2GZ7A

Structure-based drug design and structural biology study of novel nonpeptide inhibitors of sars-cov main protease
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title Structure-Based Drug Design and Structural Biology Study of Novel Nonpeptide Inhibitors of Severe Acute Respiratory Syndrome Coronavirus Main Protease
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 84
structure length 306
sequence length 306
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2gz7A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gz7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gz7A02
1CA0C 1AB9B 1OP2A 1O3FA 4KTSA 1G3CA 3QDZB 4JYUH 1NRSH 4Y8YA 4Y7AA 2F9PA 1GBCA 2Z9IA 1QRZA 2K1QA 2VVCA 4ISLA 3S0NA 1CHOG 3GCHB 3HPTB 3U1JB 4OS7A 8KME2 3E0NB 3TK6A 1QJ7B 3RMMH 2ALPA 1EJNA 1AE8H 4DG4A 1QA7A 4MNWA 2BDAA 2PKSB 3LJOA 1GI1A 2H9TH 3NKKA 4I8HA 3MFJA 2BY7X 1JIMA 4XBBA 3KIDU 3VXEH 3SNAA 2J2UA 3Q76A 3UY9A 1P8VC 1G30B 1ZSLA 2F9NA 1TMUH 1TB6H 4AORA 1O3PB 2F83A 2ZZUH 1VGCB 1TGNA 3SW2B 1XUGA 2WINI 2HGTH 3MH7A 4XBDA 5F8TA 1D4PB 1C5YB 3TK5A 1A1RA 1LPZB 1AHTH 1PYTC 2ZFPH 3A84A 4U32A 4BTUB 1C4V2 1SGEE 4K1TA 1BTWA 1D3PB 2ALVA 2FO9A 1O2KA 2H5CA 5AF9H 4K1SA 1F5LA 2BD7A 1ZOMA 1GGDB 4XDEA 5EXMA 7KMEH 2WV4A 8GCHF 1GI4A 1A3EH 1GMHF 2EI7A 4JCNA 5CHAC 1ZPCA 1SR5C 1V6DA 1O5AB 2BDIA 1EB2A 2O8WA 3LH1A 3P70B 1CU1A 2HALA 1GHWH 4Q7XA 1J14A 1HUTH 1CGHA 4QT8C 1O2VA 1O2OA 1AB9C 3N7OA 5CMXH 1TRYA 4ABFA 2YNAA 2A1DB 3I29A 1BTUA 4GLYA 1SGPE 3KCGH 1Z8IB 1FDPA 2PTCE 4NGAH 1YPKH 1DM4B 1MTVA 3GCHC 2GCHG 3U8OH 3UNQA 1HCGA 1UCYE 3SQEE 1EZXC 5DP8A 2G55A 4R8TB 5TCCA 4B71A 2BD4A 1O2TA 1QURH 1TNIA 1TOCB 3TIUA 4K60A 1V2WT 2FPZA 3S7HB 2G5VA 1CSOE 1PFXC 2FYRA 4DT7B 4X8VH 2B7DH 2ZTZA 3AAUA 4X2WA 3SGBE 3G01A 1YPGH 4E7RG 4FUIA 1K1OA 2GV6A 2VVUA 1C4Y2 3F1SB 3UOUA 5ESTE 2ZDNA 3Q00A 2PUXB 5LH8A 3K6YA 4NCYA 1JMOH 2AEIH 2BDBA 3VPKA 4ABBA 1OOKB 1AGJA 2FOBA 2XBYA 4ZKNU 5EW1H 4Y71A 1TALA 3GY7A 3RXPA 4BAQB 1UCYH 3NXPA 3AW1A 4CBNA 2ZCKP 3SQHE 4IC5A 2KAIB 2HVXA 3UUZA 5FPTA 3PV4A 5JBTA 1KXBA 2BQ6B 4I8KA 1GI6A 1LKBA 1IHSH 1HAOH 6CHAC 2Q6FA 4MPWA 1C5TA 1KYNA 3DA9B 4DGJA 1NRPH 1MD7A 1V2RT 3RMLH 1O5GH 1MCTA 2GKVE 4THNH 2ZU1A 2BOKA 5ETXA 2WV5A 2FYQA 1P06A 2CHAC 4Y76A 1VITF 1MTNB 5DP5A 3SU0A 1TX6A 3TGKE 2SGQE 1GJ5H 1HAIH 1SOTA 3SV9A 3TK9A 3ZYDA 1YP9A 2C8ZB 1TPPA 2A2XH 1ANEA 4Z6AH 1YPJH 3RXFA 1C5ZB 4NFFA 5EQQA 3M3TA 1DXPA 1PPFE 4A1TA 5FX5A 1ZJDA 3M61U 1D9IA 2ESTE 1O2XA 3QGNB 3SORA 1V2VT 2XXLA 1GMDF 3V12A 5T6GA 2ZHEH 1SLWB 2FP7B 2VVVA 2FX4A 2XW9A 5AFZH 1LDTT 1VCWA 4GCHG 1ABIH 4AG1A 1IOEA 1FMGA 1Q3XA 5PTPA 1PPCE 2IN2A 6ESTA 1NFXA 1D3TB 1S0RA 3KHVA 1GJ8B 1A0LA 1YYY1 3EDXB 2LPRA 3GDSA 4KP0A 1B0FA 2FESH 3JZ1B 1QL9A 1BB0B 2P93A 4X1QU 2BY8X 3M5NA 1ORFA 1W0ZU 4IGDA 1QGFA 4UFGH 3F6UH 3EQ0H 1ZTKA 1XUIA 3ATLA 4A1VA 1PYTD 1O2ZA 2FOGA 2B0FA 3P8NA 1O5CB 2Z9GA 2ZDKA 1C9PA 1GI5A 2C8WB 1QL7A 1CGIE 2BLQA 1K1NA 4FUDA 1ANBA 4YLUA 4UD9H 1DSTA 2ODPA 3GY8A 1BQYA 2YOLA 1F0TA 3H7TA 3Q3YA 1HAVA 1ANCA 1Y8TA 4D7GA 3HGPA 1FJSA 1B5GH 2PR3A 4D7FA 1GI2A 2QN5T 4KGAA 4X8UH 1G36A 1O31A 2HNTE 3KGPA 2R9PA 3UR6A 3ZZ8A 3EA9A 1GDUA 1LHFH 2PFEA 3HK6B 4RKJB 2IPHA 1YPEH 4X1NU 4X2YA 2OCVB 3B8JA 3SJKA 4E06H 1E35B 1UVPA 2V3OH 1C4U2 1NRRH 4NSYA 4ZHMU 1EASA 4Y0ZE 2BTCE 1T4UH 1IQNA 1C2LA 1UTPA 3SNDA 1YC0A 5FCRA 1GI7B 1O39A 2IJOB 2ZU5A 1C1SA 2P59A 1QBNA 5EXNA 4AG2A 1MH0A 1QCPA 3ZZ3A 4E05H 3U69H 1ZPBA 4NIWA 2PKAB 1CBWB 1ZLRA 2B5TB 3ZZ9A 1GBJA 1JRSA 4KTUA 1AFQC 3OY6U 1SOZA 3DFJA 4JK6A 1IQFA 1Y3YA 2HLCA 1AD8H 3RXGA 1NS3A 1T4VH 5DP3A 1O2RA 3FANA 3S9BA 1RS0A 3OU0A 1KTSB 1C5LH 4FXGH 1EJMA 4U2WA 6LPRA 4UFFH 2RA3A 4F4OC 5JDUB 2TGDA 3RM0H 1V2MT 2FLRH 3BG4B 3FP8E 3BTME 1E38B 5GWZA 2QY0B 1DLEA 1HNEE 3MO6A 3MWIU 1MKXH 3VB7A 1P03A 2A4OA 2ZA5A 1AUTC 2FODA 2OC0A 3FVFB 3AVZA 2GTBA 1PPHE 1BDAA 1RIWC 1SGTA 2ZNKH 4X8SH 5DO4H 4JZDH 1A5HA 3SV7A 5HM9A 5LGOA 4UE7H 1LHDH 3LGYA 1TAWA 5GPIB 1DT2A 1EZQA 1GJ7B 1QB1A 1ZTJA 2GD4B 1RTKA 2VH0A 2ZTYA 3VB3A 2BYAX 3A7VA 4ISIH 1MCVA 2M5TA 1LMWB 2XC0A 1LHEH 1KLIH 1O3EA 1LPKB 3ZZ7A 1DANH 1DX5M 1SSXA 1FPCH 1X7AC 1HGTH 5C3NA 1EPTA 1GI0A 4X6NA 5TCAA 4CRBA 3SU1A 1P2OA 1BCUH 5DG6A 2O8LA 3A7YA 4I8LA 1W2KH 1RFNA 2EC9H 4WXIA 4HTCH 3RU4D 1YPLH 4AFSA 4I33A 1EKBB 3PB1E 4FUJA 1TE0A 1CHOF 1P09A 1C1OA 1D3QB 3KQEA 2XRCA 5F6MA 1VR1H 3Q3XA 1NC6A 2QV1A 1CT4E 2BVXH 3ZV9A 1JOUB 3RXKA 1XX9A 3T27A 1NTPA 1OPHB 2FOMB 1C5MD 1UHBA 2I6SA 4B73A 1W7XH 1A2CH 4B75A 2W26A 3T28A 5GIBA 4NA7A 1EXFA 3ZZBA 3RXSA 3EA7A 3B9FH 1KLJH 1PPEE 2DE9A 2FLBH 2WYJA 2XBVA 2D8WA 3P6ZB 3UFAA 1O34A 2NU3E 2R3YA 1CGJE 1Y3VA 1L1GA 3E3TA 1D6RA 3RXUA 2Y7ZA 3VGCB 5DK1A 1GBLA 4B74A 2HPQH 1XM1A 3FAOA 4WVPE 1VCPA 3A88A 2VGCB 2ZGHA 2FX6A 2C90B 2RG3A 4UFDH 3M37A 2ZHWH 2Y6TA 1P2IA 4TYDA 5E0GA 1OWEA 3OYPA 3M3VA 3M7QA 2BZAA 4YTAA 3A7TA 2YNBA 1AKSA 4XE4A 5DKMA 1S81A 2CN0H 1O3MA 1C2MA 2G00A 2BM2A 1W11U 3OSYA 1YPHC 4X2XA 5EQRA 1FY8E 3UTUH 2TBSA 2VWNA 2ZFRH 3GY6A 4NFEA 2GCHF 3GICB 5J4SA 3SOSA 4ABEA 2VU8E 2Q1JA 3VB4A 2CV3A 2Z6BD 1CHGA 4FUFA 1C5XB 1OYQA 3MNCA 1BOQA 1JRTA 1SG8B 1EQ9A 5DGJA 2UWPA 3SBKA 1O33A 4IMZA 