4AZ2B 2ZZUH 5CHAC 3UTUH 1BB0B 1FY3A 4WMDA 3ZZ5A 1AU8A 1YPHC 1C1QA 1DXPA 2AMDA 3M5LA 2ZPRA 1W7GH 1UTQA 1MCVA 1DUAA 4LXBH 3MO3A 1ZHPA 2HLCA 2ZDVH 3ZVGA 3NK8A 1DPOA 4OS1A 1SR5C 3Q3YA 3GDSA 4XOJA 3DHKH 2C93B 1YCPK 1C5NH 3ZZBA 4WWYA 1SVPA 4AFQA 1KDQB 1TB6H 2XBXA 4GSOA 1C2EA 1O35A 4CH8B 1GBIA 1HAPH 2VIOA 1BMNH 1TNLA 2W5EA 3RXJA 1AWHB 2NWNA 2W7UA 4TWYA 5A2MH 1BHXB 1HAVB 1FLEE 1RTFB 2ANKH 3SUGA 3ZVBA 4CRBA 1LQEA 1SHHB 2PTNA 1HUTH 2UUYA 1PYTD 1Q3XA 1Y59T 1H9LB 1GCTB 1XUJA 2FESH 2BD8A 4Q7ZA 4YO9A 4SGAE 4Y79A 4CBNA 3P8GA 1OOKB 2ZC9H 1AIXH 5EGMA 1SC8U 4YESB 2VWLA 1YP9A 4D76A 5TCCA 3TGKE 1O3BA 1DT2A 1IQGA 2QF3A 5LPEA 1VZQH 1BMMH 1D4PB 3NCLA 2QGRA 4NA7A 3NZIA 4XE4A 1UTOA 1XUFA 2Z9LA 1SGFG 3FZZA 1C2JA 2CV3A 4Y0YE 1DDJA 1JXPA 3ESTA 2WPKS 2O8TA 3RMMH 3UQVA 4I8GA 2PKSB 2ZGBH 1UO6A 1IHTH 4YOJA 1KXAA 2XC5A 4IMQA 3MTYA 1ELEE 1OSSA 1LDTT 2GZ9A 3SNDA 2UWPA 5I46H 1NZQH 1F0UA 2Y7XA 2D1JA 4I8HA 1G2MA 4HFPB 1B7XB 3KGPA 2K1QA 3AASA 4A1XA 4ASHA 4YLUA 3HATH 3RMNH 3QZQA 4O03A 1O2WA 4KKDA 1UJ1A 1LPGB 2F9UA 1C5UA 3TJOA 5A8YA 1IQMA 1UK4A 1TRNA 2ZKSA 4Q2KA 2ANMH 4MPWA 2BTCE 5EU8A 4DIHH 1ELTA 1AFEH 2GKVE 3ATMA 3RLWH 2XRCA 3RXAA 4X6OA 3FP8E 2ZQ1A 1LHDH 1T31A 1WTHD 1HPGA 1WBGB 1DSUA 1G30B 1BBRK 4X1PU 1F0TA 3BEUA 1XUHA 1GJ5H 2ZHFH 1EAWA 3UIRA 1OP2A 3A7WA 1GBTA 1YPLH 1D3PB 4NZLA 1DY9A 1BDAA 2XC0A 2AMQA 2ESTE 5JB9S 1A0HB 1ETSH 1H8DH 1S84A 1SSXA 4IGDA 2B8OH 2SGPE 3LH1A 4AB9A 1W3CA 1AO5A 2ZG0H 3B9FH 1ETRH 1GBMA 3UOPA 1BCUH 2EI6A 3SQEE 4ABBA 1KIGH 3KQBA 1LHFH 2WYJA 3HGNA 2QIQA 2F9NA 1XX9A 1C2MA 4NFEA 2BLOA 3WY8A 1QRWA 4UONA 1FPHH 1SQAA 3HK6B 3AAUA 2FXRA 3PLKA 1L1GA 3D49H 2ZHWH 1MKWK 4AFZA 4BOHA 5A0CA 4E05H 1E38B 4MDSA 1K9OE 2SGDE 5LH8A 1V2ST 4YT7H 3TNSA 2Z6BD 2QA9E 2H1UA 1FV9A 1XUKA 2PTCE 1GHBG 2A7JA 4BNRA 1NY22 2J4IA 3LT3A 2EI7A 5J4SA 2GT8A 1DUEA 1YF4A 3MOCA 3SJ8A 1P09A 4ZXXH 1TNHA 2F91A 5DP3A 1EKBB 4J2YB 1TX6A 2O8UA 4MQAA 1W0YH 2BOKA 2ASUB 3RU4D 3GY4A 4MTBA 1E36B 1QURH 1SQTA 3LOXA 4WH8A 1K1NA 4CRFA 1RXPA 1MTVA 5C1UA 1ZPBA 1MKXK 3CS7A 5I25A 3VEQB 1A5HA 4Y6DA 2WYGA 1TMTH 2WV5A 2G4TA 2BD9A 4NCYA 3URCA 3ZZ3A 3T2NA 2O9QA 3T27A 1OWJA 1N8OC 1TWXB 4MNY