4YOIA 2H6MA 1QRXA 3PLKA 2IOTA 3AAVA 3MNBA 2A4GA 4ISOA 3D65E 3QK1A 1J16A 5TJXA 4BNRA 2B9LA 1K1PA 4WF8A 1VZQH 1AI8H 3BSQA 1O0DH 1T8OA 2ZQ1A 4B2BA 1S84A 3TITA 1W8BH 5GCHG 2BX3A 4Y8ZA 1LVBA 4AYYB 5A09A 2SGEE 1P05A 2VGCC 1GHAF 3KEEA 1DWCH 2ZGJA 2A5IA 1ID5H 1DWEH 2RA0A 1DY8A 4O9VA 5EXLA 1QB6A 1UCYK 3RM2H 3ESTA 3PROA 3CP7A 3BTQE 2BQWB 1EJAA 2ZPRA 1BTPA 1T8LA 1IQLA 1DICA 2QF0A 4Y8XA 5JB8S 3BEUA 1EAWA 3LT3A 2D26C 1HYLA 4B1TA 1TPOA 1GMCG 3CENA 3GOVB 5JB9S 4B76A 5LPFA 1ZPZA 1GG6C 2QXJA 4CREA 3EAJA 5A0BA 4X0WU 1YKTA 3TPIZ 3E90B 2ZDLA 4ZAEA 2QCYA 5JBCS 3PWBA 1EB1H 4INLA 1GCTB 4X1PU 5FXLA 1NY22 4MLFB 3M35A 1BRUP 1QY6A 2XBWA 2RDLA 4UDWH 3BEIB 3A81A 1SVPA 4WMEA 4LXBH 1JIRA 4MNYA 3OY5U 1Z71A 2F9OA 3GCNA 1E37B 5F8ZA 3AW0A 1KDQB 3QZQA 3A8DA 2QAAA 1O5BB 2ZP0H 1Y3WA 5E2OA 1HAVB 4OS6A 2JETC 4DIIH 3O8CA 3I77A 1HRTH 2J38A 1TWXB 3P17H 8ESTE 2BLWA 1UTNA 1C2DA 1CT0E 4NIVA 1BZXE 3ZZAA 1Z6EA 2Z3CA 1AVGH 1ZRKA 1PQ7A 4JYVH 2ZGCA 1BJUA 1OWJA 2P8OB 3PLPA 2G4TA 2AERH 1NPMA 1HJAB 1PPZA 1ELCA 2BY9X 3O8DA 4BAMB 1BUIA 3F9EA 4HFPB 1AE5A 1GL1A 3A82A 3F9FA 4H4FA 1TGBA 3BV9B 1O5EH 3A80A 4J2YB 2PTNA 1DUEA 1EATA 4CH2B 1XKBC 2H9EH 2PSYA 5FCKA 4NIYA 2W3KA 2P3UB 1SGYE 3TGIE 5FX6A 1TX8A 1ELTA 3JZ2B 2VIVA 3PO1C 3KF2A 4AN7A 2ZKSA 1ZHMA 1T31A 1QNJA 1GL0E 1HB0B 2PUQH 1AQ7A 4KELA 1C1QA 2XNIA 4ABIA 1QQUA 1EUFA 3BN9A 3SGQE 1BTYA 4R0IA 1MAXA 2OC7A 1BMLA 1ELVA 7LPRA 1BMNH 4XFQA 1G3EA 4NG9H 2UWOA 3K6ZA 4ABAA 1DPOA 1THRH 5C67A 1G2LA 3RLYH 1THPB 3U8RH 1MTSA 1LHCH 2ILNA 4AYVB 4ZHAA 2G52A 2BDCA 3ZVAA 4BAKB 1MZDA 1TMBH 1TNKA 1QBOA 4TWYA 2HOBA 2Y5FA 2ZFQH 1N8OB 1V2JT 2BD5A 2VINA 2H2ZA 2PKSC 1TNLA 2PHBA 5FPSA 1BHXF 2OTVA 1V2LT 1FI8A 2QYIA 1ETTH 1A46H 3FZDA 4Q7YA 3LGVA 3SNCA 2ZTXA 1TOMH 1VGCC 2XC5A 2SFAA 1ZSKA 5C20A 3MU4A 1OP0A 3SU6A 1AIXH 1GBTA 1O3HA 1GJBB 2Y5GA 1O5FH 1GVKB 1C1MA 3E91A 4FU7A 1OWKA 4AB9A 1WUNH 2BD8A 4WH6A 4Y11E 2THFB 1GGDC 1YLDA 1MKXK 5DP9A 1A7SA 1P04A 2AIPA 4IBLH 1MTWA 1GDQA 1SBWA 2A45B 2FMJA 2SGDE 5EODA 1ZRBA 3KQBA 2AIQA 3ZVGA 3STJA 2XYAA 4DW2U 4VGCB 1T8NA 3QLPH 1TONA 2CJIA 1G2MA 1UTLM 1DUAA 1PPBH 3BIVH 1WQVH 1C2HA 2ZDVH 3EBNA 1ELFA 1TGSZ 4NZLA 2ZPSA 1FQ3A 1IQMA 3TJUA 1XUHA 5K7RA 2BD3A 1ZR0A 4ABDA 5JBBS 3DFLA 5T3HA 4CRDA 2ZEBA 3EA8A 1DWBH 3VXFH 1NFUA 1QJ1B 1J9CH 4BXWA 1C2KA 1SGFA 2ZU2A 7GCHG 1TQ0B 2P95A 1UTKA 2FTLE 2OC8A 3BTTE 2RCEA 1FXYA 1FNIA 4FUHA 2AMDA 3R0FA 1BBRE 1GI3A 3SJ9A 3ZZDA 4D9RA 1IHTH 4O03A 5FAHA 1GBDA 1BMAA 1YBWA 1RXPA 1TPSA 1GJ9B 1MUEB 4BTTB 1MAYA 3BTGE 1MQ6A 1O30A 1G9IE 1GHXH 1DFPA 1AKSB 4Q2KA 1EAIA 1PQ5A 1ETRH 5DP4A 1HAZB 2UUFB 3L33A 1JXPA 2I6QA 1NM6A 4HZHA 5IYTA 1AUJA 1GCDA 1LPGB 2AFQB 1FLEE 2ZGXH 1Z1JA 4RSPA 1QB9A 2QXGA 4I8GA 2J92A 3A7WA 2FOHA 3SUEA 5DPAA 1V2TT 1C5WB 5GJ4B 4K1EA 1BBRH 3EYDA 1THSH 2GDEH 3ZYEA 4WXVA 4VGCC 5L30H 5A8XA 2OXSA 2ZU3A 1EOLA 1TBRH 4K8BA 1BIOA 5JYIA 3PMHB 1DDJA 2AYWA 5E0HA 4OGYA 3SV6A 1K21H 2F9VA 1O3GA 3T26A 2A4RA 2VIOA 1HDTH 1GI8B 1RTLA 1MTNC 1SGNE 1PJPA 4UONA 1XVOA 1V2ST 1TGTA 3SNBA 4K8YA 2NU0E 1ZHPA 2V6NA 1MBQA 3GISB 1KXEA 3UNSA 1TIOA 1HAPH 3A8AA 1AY6H 2GDDA 2NU1E 1TNHA 1K22H 1N6XA 4TY7A 4YT7H 1O2NA 1OKXA 2BXUH 1YLCA 2BY6X 3KL6A 2GCTB 4H42U 2ZU4A 1O38A 2TGPZ 3A89A 1PQAA 2FOEA 1OXGA 1MKWH 1S5SA 5AHGH 1F5RA 1NU9A 1BTXA 2G8TA 3MTYA 3PYHA 3RXVA 2GX4A 2O8TA 1H9HE 2HRVA 1HLTH 5G4BA 1V3XA 2SGAA 1K1IA 3DD2H 1VJAU 2FTMA 3EGKH 1ABJH 4BAHB 2J94A 3ODDA 1MQ5A 5FPYA 5GCHF 1WYKA 4Y79A 1GBFA 1HIAB 1ESTA 4CHAB 5EGMA 2HNTC 4ASHA 5FBIA 3GCTG 1F0SA 5SGAE 1NESE 3RXLA 2STBE 4I7YH 2DUCA 1T7CA 4CRAA 1O35A 5H4IB 2A7HA 4A6LA 5A2MH 1HPGA 3SV2H 3C1KA 3HATH 1SLUB 1V2UT 3KN2A 1UTJA 2ZHQH 4RN6A 1Y5BT 1C5VA 3BTDE 1K2I1 3BF6H 1O2HA 1GMCF 1O3CA 2CMYA 4X6PA 1SB1H 5F8XA 2STAE 2Z94A 1GJ6A 4O3TA 2WPMS 4PROA 3ZVEA 3DT0H 3CS7A 1CVWH 1WV7H 1P2QA 4D76A 1TFXA 5JBAS 4X2VA 2ZF0H 2R0LA 2ANWA 2GP9B 2EA3A 4Q7ZA 2WUCA 1BJVA 3P92A 1G32B 1O2QA 3PMAB 1S82A 2EI8A 2VWLA 4NA9H 3S9CA 1NFYA 3SHAH 1GHBG 2ZHFH 2EI6A 3RLWH 1SMFE 4B2AA 4A92A 4OGXA 2FS9A 1XUJA 3O8BA 1EAUA 4H6SB 1GJCB 1MBMA 3R3GB 4GHTA 3LGTA 1DOJA 1GJAB 1QR3E 2PW8H 2A2QH 2WYGA 3E0PB 3GY2A 1FZZA 4NWKA 3SI3H 3MO3A 3QX5H 1CBWC 1DITH 4JYTA 5L6NH 1AO5A 1TRNA 4F49A 2XCNA 3RXDA 3M3SA 1EP5A 3UPEA 2ZFFH 3TJVA 2HWLB 1AN1E 1IQGA 3RC6A 4ISNA 4MPUA 4OS4A 1AMHA 2VIQA 1S85A 4DJZB 1EX3A 3H5CB 3RXRA 2FDAA 1KY9A 1ZJKA 3S9AA 1DE7H 3LPRA 3PM3A 4FUGA 4WJG2 3RU4T 5L2ZH 3SJ8A 2XTTB 2VWOA 2G4UA 4E7NA 3BG4C 1S6FA 2BZ6H 1GWAA 4B2CA 1LKAA 2V3HH 2F91A 4MPVA 3K9XB 3U1IB 4XOJA 3LONA 2CF8H 5I46H 1C1PA 1KXDA 1C2FA 1ESAA 1P12E 1Z7KA 2V0BA 2C3SA 3ATWA 1DVAH 4NSVA 3LOXA 4GSOA 3E8LA 1L4DA 4X1SU 1Y3UA 3NK8A 1Y59T 3QTVH 2DE8A 2AMPA 1SGIB 3LJJA 4TPIZ 3TH4H 1GHYH 4LZ4B 1NO9H 3LC5A 3MMGA 3MU0A 3TLOA 4MNVA 4FUEA 3WY8A 3KNXA 2FOAA 1F0RA 1C2JA 5EPNA 1K1MA 3UQVA 1S0QA 4LK4A 1A5IA 4GPGA 1G3BA 2AGEX 3ITIA 2XWAA 1UVOA 2GMTB 1ARBA 1DLKB 3SO3A 4RKOB 5EU8A 1AWFH 5DJ7A 3ZVFA 3F9GA 1F92A 2OC1A 2Z3EA 1GJDB 2TPIZ 3QN7A 3P8OA 1O3DA 2ZPQA 3LGIA 2GT7A 1YCPH 4WMDA 2Q6GA 2LNCA 1SLXB 3RXEA 1OYTH 1B0EA 5GXPA 1GVZA 1K1JA 3VEQB 3LU9B 3BIUH 2K7XA 2BD2A 3HKIB 4Q80A 1HAGE 2ZFSA 4FU9A 9LPRA 4H6TA 1LVOA 4AZ2B 5EQSA 4D9QA 1RRKA 1GBBA 1SQOA 2ULLA 2Z7FE 4KKDA 1FY5A 1QA0A 1K1LA 3HKJB 4DOQA 3BTKE 2A5KA 3VGCC 4YM9A 3SV8A 1CA0B 1UK4A 1KIGH 1V2PT 1ZMJA 3CS0A 3UIRA 4OS5A 1S83A 3GDVA 1QRWA 3ZV8A 4IS5A 4ZUHA 4YOJA 3RXOA 1NT1A 1O2SA 4AFUA 3V3MA 2JKHA 3M7TA 1ZZZA 3RXQA 1ZGIA 1OX1A 1SQTA 1YPMH 2QGRA 1H8DH 4JZFH 3K65B 4UEHH 1QHRB 3V7TA 1LQDB 2CGAA 1DXWA 1LQEA 1QTFA 3SI4H 1MZAA 1XUKA 4LOYH 1CE5A 1TLDA 2GMTC 1GVLA 1O3BA 2JH5D 4NIXA 2OUAA 2R2WU 4AGJA 2SGFE 3SJOA 2FXRA 2Y81A 1OWIA 1P57B 3PMJA 5C5NA 4U01A 3LC3A 2ZG0H 3Q3KA 3QTOH 1WQSA 4DVAU 7GCHF 7ESTE 3MI4A 3RUOA 1O2LA 3IG6B 4IN2A 1ETSH 1GHZA 3EE0B 1TRMA 4ZMAH 2P3FH 2ZDMA 1TA6A 1C5QA 2Z9LA 3T62A 1K9OE 3BG8A 5BPEA 2A4QA 1N1LA 1D3DB 1TMTH 3VFEA 4SGBE 2J9NA 4ESTE 1FUJA 3LKWA 4GCHF 1C9TA 3UR9A 5CHAB 1UK3A 1FN6A 1HBTH 4AB8A 5B6OA 1H9LB 3NCLA 3U8TH 3MU5A 2GT8A 1N6YA 2QXIA 3DHKH 3PLBA 1O5DH 2HNTF 1RJXB 5T6DA 1WTGH 4WWYA 4XSKU 2BOHB 3ATIA 1W0YH 3E6PH 4AFZA 1W3CA 1W7GH 4DURA 2VIPA 2XCFA 1C1TA 3D23A 3AASA 5HM2A 1C5RA 2GGVB 1IAUA 2QXHA 2WPLS 3GDUA 3UWJH 3D62A 3NUMA 1BBRK 1ELAA 2G51A 1KLTA 3GYMA 1TBZH 1VJ9U 2UUJB 4LZ1H 2AGGX 2FOCA 2JH6D 4HGCA 2FWWA 1LCYA 2FZZA 2JH0D 4NWLA 4ABJA 2PGQB 2BDHA 2FI5E 1LHGH 1SPJA 2NWNA 5C5OA 1W14U 1XKAC 3SU2A 2XBXA 1C1NA 1GCTC 5CE1A 4U30A 4JZ1A 3P8FA 2W5EA 4BTIB 1GBHA 3IWMA 1A0HB 2BVSH 4GVUA 3M5LA 1GHVH 1M9UA 1HAHH 2W7SA 1ZTLA 3RXBA 3FP7E 4FVDA 4BXSA 2ANYA 1GBMA 3LIWA 1MMJN 5IDKA 5LPRA 3RMNH 3Q77A 1O2WA 4BAOB 2FI3E 3E16B 3ZZ6A 4ZKRU 2NU4E 1C1VH 3ZZCA 2PSXA 3GY3A 3A87A 4AOQA 1MKWK 2W7UA 1V2OT 1T32A 2ZCHP 2H5DA 3BTWE 6CHAB 2BDYA 5HYOA 2Y7XA 5A0CA 4MPXA 1GPZA 1TYNA 4IMQA 4ZH8A 2R0KA 3ELAH 2ZWLH 3RXAA 2CXVA 1ESBA 1ZHRA 1C1RA 2P8OC 1SFIA 1IQHA 3MH4A 3GCTF 4FVBA 1A3BH 1HJAC 1P2MA 4ISHH 2CHAB 4SGAE 3RXIA 3GY5A 2UUKB 1C1UH 2H9HA 1EPTB 3SNEA 2ZGBH 2D2DA 3A85A 2PV9B 2ZO3H 3OX7U 1P10A 1Z6JH 3S69A 1UMAH 2VIDA 1J15A 1V2KT 3ZVCA 2F9BH 1O2JA 3W94A 3VB6A 2G81E 1MU6B 3RMOH 3MNXA 2Q6DA 3GYLB 1RTFB 2P16A 2OQUA 1E36B 2XC4A 1H8IH 2FOFA 4MDSA 2B8OH 2PGBB 1O3NA 1Y5UT 1PQ8A 4AGKA 1CO7E 3SGAE 1O3OA 1UHBB 2C4FH 2F3CE 2FI4E 4JZIA 2ZDAH 5JPMH 1FN8A 1Z1IA 1QL8A 1GHBF 1FIWA 3FP6E 3LH3A 1UK2A 1TA2A 2BB4A 1P9UA 1KXAA 4ABGA 1IQKA 5C2ZA 1T8MA 3L6PA 1GHAG 2BDGA 3KQDA 3RU4E 3O8RA 3UQOA 3KQCA 2J34A 1ACBE 2V35A 5EPYA 1IQEA 1F7ZA 1ZMNA 3DUXH 3IITA 1NFWA 4K3JA 1N8OC 1TPAE 1HAXB 2AGIX 1A61H 2FEQH 3PMBB 4CRFA 4INKA 3URCA 3SZNA 1C2IA 3T29A 4YOGA 1F0UA 1W10U 2Y80A 1EOJA 5T6FA 3RDZA 3ZZ5A 3V0XA 2PWXA 3E1XB 1QIXB 1NRNH 4FUBA 3A7XA 1OS8A 1BTZA 2VWMA 4YLQH 1EPTC 3MH6A 1W13U 4AFQA 5HGGA 4BOHA 6GCHG 4YT6H 1FPHH 2CF9H 2A7CA 3P8GA 3M5OA 1SGRE 1NU7B 4KTCA 5E8EH 4M7GA 2BD9A 2OLGA 3ODFA 2O9QA 4CR9A 2WPJS 1SHYA 2WPKS 3QZRA 2TGAA 1AVXA 5E2PA 4YZUA 1HJ8A 1O2UA 1MD8A 2GZ7A 1LO6A 2R2MB 2O8UA 1C5SA 1BA8B 1BRCE 1UO6A 1V2QT 3TU7H 4CR5A 1P02A 3FFGA 1J8AA 4WY3A 5C1XA 1UJ1A 1YCPM 2BQ7B 3LGWA 4K5ZA 4AX9H 1MTUA 2BHGA 4GAWA 4Y0YE 1AFQB 8LPRA 1Z8GA 1TX7A 1LVMA 4J1YA 1YM0A 3UREA 2ZC9H 1OP8A 3RXJA 4ZXXH 3M36A 1ARCA 1DWDH 1H9IE 1O2MA 1TBQH 4ABHA 2SGPE 2D1JA 3GCOA 4A5TS 4YESB 2SNVA 1QJ6B 3MHWU 2J4IA 2OP9A 1UTQA 4ZHLU 4I32A 1KDQA 1EZSC 5F03A 1BRBE 3W95A 1JBUH 1P9SA 1SLVB 3T2NA 2LIZA 4A1XA 2XWBI 5GDSH 1QBVH 1FY4A 5HMAA 1BITA 1BTHH 1O3LA 1RIWB 4IC6A 3L3TA 1H4WA 8GCHG 1GMHG 1TQ7B 1YCPK 1AWHB 2AS9A 4OS1A 3SUGA 3PWCA 5C1YA 1SGCA 2ODQA 3TH3H 2OD3B 3P95A 3MOCA 1GI9B 3LDXH 5J4QA 3STIA 1F5KU 2BLOA 1AFEH 1Z8RA 3HGNA 3ZVBA 2EEKA 1YGCH 3TH2H 1RD3B 1WAYB 1TABE 4Y6DA 2NU2E 1UVSH 3V13A 3PTBA 3NPSA 4GHQA 1A4WH 1FV9A 3BEFB 4FUCA 4GUXA 3C27B 5FBEA 1C2GA 1FY1A 1KTTB 1IQJA 2WPHS 3LGUA 3MU8A 4DY7B 1GJ4H 3QUMP 1L2EA 4Z0KA 3B23B 5FHTA 1W12U 1UVUH 3RC4A 3SU5A 3F68H 1BHXB 2VIWA 2C93B 4DCDA 2GV7A 1D6WA 1MU8B 1NZQH 4X8TH 1HFDA 1CA8B 4A7IB 1INCA 1ELGA 2A7JA 3SN8A 1UTMA 3TJOA 4ZROA 3M7UA 1DSUA 3HK3B 2AMQA 1C5UA 3BTFE 1L1NA 2GCTC 1L0ZA 1ELEE 5DP7A 1ZGVA 5AFYH 2GVFA 2WUBA 4INHA 2VH6A 1HAYB 1H1BA 3RXCA 2TRMA 4ZXYH 3RP2A 5ESBA 1BMMH 2FIRH 1DY9A 1P2KA 1O2PA 3H7OA 3U98H 1CQQA 2ZFTA 4MNXA 5BRRE 1Y3XA 4XBCA 3SU3A 1Y5AT 1C1WH 1OWDA 3ATMA 3NZIA 3MNSA 4IW4E 2Z3DA 3A83A 2ASUB 2VNTA 1KXCA 4UFEH 3RXHA 1GBKA 2VB0A 4CHAC 2ZCLP 1WTHD 5DP6A 4I8JA 1VITG 1ELBA 3SJIA 4JK5A 1Q31A 3TNSA 1O2IA 1C5OH 4NZQA 3TJNA 9ESTA 3UNRA 1P01A 1C5NH 1GBEA 1ELDE 1WU1A 4WH8A 2KAIA 2Z9KA 1XXFA 5E0JA 1E0FD 1TGCA 3MO9A 1QQ4A 1XVMA 2W3IA 2C8YB 1G3DA 1WSSH 1WBGB 2HPPH 1GMDG 1ZSJA 4CH8B 4Y7BA 1BT7A 1FIZA 3SUFA 4BANB 4TPYA 2QC2A 3T25A 4D8NA 2F9UA 1P3CA 4JZEH 4DIHH 2J95A 4X1RU 1BRAA 3K2UA 3S7KB 2UUYA 2ZQ2A 1KXFA 1GDNA 3ZVDA 1YPHE 1HXFH 2UWLA 4Y10E 3MU1A 3PTNA 2H1UA 1UTOA 1FAKH 1J17T 1JWTA 2Y5HA 4JMYA 1TNJA 5L2YH 2BXTH 1FY3A 3RC5A 1QFKH 1C2EA 1A0JA 3BTHE 2SNWA 3SUDA 1E34B 4CBOA 2OQ5A 4CRGA 1F2SE 2A5AA 2ZECA 5C1UA 1L1JA 1IQIA 2FS8A 3UOPA 4NA8A 1SHHB 5EG4A 5AVDA 1HJ9A 2BY5X 2P3TB 4X6OA 1SQAA 1P2NA 2QF3A 3M5MA 4I31A 3MYWA 1O36A 4O97A 2ZI2H 1Q2WA 2P94A 5A0AE 4HI3A 1NN6A 3T5FH 1VITH 1O32A 3QWCH 2ODYB 1AU8A 2PLXA 4FU8A 2ANMH 3OTJE 2ZIQH 1V2NT 1GG6B 4K69A 3QO6A 2O8MA 3VB5A 3ENSB 1GBAA 3A86A 1L4ZA 3RXTA 3TGJE 2G5NA 1C5PA 1PPGE 3GY4A 1GBIA 1ZYOA 3A7ZA 4IN1A 3NWUA 3ZZ4A 3RXMA 1XMNB 1LTOA 1B7XB 1OSSA 2A32A 1AZZA 1SGFG 3TVJB 4TWWA 5A8YA 1EP6A 2AH4X 2VJ1A 1O2YA 1SI5H 1O2GH 1HXEH 3BTEE 1RGQA 5A8ZA 1O3JA 1O3KA 3MH5A 1FAXA 2BVRH 1Z8JB 1TNGA 2OINA 4ZKOU 1HV7A 3F9HA 2FM2A 1EZUC 1NROH 1KSNA 3QGJA 4CRCA 2QIQA 1YF4A 2JETB 1SFQB 1SGQE 1ZMLA 5EOKA 4X6MA 5I25A 4ZKSU 1OWHA 5ABWA 2C8XB 4MVNA 1O37A 3FZZA 1FONA 2OBOA 1O3AA 1P2JA 1WOFA 2GZ8A 4OS2A 1UVTH 2BLVA 3D49H 2BMGB 5LPEA 2ANKH 2ZHDA 2WPIS 2A0QB 3U9AH 5HXFA 2QA9E 5EW2H 5K0HA 1DS2E 4MTBA 4O3UA 1U6QA 3TNTA 1LVYA 1SGDE 1AVWA 1K28D 3A8CA 3ATKA 1EAXA 1G37A 1O3IA 1WCZA 1VCQA 1XUFA 1SL3A 1AZ8A 2TGTA 4K2YA 4WMFA 3A8BA 2PKAA 3SHCH 1P11E 1P3EA 3PO1B 2Z9JA 2A31A 1S6HA 1HIAA 4MG3A 1P0SH 2TIOA 3URDA 6GCHF 4YO9A 2Y82A 2OBQA 1A5GH 1XXDA 4TY6A 2GZ9A 1ANDA 3I78A 2BX4A 1SC8U 1NRQH 2R3UA 1CT2E 3UWIA 3SU4A 4MQAA
chains in the Genus database with same CATH superfamily
1CA0C 1AB9B 1OP2A 1O3FA 4KTSA 1G3CA 3QDZB 4JYUH 1NRSH 4ACAA 4Y8YA 4Y7AA 2F9PA 1GBCA 2Z9IA 1QRZA 2K1QA 2VVCA 4ISLA 3S0NA 1CHOG 3GCHB 3HPTB 3U1JB 4OS7A 8KME2 3E0NB 3TK6A 1QJ7B 3RMMH 2ALPA 1EJNA 5KECA 1AE8H 4DG4A 1QA7A 4MNWA 2BDAA 2PKSB 3LJOA 1GI1A 2H9TH 3NKKA 4I8HA 3MFJA 2BY7X 1JIMA 4XBBA 3KIDU 3VXEH 3SNAA 2J2UA 3Q76A 3UY9A 1P8VC 1G30B 1ZSLA 2F9NA 1TMUH 1TB6H 4AORA 1O3PB 2F83A 2ZZUH 1VGCB 1TGNA 3SW2B 1XUGA 2WINI 2HGTH 3MH7A 4XBDA 5F8TA 1D4PB 1C5YB 3TK5A 1A1RA 1LPZB 1AHTH 1PYTC 2ZFPH 3A84A 4U32A 4BTUB 1C4V2 1SGEE 4K1TA 1BTWA 1D3PB 2ALVA 2FO9A 1O2KA 2H5CA 5AF9H 4K1SA 1F5LA 2BD7A 1ZOMA 1GGDB 4XDEA 5EXMA 7KMEH 3CNRA 2WV4A 8GCHF 1GI4A 1A3EH 1GMHF 2EI7A 4JCNA 5CHAC 1ZPCA 1SR5C 1V6DA 1O5AB 2BDIA 1EB2A 2O8WA 3LH1A 3P70B 1NBMD 1CU1A 2HALA 1GHWH 4Q7XA 1J14A 1HUTH 1CGHA 4QT8C 3EE7A 1O2VA 1O2OA 1AB9C 3N7OA 5CMXH 1TRYA 4ABFA 2YNAA 2A1DB 3I29A 1BTUA 4GLYA 1VKYA 1SGPE 3KCGH 1Z8IB 1FDPA 2PTCE 4NGAH 1YPKH 3PRDA 1DM4B 1MTVA 3GCHC 2GCHG 3U8OH 2V7QD 3UNQA 1HCGA 1UCYE 3SQEE 1EZXC 5DP8A 2G55A 4R8TB 5TCCA 4B71A 2BD4A 1O2TA 1QURH 1TNIA 1TOCB 2J97A 3TIUA 4K60A 1V2WT 4FOUC 2FPZA 3S7HB 2G5VA 1CSOE 1PFXC 2FYRA 4DT7B 4X8VH 2B7DH 2ZTZA 3AAUA 4X2WA 3SGBE 3G01A 1YPGH 4E7RG 4FUIA 1K1OA 2GV6A 2VVUA 1C4Y2 3F1SB 3UOUA 5ESTE 4DT4A 2ZDNA 3Q00A 2PUXB 5LH8A 3K6YA 4NCYA 1JMOH 2AEIH 2BDBA 3VPKA 4ABBA 3U28C 1OOKB 1AGJA 2FOBA 2XBYA 4ZKNU 4ACBA 5EW1H 4Y71A 1TALA 3GY7A 3RXPA 4BAQB 1UCYH 3NXPA 3AW1A 4CBNA 2ZCKP 3SQHE 4IC5A 2KAIB 2HVXA 3KQ5A 3UUZA 5KEDA 5FPTA 3PV4A 5JBTA 1KXBA 2BQ6B 4I8KA 1GI6A 3N7DA 1LKBA 1IHSH 1HAOH 6CHAC 2Q6FA 2QF5A 4MPWA 1C5TA 1KYNA 3DA9B 4DGJA 1NRPH 1MD7A 1V2RT 3RMLH 1O5GH 1MCTA 2GKVE 4THNH 2ZU1A 2BOKA 5ETXA 2WV5A 2FYQA 1P06A 2AHME 2CHAC 4Y76A 1VITF 1MTNB 5DP5A 3OEED 1TX6A 3SU0A 3TGKE 2SGQE 1GJ5H 1HAIH 1SOTA 3SV9A 3TK9A 3ZYDA 3MQKC 4RT0A 1YP9A 2C8ZB 1TPPA 2A2XH 1ANEA 4Z6AH 1YPJH 3RXFA 1C5ZB 4NFFA 5EQQA 2QF4A 3M3TA 1DXPA 1PPFE 4A1TA 5FX5A 1ZJDA 3M61U 1D9IA 2ESTE 1O2XA 3QGNB 3SORA 1V2VT 2XXLA 1GMDF 3V12A 5T6GA 2ZHEH 1SLWB 2FP7B 2VVVA 2FX4A 2XW9A 5AFZH 1LDTT 1VCWA 4GCHG 1ABIH 4AG1A 1IOEA 1FMGA 1Q3XA 5PTPA 1PPCE 2IN2A 6ESTA 2WPDD 1NFXA 1D3TB 1S0RA 3KHVA 1GJ8B 1A0LA 1YYY1 3EDXB 2LPRA 3GDSA 4KP0A 1B0FA 2FESH 3JZ1B 1QL9A 1BB0B 2P93A 4X1QU 2BY8X 3M5NA 2WHXA 1ORFA 1W0ZU 4IGDA 1QGFA 4UFGH 3FN8A 3F6UH 3EQ0H 1ZTKA 1XUIA 3ATLA 4A1VA 1PYTD 1O2ZA 2FOGA 2B0FA 3P8NA 1O5CB 2Z9GA 2ZDKA 1C9PA 1GI5A 2RDEA 2C8WB 1QL7A 1CGIE 2BLQA 4ZCNA 1K1NA 4FUDA 1ANBA 3UB0A 4YLUA 4UD9H 1DSTA 2ODPA 3GY8A 1BQYA 2YOLA 1F0TA 3H7TA 3Q3YA 1HAVA 1ANCA 1Y8TA 5FL7D 4D7GA 3HGPA 1FJSA 1B5GH 2PR3A 4D7FA 1GI2A 2QN5T 4KGAA 4X8UH 1G36A 1O31A 2HNTE 3KGPA 2R9PA 3UR6A 3ZZ8A 3EA9A 1GDUA 1LHFH 2PFEA 3HK6B 4RKJB 2IPHA 1YPEH 4X1NU 4X2YA 2OCVB 3B8JA 3SJKA 4E06H 1E35B 1UVPA 2V3OH 1C4U2 1NRRH 4NSYA 4ZHMU 1EASA 4Y0ZE 2BTCE 1T4UH 1IQNA 1C2LA 1UTPA 3SNDA 1YC0A 5FCRA 1GI7B 1FX0B 1O39A 2IJOB 2ZU5A 5B6LA 1C1SA 2P59A 1QBNA 5EXNA 4AG2A 1MH0A 1QCPA 3ZZ3A 4E05H 3U69H 1ZPBA 4NIWA 2PKAB 1CBWB 1ZLRA 2B5TB 3ZZ9A 1GBJA 1JRSA 4KTUA 1AFQC 3OY6U 1YY3A 1SOZA 3DFJA 4JK6A 1IQFA 1Y3YA 2HLCA 1AD8H 3RXGA 1NS3A 1T4VH 5DP3A 1O2RA 3FANA 4XD7D 3S9BA 1RS0A 3OU0A 1KTSB 1C5LH 4FXGH 1EJMA 4U2WA 6LPRA 4UFFH 2RA3A 4F4OC 5JDUB 2TGDA 3RM0H 1V2MT 2FLRH 3BG4B 3FP8E 3NRLA 3BTME 1E38B 5GWZA 2JDID 2QY0B 1DLEA 1HNEE 3MO6A 3MWIU 1MKXH 3VB7A 1P03A 2A4OA 2ZA5A 1AUTC 2FODA 2OC0A 3FVFB 3AVZA 2GTBA 1PPHE 1BDAA 1RIWC 1SGTA 2ZNKH 4X8SH 5DO4H 4JZDH 1A5HA 3SV7A 5HM9A 5LGOA 4UE7H 1LHDH 3LGYA 1TAWA 3PV2A 5GPIB 1DT2A 1EZQA 2YMSC 1GJ7B 1QB1A 1ZTJA 2GD4B 1RTKA 2VH0A 2ZTYA 5C0UA 3VB3A 2BYAX 3A7VA 4ISIH 1MCVA 2M5TA 1LMWB 2XC0A 1LHEH 1KLIH 1O3EA 1LPKB 3ZZ7A 1DANH 1DX5M 1SSXA 2F43B 1FPCH 1X7AC 1HGTH 5C3NA 1EPTA 1GI0A 4X6NA 5TCAA 4CRBA 3SU1A 1P2OA 1BCUH 5DG6A 2O8LA 3A7YA 4I8LA 1W2KH 1RFNA 2EC9H 4WXIA 4HTCH 3RU4D 1YPLH 3F2HA 4AFSA 2KFWA 4I33A 1EKBB 2K0QA 3PB1E 4FUJA 1TE0A 1CHOF 1P09A 1C1OA 1D3QB 3KQEA 2XRCA 5F6MA 1VR1H 3Q3XA 1NC6A 2QV1A 1CT4E 2BVXH 3ZV9A 1JOUB 3RXKA 1XX9A 3T27A 1NTPA 1OPHB 2FOMB 1C5MD 1UHBA 2I6SA 4B73A 1W7XH 1A2CH 4B75A 2W26A 3T28A 5GIBA 4NA7A 1EXFA 3ZZBA 3RXSA 3EA7A 3B9FH 1KLJH 1PPEE 2DE9A 2FLBH 2WYJA 2XBVA 2D8WA 3P6ZB 3UFAA 1O34A 3F2FA 2NU3E 2R3YA 1CGJE 1Y3VA 1L1GA 3E3TA 1D6RA 3RXUA 2Y7ZA 3VGCB 5DK1A 1GBLA 4B74A 2HPQH 1XM1A 3FAOA 4WVPE 1VCPA 3A88A 2M2AA 2VGCB 2ZGHA 2FX6A 2C90B 2RG3A 2KX4A 4UFDH 3M37A 2ZHWH 2Y6TA 1P2IA 4TYDA 5E0GA 1OWEA 3OYPA 3M3VA 3M7QA 2BZAA 1QZ8A 3A7TA 4YTAA 2YNBA 5HKKD 1AKSA 4XE4A 5DKMA 1S81A 2CN0H 1O3MA 1C2MA 2G00A 2BM2A 1W11U 3OSYA 1YPHC 4X2XA 5EQRA 1FY8E 3UTUH 2TBSA 2VWNA 2ZFRH 3GY6A 4NFEA 2GCHF 3GICB 5J4SA 3SOSA 4ABEA 2VU8E 2Q1JA 3VB4A 2CV3A 2J5UA 2Z6BD 1CHGA 4FUFA 1C5XB 1OYQA 4TSFD 3MNCA 1BOQA 1JRTA 1SG8B 1EQ9A 5DGJA 3VG8A 2UWPA 3SBKA 1O33A 4IMZA 4YOIA 2H6MA 1QRXA 3PLKA 2IOTA 3AAVA 3MNBA 2A4GA 4ISOA 3D65E 3QK1A 1J16A 5TJXA 4BNRA 2B9LA 1K1PA 1H8ED 4WF8A 1VZQH 1E79D 1AI8H 3BSQA 1O0DH 1T8OA 2ZQ1A 4B2BA 1S84A 3TITA 1W8BH 5GCHG 2BX3A 4Y8ZA 1LVBA 4AYYB 5A09A 2SGEE 1P05A 2VGCC 1GHAF 3KEEA 1DWCH 2ZGJA 2A5IA 1ID5H 1DWEH 2RA0A 4OM9A 1DY8A 4O9VA 5EXLA 1QB6A 1UCYK 5EJZA 3RM2H 3ESTA 3PROA 3CP7A 3N99A 3BTQE 3DSOA 2BQWB 1EJAA 2ZPRA 1BTPA 1T8LA 1IQLA 1DICA 2QF0A 4Y8XA 5JB8S 3BEUA 1EAWA 3LT3A 2D26C 1HYLA 2YMSD 4B1TA 1TPOA 1GMCG 3CENA 3GOVB 5JB9S 4B76A 5LPFA 1ZPZA 1GG6C 2QXJA 4CREA 3EAJA 3F0PA 5A0BA 4X0WU 1YKTA 3TPIZ 2KCOA 3E90B 2ZDLA 4ZAEA 3W1EA 2QCYA 5JBCS 3PWBA 1EB1H 4INLA 1GCTB 4X1PU 5FXLA 1NY22 2L74A 3M35A 4MLFB 1BRUP 1QY6A 2XBWA 2RDLA 3DCLA 4FETA 4UDWH 3BEIB 3A81A 1SVPA 4WMEA 4LXBH 1JIRA 4MNYA 3OY5U 1Z71A 2F9OA 3GCNA 1E37B 5F8ZA 3AW0A 1KDQB 3QZQA 3A8DA 2QAAA 1O5BB 2ZP0H 1Y3WA 5E2OA 1HAVB 4OS6A 2JETC 4DIIH 3O8CA 3I77A 1HRTH 2J38A 5C94A 1TWXB 3P17H 8ESTE 2BLWA 1UTNA 1C2DA 1CT0E 4NIVA 1BZXE 2EQNA 3ZZAA 1Z6EA 2Z3CA 1AVGH 1ZRKA 1PQ7A 4JYVH 2ZGCA 1BJUA 1OWJA 2P8OB 3PLPA 2G4TA 2V3MA 2AERH 1NPMA 1HJAB 1PPZA 1ELCA 2BY9X 1E1QD 1WXRA 3O8DA 2LELA 4BAMB 1BUIA 3F9EA 4HFPB 2VBCA 1AE5A 1GL1A 3A82A 3F9FA 4H4FA 1TGBA 3BV9B 1O5EH 3A80A 4J2YB 2PTNA 1DUEA 1EATA 4CH2B 1XKBC 2H9EH 2PSYA 5FCKA 4NIYA 2W3KA 2P3UB 1SGYE 3TGIE 5FX6A 1TX8A 1ELTA 3JZ2B 2VIVA 3PO1C 3KF2A 4AN7A 2ZKSA 1ZHMA 1T31A 1QNJA 1GL0E 1HB0B 2PUQH 1AQ7A 4KELA 1C1QA 2XNIA 3SYJA 4ABIA 1QQUA 1EUFA 3BN9A 4ASUD 3SGQE 1BTYA 4R0IA 1MAXA 2OC7A 1BMLA 1ELVA 7LPRA 1BMNH 4XFQA 1G3EA 4AC9A 4NG9H 2UWOA 3K6ZA 4ABAA 1DPOA 1THRH 5C67A 3F2GA 1G2LA 3RLYH 1THPB 3U8RH 1MTSA 1LHCH 2ILNA 4AYVB 4ZHAA 2G52A 2BDCA 3ZVAA 4BAKB 1MZDA 1TMBH 1TNKA 1QBOA 4TWYA 2HOBA 2Y5FA 2ZFQH 1N8OB 1V2JT 2BD5A 2W6ID 2VINA 2H2ZA 2PKSC 1TNLA 2PHBA 5FPSA 1BHXF 2OTVA 1V2LT 1FI8A 2IPQX 2QYIA 1ETTH 1A46H 3FZDA 4Q7YA 3LGVA 3SNCA 2ZTXA 2JIZD 1TOMH 1VGCC 2XC5A 5GNDA 2SFAA 1ZSKA 5C20A 3MU4A 1OP0A 3SU6A 1AIXH 1GBTA 1O3HA 1GJBB 2Y5GA 3PV5A 1O5FH 1GVKB 1C1MA 3E91A 4FU7A 1OWKA 4AB9A 1WUNH 2BD8A 4WH6A 4Y11E 2THFB 1GGDC 1YLDA 1MKXK 5DP9A 1A7SA 1P04A 2AIPA 4IBLH 1MTWA 1GDQA 1SBWA 2A45B 2FMJA 2SGDE 5EODA 1ZRBA 3KQBA 2AIQA 3ZVGA 3STJA 2XYAA 4DW2U 4VGCB 1T8NA 3QLPH 1TONA 2CJIA 1G2MA 1UTLM 1DUAA 1PPBH 3BIVH 1WQVH 2HVYB 1C2HA 2ZDVH 3EBNA 1ELFA 1TGSZ 4NZLA 2ZPSA 1FQ3A 1IQMA 3TJUA 1XUHA 4F55A 5K7RA 2BD3A 1ZR0A 4ABDA 2J98A 5JBBS 3DFLA 5T3HA 4CRDA 2ZEBA 3EA8A 1DWBH 3VXFH 1NFUA 1QJ1B 1J9CH 2WV9A 4BXWA 1C2KA 2KCPA 1SGFA 2CK3D 2ZU2A 1TQ0B 7GCHG 2P95A 1UTKA 2FTLE 2OC8A 3BTTE 3OE7D 2RCEA 1FXYA 1FNIA 4FUHA 2AMDA 1EFRD 1BBRE 1GI3A 2WZQA 3R0FA 3SJ9A 3ZZDA 4D9RA 1IHTH 4O03A 5FAHA 1GBDA 1BMAA 3WWFA 1YBWA 1RXPA 1TPSA 1GJ9B 1MUEB 4BTTB 1MAYA 3BTGE 1MQ6A 1O30A 1G9IE 1GHXH 1DFPA 1AKSB 4Q2KA 2OK5A 1EAIA 1PQ5A 1ETRH 4RT1A 5DP4A 1HAZB 2UUFB 3L33A 1JXPA 2I6QA 1NM6A 4HZHA 5IYTA 1AUJA 1GCDA 1LPGB 2AFQB 1FLEE 2ZGXH 1Z1JA 4RSPA 1QB9A 2QXGA 4I8GA 2J92A 3A7WA 2FOHA 3SUEA 5DPAA 1V2TT 1C5WB 5GJ4B 4K1EA 1BBRH 3EYDA 1THSH 2GDEH 3ZYEA 4WXVA 4VGCC 5L30H 5A8XA 2OXSA 2ZU3A 1EOLA 1TBRH 4K8BA 1BIOA 5JYIA 3PMHB 1DDJA 2AYWA 5E0HA 4OGYA 3SV6A 1K21H 2F9VA 1O3GA 3T26A 2A4RA 3OFND 2VIOA 1HDTH 1GI8B 1RTLA 1MTNC 1SGNE 1PJPA 4UONA 1XVOA 1V2ST 1TGTA 3SNBA 4K8YA 1WDIA 2NU0E 1ZHPA 2V6NA 1MBQA 3GISB 2LP6A 1KXEA 3UNSA 1TIOA 1HAPH 3A8AA 1AY6H 2GDDA 2NU1E 1TNHA 1K22H 1N6XA 4TY7A 4YT7H 2JJ1D 1O2NA 1OKXA 2BXUH 1YLCA 2BY6X 3KL6A 2GCTB 4H42U 2ZU4A 1O38A 2TGPZ 3A89A 1PQAA 2FOEA 1OXGA 1MKWH 1S5SA 5AHGH 1F5RA 1NU9A 1BTXA 2G8TA 3MTYA 3PYHA 3RXVA 1S6LA 2GX4A 2O8TA 5C17A 1H9HE 2HRVA 1HLTH 5G4BA 1V3XA 2SGAA 1K1IA 3DD2H 1VJAU 2FTMA 3EGKH 1ABJH 4BAHB 2J94A 3ODDA 1MQ5A 5FPYA 5GCHF 1WYKA 4Y79A 1GBFA 1HIAB 1ESTA 4CHAB 5EGMA 2HNTC 4ASHA 3FKSD 5FBIA 3GCTG 1F0SA 5SGAE 1NESE 3RXLA 2STBE 4I7YH 2DUCA 1T7CA 4CRAA 1O35A 5H4IB 2A7HA 4P02A 4A6LA 5A2MH 1HPGA 3SV2H 3C1KA 3HATH 1SLUB 1V2UT 3KN2A 1UTJA 2ZHQH 4RN6A 1Y5BT 1C5VA 3BTDE 1K2I1 3BF6H 1O2HA 1GMCF 2KCAA 1O3CA 1YLNA 2CMYA 1SB1H 4X6PA 5F8XA 2STAE 5C0TA 2Z94A 2EY4C 1GJ6A 4O3TA 2WPMS 4PROA 2JJ2D 3ZVEA 3DT0H 3CS7A 1CVWH 1WV7H 1P2QA 4D76A 1TFXA 5JBAS 3FOAA 4X2VA 2ZF0H 2R0LA 2ANWA 2GP9B 2EA3A 4Q7ZA 2WUCA 1BJVA 3P92A 1G32B 1O2QA 3PMAB 1S82A 2EI8A 2VWLA 4NA9H 3S9CA 1NFYA 3SHAH 1GHBG 2ZHFH 2EI6A 3RLWH 1SMFE 4B2AA 4A92A 4OGXA 2FS9A 1XUJA 3O8BA 1EAUA 4H6SB 1GJCB 1MBMA 3R3GB 4GHTA 3LGTA 1DOJA 1GJAB 1QR3E 2PW8H 2A2QH 2WYGA 3E0PB 3GY2A 1FZZA 4HG6A 4NWKA 3SI3H 3MO3A 2HLDD 3QX5H 1CBWC 1DITH 4JYTA 5L6NH 1AO5A 1TRNA 4F49A 2XCNA 3RXDA 3M3SA 1EP5A 3UPEA 2KM0A 2ZFFH 3TJVA 2HWLB 1AN1E 1IQGA 3RC6A 4ISNA 4MPUA 4OS4A 1AMHA 2VIQA 1S85A 4DJZB 1EX3A 3H5CB 5EJLA 2FDAA 3RXRA 1KY9A 1ZJKA 3KYFA 3S9AA 1DE7H 3LPRA 3PM3A 4FUGA 4WJG2 3RU4T 5L2ZH 3SJ8A 2XTTB 2VWOA 2G4UA 4E7NA 3BG4C 1S6FA 2BZ6H 1GWAA 4B2CA 1LKAA 2V3HH 2F91A 4MPVA 3K9XB 3U1IB 4XOJA 3LONA 2RFKC 2CF8H 5I46H 1C1PA 1KXDA 1C2FA 1ESAA 1P12E 1Z7KA 2V0BA 2C3SA 3ATWA 1DVAH 4NSVA 3LOXA 4GSOA 3E8LA 1L4DA 4X1SU 1K0HA 1Y3UA 3NK8A 1Y59T 3QTVH 2DE8A 2AMPA 1SGIB 2KCYA 3LJJA 4TPIZ 3TH4H 1GHYH 4LZ4B 1NO9H 3LC5A 1COWD 3MMGA 3MU0A 3TLOA 1W0KD 4FUEA 4MNVA 3WY8A 3KNXA 2FOAA 1F0RA 1C2JA 5EPNA 1K1MA 3UQVA 1S0QA 4LK4A 1A5IA 4GPGA 1G3BA 2QE7D 2AGEX 3ITIA 2XWAA 3SZEA 1UVOA 2GMTB 1ARBA 1DLKB 5DN6D 3SO3A 4RKOB 5EU8A 1AWFH 5DJ7A 3ZVFA 3F9GA 1F92A 2OC1A 2Z3EA 1GJDB 2TPIZ 3QN7A 3P8OA 1O3DA 2ZPQA 3LGIA 2GT7A 1YCPH 4WMDA 2Q6GA 2LNCA 1SLXB 3RXEA 1OYTH 1B0EA 5GXPA 1GVZA 1K1JA 3VEQB 3LU9B 3BIUH 2K7XA 2BD2A 3HKIB 4Q80A 1HAGE 2ZFSA 4FU9A 9LPRA 4H6TA 1LVOA 4AZ2B 5EQSA 4D9QA 1RRKA 1GBBA 2L6OA 1SQOA 2ULLA 3PRBA 2J98B 2Z7FE 4KKDA 1FY5A 1QA0A 1K1LA 3HKJB 4DOQA 5IK2D 3BTKE 2A5KA 3VGCC 4YM9A 3SV8A 1CA0B 1UK4A 1KIGH 1V2PT 1ZMJA 3CS0A 3UIRA 4OS5A 1S83A 3GDVA 1QRWA 3ZV8A 4IS5A 4ZUHA 4YOJA 3RXOA 1NT1A 1O2SA 4AFUA 3V3MA 2JKHA 3M7TA 1ZZZA 3RXQA 1ZGIA 1OX1A 1SQTA 1SQRA 1YPMH 2QGRA 1H8DH 4JZFH 3K65B 4UEHH 1QHRB 3V7TA 1LQDB 2CGAA 1DXWA 1LQEA 1QTFA 3SI4H 1MZAA 1XUKA 4LOYH 1CE5A 1TLDA 2GMTC 2KZ4A 1GVLA 1O3BA 2JH5D 4NIXA 2OUAA 2R2WU 4AGJA 2SGFE 3SJOA 2FXRA 2Y81A 1OWIA 1P57B 3PMJA 5C5NA 4U01A 3LC3A 2ZG0H 3Q3KA 3QTOH 1WQSA 4P00A 4DVAU 7GCHF 3MI4A 3RUOA 1O2LA 3IG6B 7ESTE 4IN2A 4I86A 1ETSH 1GHZA 3WW7A 3EE0B 2F4LA 1TRMA 4ZMAH 2P3FH 2ZDMA 1TA6A 1C5QA 2Z9LA 3T62A 1K9OE 3BG8A 5BPEA 2A4QA 1N1LA 1D3DB 1TMTH 3VFEA 4SGBE 2J9NA 4ESTE 1FUJA 3LKWA 4GCHF 1C9TA 3UR9A 2XNDD 5CHAB 1UK3A 1FN6A 1HBTH 4AB8A 5B6OA 1H9LB 3NCLA 3U8TH 3MU5A 2GT8A 5F53A 1N6YA 2QXIA 3DHKH 1H8HD 3PLBA 1O5DH 2HNTF 1RJXB 5T6DA 1WTGH 4WWYA 4XSKU 2BOHB 3ATIA 1W0YH 3E6PH 4AFZA 1W3CA 1W7GH 4DURA 2VIPA 2XCFA 1C1TA 3D23A 3AASA 5HM2A 1C5RA 2GGVB 3UAIC 1IAUA 2QXHA 2WPLS 3GDUA 3UWJH 3D62A 3NUMA 1BBRK 1ELAA 2G51A 4RI0A 1KLTA 3GYMA 1TBZH 1VJ9U 2UUJB 4LZ1H 2AGGX 2FOCA 2JH6D 4HGCA 2FWWA 1LCYA 2FZZA 2JH0D 4NWLA 4ABJA 2PGQB 2BDHA 2FI5E 1LHGH 1SPJA 2NWNA 5C5OA 1W14U 1XKAC 3SU2A 2XBXA 1C1NA 1GCTC 5CE1A 4U30A 4JZ1A 3P8FA 2W5EA 4BTIB 1GBHA 3GS9A 3IWMA 1A0HB 1BMFD 2BVSH 4GVUA 3M5LA 1GHVH 1M9UA 1HAHH 2W7SA 1ZTLA 3RXBA 3OAAD 3FP7E 4FVDA 4BXSA 2ANYA 1GBMA 3LIWA 1MMJN 5IDKA 5LPRA 3RMNH 3Q77A 1O2WA 4BAOB 2FI3E 3E16B 3ZZ6A 4ZKRU 2NU4E 1C1VH 3ZZCA 2PSXA 3GY3A 3N7EA 3A87A 4AOQA 1MKWK 2W7UA 1V2OT 1T32A 2ZCHP 2H5DA 3BTWE 6CHAB 2BDYA 5HYOA 2Y7XA 5A0CA 4MPXA 1GPZA 1TYNA 4IMQA 4ZH8A 2R0KA 3ELAH 2ZWLH 3RXAA 2CXVA 1ESBA 1ZHRA 1C1RA 2P8OC 1SFIA 1IQHA 3MH4A 3GCTF 4FVBA 1A3BH 1HJAC 1P2MA 4ISHH 2CHAB 4SGAE 3RXIA 3GY5A 2UUKB 1C1UH 2H9HA 1EPTB 3SNEA 2ZGBH 2D2DA 3A85A 2PV9B 2ZO3H 3OX7U 1W0JD 4B6EA 1P10A 1Z6JH 3S69A 1UMAH 2VIDA 1J15A 1V2KT 3KYGA 2F9BH 1O2JA 3ZVCA 3W94A 3VB6A 4B6FA 2G81E 1MU6B 3RMOH 3MNXA 2Q6DA 3GYLB 1RTFB 2P16A 2OQUA 1E36B 2XC4A 1H8IH 2FOFA 4MDSA 2B8OH 2PGBB 1O3NA 1Y5UT 1PQ8A 4AGKA 1CO7E 3SGAE 1O3OA 1UHBB 2C4FH 2F3CE 2FI4E 4JZIA 2ZDAH 5JPMH 1FN8A 1Z1IA 1QL8A 1GHBF 2K8IA 1FIWA 3FP6E 3LH3A 1UK2A 1TA2A 2BB4A 1P9UA 1KXAA 4ABGA 1IQKA 5C2ZA 1T8MA 3L6PA 1GHAG 2BDGA 3KQDA 3RU4E 3O8RA 3UQOA 1KMHB 3KQCA 2J34A 1ACBE 2V35A 5EPYA 1IQEA 1F7ZA 1ZMNA 3DUXH 3IITA 1NFWA 4K3JA 1N8OC 1TPAE 1HAXB 2AGIX 1A61H 2FEQH 3PMBB 4CRFA 4F48B 3DSGA 4INKA 5HIYA 3URCA 3SZNA 1C2IA 3T29A 4YOGA 1F0UA 1W10U 2Y80A 1EOJA 5T6FA 3RDZA 3ZZ5A 3V0XA 2PWXA 3E1XB 1QIXB 1NRNH 4FUBA 3A7XA 1OS8A 1BTZA 4YXWD 2VWMA 4YLQH 1YWUA 1EPTC 3MH6A 1W13U 4AFQA 5HGGA 4BOHA 6GCHG 4YT6H 1FPHH 2CF9H 2A7CA 3P8GA 3M5OA 1SGRE 1NU7B 4KTCA 5E8EH 4M7GA 2BD9A 2OLGA 3ODFA 2O9QA 4CR9A 2WPJS 1SHYA 2WPKS 3QZRA 2TGAA 1AVXA 4Z1MD 5E2PA 4YZUA 1HJ8A 1O2UA 1MD8A 2GZ7A 1LO6A 2R2MB 4Q63A 2O8UA 1C5SA 1BA8B 1BRCE 1UO6A 1V2QT 3TU7H 4CR5A 1P02A 3FFGA 1J8AA 4WY3A 5C1XA 1UJ1A 1YCPM 5CHBA 2XOKD 2BQ7B 3LGWA 4K5ZA 4AX9H 1MTUA 2BHGA 4GAWA 4Y0YE 1AFQB 8LPRA 1Z8GA 1TX7A 1LVMA 4J1YA 5T1VA 1YM0A 3UREA 2ZC9H 1OP8A 3RXJA 4ZXXH 3M36A 1ARCA 1DWDH 1H9IE 1O2MA 1TBQH 4ABHA 2SGPE 2D1JA 3GCOA 4A5TS 4YESB 2SNVA 1QJ6B 3MHWU 2J4IA 2OP9A 1OHHD 2KR7A 1UTQA 4ZHLU 3F3BA 4I32A 1KDQA 1EZSC 5F03A 1BRBE 3W95A 1JBUH 1P9SA 1SLVB 3T2NA 2LIZA 4A1XA 2XWBI 3H09A 5GDSH 1QBVH 1FY4A 5HMAA 1BITA 1BTHH 1O3LA 1RIWB 4IC6A 3L3TA 1H4WA 8GCHG 1GMHG 1TQ7B 1YCPK 1AWHB 2AS9A 4OS1A 3SUGA 3PWCA 5C1YA 1SGCA 3F0OA 2ODQA 3TH3H 2OD3B 3P95A 2YMSB 3MOCA 1GI9B 3LDXH 5J4QA 3STIA 1F5KU 2BLOA 1AFEH 1Z8RA 3HGNA 3ZVBA 2EEKA 1YGCH 3OEHD 3TH2H 1RD3B 1WAYB 1TABE 4Y6DA 2NU2E 1UVSH 3V13A 3PTBA 3NPSA 4GHQA 1A4WH 1FV9A 3BEFB 4FUCA 4GUXA 3C27B 5FBEA 1C2GA 1FY1A 1KTTB 1IQJA 2WPHS 3LGUA 3MU8A 4DY7B 1GJ4H 3QUMP 1L2EA 4Z0KA 3B23B 5FHTA 1W12U 1UVUH 5HIZA 3RC4A 3SU5A 3F68H 1BHXB 2VIWA 2W6JD 2C93B 4DCDA 2GV7A 1D6WA 1MU8B 1NZQH 4X8TH 1HFDA 1CA8B 4A7IB 1INCA 1ELGA 2A7JA 3SN8A 1UTMA 3TJOA 4ZROA 3M7UA 1DSUA 3HK3B 2AMQA 1C5UA 3BTFE 1L1NA 2GCTC 1L0ZA 1ELEE 5DP7A 1ZGVA 5AFYH 2GVFA 2WUBA 4INHA 5EJ1A 2VH6A 1HAYB 1H1BA 3RXCA 2TRMA 4ZXYH 3RP2A 5ESBA 1BMMH 2FIRH 1DY9A 1P2KA 1O2PA 3H7OA 3U98H 1CQQA 2ZFTA 4MNXA 5BRRE 1Y3XA 4XBCA 3SU3A 3WWBA 1Y5AT 1C1WH 1OWDA 3ATMA 3NZIA 3MNSA 4IW4E 2Z3DA 3A83A 2ASUB 2VNTA 1KXCA 4UFEH 3RXHA 1GBKA 2VB0A 3AK5A 4CHAC 2ZCLP 1WTHD 5DSFA 5DP6A 4I8JA 1VITG 1ELBA 3SJIA 4JK5A 1Q31A 3TNSA 3ZIAD 1O2IA 1C5OH 4NZQA 3TJNA 9ESTA 3UNRA 1P01A 1C5NH 1GBEA 1ELDE 1WU1A 4WH8A 2KAIA 2Z9KA 1XXFA 5E0JA 1E0FD 4Q4LA 1TGCA 3MO9A 1QQ4A 1XVMA 2W3IA 2C8YB 1G3DA 4M9FA 1WSSH 1WBGB 2HPPH 1GMDG 1ZSJA 4CH8B 4Y7BA 1BT7A 1FIZA 3SUFA 4BANB 4TPYA 2QC2A 3T25A 4D8NA 2F9UA 1P3CA 4JZEH 4DIHH 2J95A 4X1RU 1BRAA 3K2UA 3S7KB 2UUYA 2ZQ2A 1KXFA 1GDNA 4XRNA 3ZVDA 5EIYA 1YPHE 2GJGA 1NBME 1HXFH 2UWLA 4Y10E 3MU1A 3PTNA 2H1UA 1UTOA 1SKYE 1FAKH 1J17T 1JWTA 2Y5HA 1TNJA 4JMYA 2BXTH 1FY3A 3FO8D 3RC5A 5L2YH 1QFKH 1C2EA 1A0JA 3BTHE 2SNWA 3SUDA 1E34B 4CBOA 2OQ5A 4CRGA 1F2SE 2A5AA 2ZECA 5C1UA 1L1JA 1IQIA 2FS8A 3UOPA 4NA8A 1SHHB 5EG4A 5AVDA 1HJ9A 2BY5X 2P3TB 4X6OA 1SQAA 1P2NA 2QF3A 3M5MA 4I31A 3MYWA 1UW7A 1O36A 4O97A 2ZI2H 1Q2WA 2P94A 5A0AE 4HI3A 1NN6A 3T5FH 1VITH 1O32A 3QWCH 2ODYB 1AU8A 2PLXA 4FU8A 2ANMH 3OTJE 2ZIQH 1V2NT 1GG6B 4K69A 3QO6A 2O8MA 3DSPA 3VB5A 3ENSB 1GBAA 3A86A 1L4ZA 3RXTA 3TGJE 2G5NA 1C5PA 1PPGE 3GY4A 1GBIA 1ZYOA 3A7ZA 4TT3D 4IN1A 3NWUA 3ZZ4A 3RXMA 1XMNB 1LTOA 1B7XB 1OSSA 2A32A 1AZZA 1SGFG 3TVJB 4TWWA 5A8YA 1EP6A 2AH4X 2VJ1A 3OTPA 5KGOA 1O2YA 1SI5H 1O2GH 1HXEH 3BTEE 1RGQA 5A8ZA 1O3JA 1O3KA 3MH5A 1FAXA 2BVRH 1Z8JB 1TNGA 2OINA 4ZKOU 1MABB 1HV7A 3F9HA 2FM2A 1EZUC 1NROH 1KSNA 3QGJA 4CRCA 2QIQA 1YF4A 2JETB 2WSSD 1SFQB 1SGQE 1ZMLA 5EOKA 4X6MA 5I25A 4ZKSU 1OWHA 5ABWA 2C8XB 4MVNA 1O37A 3FZZA 1E1RD 1FONA 2OBOA 1O3AA 1P2JA 1WOFA 2GZ8A 4OS2A 1UVTH 2BLVA 3D49H 2PP6A 2BMGB 5LPEA 2ANKH 2ZHDA 2WPIS 2A0QB 3U9AH 5HXFA 2QA9E 5EW2H 5K0HA 5CDFE 1DS2E 4MTBA 4O3UA 1U6QA 3TNTA 1LVYA 1SGDE 1AVWA 1K28D 3A8CA 3ATKA 1EAXA 1G37A 1O3IA 1WCZA 1VCQA 1XUFA 1SL3A 1AZ8A 2TGTA 4K2YA 4WMFA 3A8BA 2PKAA 3SHCH 1P11E 1P3EA 3PO1B 2IJD1 2Z9JA 2A31A 1S6HA 1HIAA 4MG3A 1P0SH 2TIOA 3URDA 6GCHF 4YO9A 2Y82A 2OBQA 1A5GH 1XXDA 4TY6A 2GZ9A 1ANDA 3I78A 2BX4A 1SC8U 1NRQH 2R3UA 1CT2E 3UWIA 3SU4A 4MQAA
chains in the Genus database with same CATH topology
1CA0C 1AB9B 1OP2A 1O3FA 4KTSA 1G3CA 3QDZB 4JYUH 1NRSH 4Y8YA 4Y7AA 2F9PA 1GBCA 2Z9IA 1QRZA 2K1QA 2VVCA 4ISLA 3S0NA 1CHOG 3GCHB 3HPTB 3U1JB 4OS7A 8KME2 3E0NB 3TK6A 1QJ7B 3RMMH 2ALPA 1EJNA 1AE8H 4DG4A 1QA7A 4MNWA 2BDAA 2PKSB 3LJOA 1GI1A 2H9TH 3NKKA 4I8HA 3MFJA 2BY7X 1JIMA 4XBBA 3KIDU 3VXEH 3SNAA 2J2UA 3Q76A 3UY9A 1P8VC 1G30B 1ZSLA 2F9NA 1TMUH 1TB6H 4AORA 1O3PB 2F83A 2ZZUH 1VGCB 1TGNA 3SW2B 1XUGA 2WINI 2HGTH 3MH7A 4XBDA 5F8TA 1D4PB 1C5YB 3TK5A 1A1RA 1LPZB 1AHTH 1PYTC 2ZFPH 3A84A 4U32A 4BTUB 1C4V2 1SGEE 4K1TA 1BTWA 1D3PB 2ALVA 2FO9A 1O2KA 2H5CA 5AF9H 4K1SA 1F5LA 2BD7A 1ZOMA 1GGDB 4XDEA 5EXMA 7KMEH 2WV4A 8GCHF 1GI4A 1A3EH 1GMHF 2EI7A 4JCNA 5CHAC 1ZPCA 1SR5C 1V6DA 1O5AB 2BDIA 1EB2A 2O8WA 3LH1A 3P70B 1CU1A 2HALA 1GHWH 4Q7XA 1J14A 1HUTH 1CGHA 4QT8C 1O2VA 1O2OA 1AB9C 3N7OA 5CMXH 1TRYA 4ABFA 2YNAA 2A1DB 3I29A 1BTUA 4GLYA 1SGPE 3KCGH 1Z8IB 1FDPA 2PTCE 4NGAH 1YPKH 1DM4B 1MTVA 3GCHC 2GCHG 3U8OH 3UNQA 1HCGA 1UCYE 3SQEE 1EZXC 5DP8A 2G55A 4R8TB 5TCCA 4B71A 2BD4A 1O2TA 1QURH 1TNIA 1TOCB 3TIUA 4K60A 1V2WT 2FPZA 3S7HB 2G5VA 1CSOE 1PFXC 2FYRA 4DT7B 4X8VH 2B7DH 2ZTZA 3AAUA 4X2WA 3SGBE 3G01A 1YPGH 4E7RG 4FUIA 1K1OA 2GV6A 2VVUA 1C4Y2 3F1SB 3UOUA 5ESTE 2ZDNA 3Q00A 2PUXB 5LH8A 3K6YA 4NCYA 1JMOH 2AEIH 2BDBA 3VPKA 4ABBA 1OOKB 1AGJA 2FOBA 2XBYA 4ZKNU 5EW1H 4Y71A 1TALA 3GY7A 3RXPA 4BAQB 1UCYH 3NXPA 3AW1A 4CBNA 2ZCKP 3SQHE 4IC5A 2KAIB 2HVXA 3UUZA 5FPTA 3PV4A 5JBTA 1KXBA 2BQ6B 4I8KA 1GI6A 1LKBA 1IHSH 1HAOH 6CHAC 2Q6FA 4MPWA 1C5TA 1KYNA 3DA9B 4DGJA 1NRPH 1MD7A 1V2RT 3RMLH 1O5GH 1MCTA 2GKVE 4THNH 2ZU1A 2BOKA 5ETXA 2WV5A 2FYQA 1P06A 2CHAC 4Y76A 1VITF 1MTNB 5DP5A 3SU0A 1TX6A 3TGKE 2SGQE 1GJ5H 1HAIH 1SOTA 3SV9A 3TK9A 3ZYDA 1YP9A 2C8ZB 1TPPA 2A2XH 1ANEA 4Z6AH 1YPJH 3RXFA 1C5ZB 4NFFA 5EQQA 3M3TA 1DXPA 1PPFE 4A1TA 5FX5A 1ZJDA 3M61U 1D9IA 2ESTE 1O2XA 3QGNB 3SORA 1V2VT 2XXLA 1GMDF 3V12A 5T6GA 2ZHEH 1SLWB 2FP7B 2VVVA 2FX4A 2XW9A 5AFZH 1LDTT 1VCWA 4GCHG 1ABIH 4AG1A 1IOEA 1FMGA 1Q3XA 5PTPA 1PPCE 2IN2A 6ESTA 1NFXA 1D3TB 1S0RA 3KHVA 1GJ8B 1A0LA 1YYY1 3EDXB 2LPRA 3GDSA 4KP0A 1B0FA 2FESH 3JZ1B 1QL9A 1BB0B 2P93A 4X1QU 2BY8X 3M5NA 1ORFA 1W0ZU 4IGDA 1QGFA 4UFGH 3F6UH 3EQ0H 1ZTKA 1XUIA 3ATLA 4A1VA 1PYTD 1O2ZA 2FOGA 2B0FA 3P8NA 1O5CB 2Z9GA 2ZDKA 1C9PA 1GI5A 2C8WB 1QL7A 1CGIE 2BLQA 1K1NA 4FUDA 1ANBA 4YLUA 4UD9H 1DSTA 2ODPA 3GY8A 1BQYA 2YOLA 1F0TA 3H7TA 3Q3YA 1HAVA 1ANCA 1Y8TA 4D7GA 3HGPA 1FJSA 1B5GH 2PR3A 4D7FA 1GI2A 2QN5T 4KGAA 4X8UH 1G36A 1O31A 2HNTE 3KGPA 2R9PA 3UR6A 3ZZ8A 3EA9A 1GDUA 1LHFH 2PFEA 3HK6B 4RKJB 2IPHA 1YPEH 4X1NU 4X2YA 2OCVB 3B8JA 3SJKA 4E06H 1E35B 1UVPA 2V3OH 1C4U2 1NRRH 4NSYA 4ZHMU 1EASA 4Y0ZE 2BTCE 1T4UH 1IQNA 1C2LA 1UTPA 3SNDA 1YC0A 5FCRA 1GI7B 1O39A 2IJOB 2ZU5A 1C1SA 2P59A 1QBNA 5EXNA 4AG2A 1MH0A 1QCPA 3ZZ3A 4E05H 3U69H 1ZPBA 4NIWA 2PKAB 1CBWB 1ZLRA 2B5TB 3ZZ9A 1GBJA 1JRSA 4KTUA 1AFQC 3OY6U 1SOZA 3DFJA 4JK6A 1IQFA 1Y3YA 2HLCA 1AD8H 3RXGA 1NS3A 1T4VH 5DP3A 1O2RA 3FANA 3S9BA 1RS0A 3OU0A 1KTSB 1C5LH 4FXGH 1EJMA 4U2WA 6LPRA 4UFFH 2RA3A 4F4OC 5JDUB 2TGDA 3RM0H 1V2MT 2FLRH 3BG4B 3FP8E 3BTME 1E38B 5GWZA 2QY0B 1DLEA 1HNEE 3MO6A 3MWIU 1MKXH 3VB7A 1P03A 2A4OA 2ZA5A 1AUTC 2FODA 2OC0A 3FVFB 3AVZA 2GTBA 1PPHE 1BDAA 1RIWC 1SGTA 2ZNKH 4X8SH 5DO4H 4JZDH 1A5HA 3SV7A 5HM9A 5LGOA 4UE7H 1LHDH 3LGYA 1TAWA 5GPIB 1DT2A 1EZQA 1GJ7B 1QB1A 1ZTJA 2GD4B 1RTKA 2VH0A 2ZTYA 3VB3A 2BYAX 3A7VA 4ISIH 1MCVA 2M5TA 1LMWB 2XC0A 1LHEH 1KLIH 1O3EA 1LPKB 3ZZ7A 1DANH 1DX5M 1SSXA 1FPCH 1X7AC 1HGTH 5C3NA 1EPTA 1GI0A 4X6NA 5TCAA 4CRBA 3SU1A 1P2OA 1BCUH 5DG6A 2O8LA 3A7YA 4I8LA 1W2KH 1RFNA 2EC9H 4WXIA 4HTCH 3RU4D 1YPLH 4AFSA 4I33A 1EKBB 3PB1E 4FUJA 1TE0A 1CHOF 1P09A 1C1OA 1D3QB 3KQEA 2XRCA 5F6MA 1VR1H 3Q3XA 1NC6A 2QV1A 1CT4E 2BVXH 3ZV9A 1JOUB 3RXKA 1XX9A 3T27A 1NTPA 1OPHB 2FOMB 1C5MD 1UHBA 2I6SA 4B73A 1W7XH 1A2CH 4B75A 2W26A 3T28A 5GIBA 4NA7A 1EXFA 3ZZBA 3RXSA 3EA7A 3B9FH 1KLJH 1PPEE 2DE9A 2FLBH 2WYJA 2XBVA 2D8WA 3P6ZB 3UFAA 1O34A 2NU3E 2R3YA 1CGJE 1Y3VA 1L1GA 3E3TA 1D6RA 3RXUA 2Y7ZA 3VGCB 5DK1A 1GBLA 4B74A 2HPQH 1XM1A 3FAOA 4WVPE 1VCPA 3A88A 2VGCB 2ZGHA 2FX6A 2C90B 2RG3A 4UFDH 3M37A 2ZHWH 2Y6TA 1P2IA 4TYDA 5E0GA 1OWEA 3OYPA 3M3VA 3M7QA 2BZAA 4YTAA 3A7TA 2YNBA 1AKSA 4XE4A 5DKMA 1S81A 2CN0H 1O3MA 1C2MA 2G00A 2BM2A 1W11U 3OSYA 1YPHC 4X2XA 5EQRA 1FY8E 3UTUH 2TBSA 2VWNA 2ZFRH 3GY6A 4NFEA 2GCHF 3GICB 5J4SA 3SOSA 4ABEA 2VU8E 2Q1JA 3VB4A 2CV3A 2Z6BD 1CHGA 4FUFA 1C5XB 1OYQA 3MNCA 1BOQA 1JRTA 1SG8B 1EQ9A 5DGJA 2UWPA 3SBKA 1O33A 4IMZA 4YOIA 2H6MA 1QRXA 3PLKA 2IOTA 3AAVA 3MNBA 2A4GA 4ISOA 3D65E 3QK1A 1J16A 5TJXA 4BNRA 2B9LA 1K1PA 4WF8A 1VZQH 1AI8H 3BSQA 1O0DH 1T8OA 2ZQ1A 4B2BA 1S84A 3TITA 1W8BH 5GCHG 2BX3A 4Y8ZA 1LVBA 4AYYB 5A09A 2SGEE 1P05A 2VGCC 1GHAF 3KEEA 1DWCH 2ZGJA 2A5IA 1ID5H 1DWEH 2RA0A 1DY8A 4O9VA 5EXLA 1QB6A 1UCYK 3RM2H 3ESTA 3PROA 3CP7A 3BTQE 2BQWB 1EJAA 2ZPRA 1BTPA 1T8LA 1IQLA 1DICA 2QF0A 4Y8XA 5JB8S 3BEUA 1EAWA 3LT3A 2D26C 1HYLA 4B1TA 1TPOA 1GMCG 3CENA 3GOVB 5JB9S 4B76A 5LPFA 1ZPZA 1GG6C 2QXJA 4CREA 3EAJA 5A0BA 4X0WU 1YKTA 3TPIZ 3E90B 2ZDLA 4ZAEA 2QCYA 5JBCS 3PWBA 1EB1H 4INLA 1GCTB 4X1PU 5FXLA 1NY22 4MLFB 3M35A 1BRUP 1QY6A 2XBWA 2RDLA 4UDWH 3BEIB 3A81A 1SVPA 4WMEA 4LXBH 1JIRA 4MNYA 3OY5U 1Z71A 2F9OA 3GCNA 1E37B 5F8ZA 3AW0A 1KDQB 3QZQA 3A8DA 2QAAA 1O5BB 2ZP0H 1Y3WA 5E2OA 1HAVB 4OS6A 2JETC 4DIIH 3O8CA 3I77A 1HRTH 2J38A 1TWXB 3P17H 8ESTE 2BLWA 1UTNA 1C2DA 1CT0E 4NIVA 1BZXE 3ZZAA 1Z6EA 2Z3CA 1AVGH 1ZRKA 1PQ7A 4JYVH 2ZGCA 1BJUA 1OWJA 2P8OB 3PLPA 2G4TA 2AERH 1NPMA 1HJAB 1PPZA 1ELCA 2BY9X 3O8DA 4BAMB 1BUIA 3F9EA 4HFPB 1AE5A 1GL1A 3A82A 3F9FA 4H4FA 1TGBA 3BV9B 1O5EH 3A80A 4J2YB 2PTNA 1DUEA 1EATA 4CH2B 1XKBC 2H9EH 2PSYA 5FCKA 4NIYA 2W3KA 2P3UB 1SGYE 3TGIE 5FX6A 1TX8A 1ELTA 3JZ2B 2VIVA 3PO1C 3KF2A 4AN7A 2ZKSA 1ZHMA 1T31A 1QNJA 1GL0E 1HB0B 2PUQH 1AQ7A 4KELA 1C1QA 2XNIA 4ABIA 1QQUA 1EUFA 3BN9A 3SGQE 1BTYA 4R0IA 1MAXA 2OC7A 1BMLA 1ELVA 7LPRA 1BMNH 4XFQA 1G3EA 4NG9H 2UWOA 3K6ZA 4ABAA 1DPOA 1THRH 5C67A 1G2LA 3RLYH 1THPB 3U8RH 1MTSA 1LHCH 2ILNA 4AYVB 4ZHAA 2G52A 2BDCA 3ZVAA 4BAKB 1MZDA 1TMBH 1TNKA 1QBOA 4TWYA 2HOBA 2Y5FA 2ZFQH 1N8OB 1V2JT 2BD5A 2VINA 2H2ZA 2PKSC 1TNLA 2PHBA 5FPSA 1BHXF 2OTVA 1V2LT 1FI8A 2QYIA 1ETTH 1A46H 3FZDA 4Q7YA 3LGVA 3SNCA 2ZTXA 1TOMH 1VGCC 2XC5A 2SFAA 1ZSKA 5C20A 3MU4A 1OP0A 3SU6A 1AIXH 1GBTA 1O3HA 1GJBB 2Y5GA 1O5FH 1GVKB 1C1MA 3E91A 4FU7A 1OWKA 4AB9A 1WUNH 2BD8A 4WH6A 4Y11E 2THFB 1GGDC 1YLDA 1MKXK 5DP9A 1A7SA 1P04A 2AIPA 4IBLH 1MTWA 1GDQA 1SBWA 2A45B 2FMJA 2SGDE 5EODA 1ZRBA 3KQBA 2AIQA 3ZVGA 3STJA 2XYAA 4DW2U 4VGCB 1T8NA 3QLPH 1TONA 2CJIA 1G2MA 1UTLM 1DUAA 1PPBH 3BIVH 1WQVH 1C2HA 2ZDVH 3EBNA 1ELFA 1TGSZ 4NZLA 2ZPSA 1FQ3A 1IQMA 3TJUA 1XUHA 5K7RA 2BD3A 1ZR0A 4ABDA 5JBBS 3DFLA 5T3HA 4CRDA 2ZEBA 3EA8A 1DWBH 3VXFH 1NFUA 1QJ1B 1J9CH 4BXWA 1C2KA 1SGFA 2ZU2A 7GCHG 1TQ0B 2P95A 1UTKA 2FTLE 2OC8A 3BTTE 2RCEA 1FXYA 1FNIA 4FUHA 2AMDA 3R0FA 1BBRE 1GI3A 3SJ9A 3ZZDA 4D9RA 1IHTH 4O03A 5FAHA 1GBDA 1BMAA 1YBWA 1RXPA 1TPSA 1GJ9B 1MUEB 4BTTB 1MAYA 3BTGE 1MQ6A 1O30A 1G9IE 1GHXH 1DFPA 1AKSB 4Q2KA 1EAIA 1PQ5A 1ETRH 5DP4A 1HAZB 2UUFB 3L33A 1JXPA 2I6QA 1NM6A 4HZHA 5IYTA 1AUJA 1GCDA 1LPGB 2AFQB 1FLEE 2ZGXH 1Z1JA 4RSPA 1QB9A 2QXGA 4I8GA 2J92A 3A7WA 2FOHA 3SUEA 5DPAA 1V2TT 1C5WB 5GJ4B 4K1EA 1BBRH 3EYDA 1THSH 2GDEH 3ZYEA 4WXVA 4VGCC 5L30H 5A8XA 2OXSA 2ZU3A 1EOLA 1TBRH 4K8BA 1BIOA 5JYIA 3PMHB 1DDJA 2AYWA 5E0HA 4OGYA 3SV6A 1K21H 2F9VA 1O3GA 3T26A 2A4RA 2VIOA 1HDTH 1GI8B 1RTLA 1MTNC 1SGNE 1PJPA 4UONA 1XVOA 1V2ST 1TGTA 3SNBA 4K8YA 2NU0E 1ZHPA 2V6NA 1MBQA 3GISB 1KXEA 3UNSA 1TIOA 1HAPH 3A8AA 1AY6H 2GDDA 2NU1E 1TNHA 1K22H 1N6XA 4TY7A 4YT7H 1O2NA 1OKXA 2BXUH 1YLCA 2BY6X 3KL6A 2GCTB 4H42U 2ZU4A 1O38A 2TGPZ 3A89A 1PQAA 2FOEA 1OXGA 1MKWH 1S5SA 5AHGH 1F5RA 1NU9A 1BTXA 2G8TA 3MTYA 3PYHA 3RXVA 2GX4A 2O8TA 1H9HE 2HRVA 1HLTH 5G4BA 1V3XA 2SGAA 1K1IA 3DD2H 1VJAU 2FTMA 3EGKH 1ABJH 4BAHB 2J94A 3ODDA 1MQ5A 5FPYA 5GCHF 1WYKA 4Y79A 1GBF