2GZGA

Crystal structure of the e9 dnase domain with a mutant immunity protein im9 (y55f)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
LKHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIYFPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin-E9 immunity protein
publication title Crystal Structure of the Complex of the Colicin E9 DNase Domain with a Mutant Immunity Protein, IM9 (Y55F)
rcsb
source organism Escherichia coli k12
molecule tags Antibiotic/antibiotic inhibitor
total genus 28
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gzgA00
2GZIA 2GYKA 5EW5E 2K5XA 1FR2A 1CEIA 2VLNA 2VLOA 1GXGA 2JB0A 1IMPA 1BXIA 2VLQA 2GZJA 1EMVA 1UJZA 1UNKA 2K0DX 3U43A 2GZFA 7CEIA 1E0HA 2NO8A 1MZ8A 1IMQA 3GKLC 2GZGA 2GZEA 2JBGA 3GJNA 2WPTA 4F37A 2ERHA 2JAZA 1AYIA 2VLPA 1ZNVA 1GXHA 4QKOA 4UHPB
chains in the Genus database with same CATH superfamily
3CC2P 1NQ4A 2FHSC 5F2OA 3H4EA 5JPAA 2FQ0A 2M8LA 2MD9A 3CXCO 1N8RQ 1QRJA 2N98A 3G26A 2GZIA 2N6ZA 1VQ8P 1RNIA 3LMOA 2KORA 2PEQA 1GPJA 1M1KQ 2MR7A 2LIWA 1W2BO 1KLPA 3U43A 7CEIA 2JBGA 3G21A 2PEMA 4QKOA 2PEIA 1X3OA 1YJWP 1VQOP 5HV8A 2PNGA 2AFEA 2PEOA 4XFZA 2NO8A 1Q86Q 1A8OA 1KC8Q 2FAEA 2XV6A 2JAZA 1VQNP 3NY7B 3NTEA 2KW2A 1M6EX 2N6YA 3B4QA 4COCA 1CEIA 2VLNA 2KGCA 1YIJP 3DS4A 1VQ9P 1K9MQ 2KGAA 4U0DA 2GZGA 2Z44A 3CPWO 2E1MA 2M8NA 4M0IA 3DPHA 3CD6P 2EG5A 2JB0A 1VQ4P 2KGDA 2LIUA 3VRLC 1UJZA 2AFDA 2L4BA 2L22A 2KGEA 1IMQA 2GZEA 5KP8B 1AYIA 1KD1Q 1ZNVA 3G28A 5HVCA 1AUMA 2LPKA 1VQLP 2FQ2A 1L0HA 3H0DA 4PXHB 3P05A 5I4TG 2FQ1A 2L0QA 4PWVB 5KP6B 1NJIQ 1QVFO 2XXMA 1YHQP 2KOOA 1GXHA 2MR8A 3CCRP 2LL8A 3CC4P 3G4SP 2FVEA 2N5HA 2ROQA 2LTEA 2JQ4A 1HY8A 2EHTA 3EJBA 1EMVA 3RG2A 3CMAP 2K0YA 2LMLA 1HQBA 2BUOA 2GZFA 1E0HA 4GR2A 2JO0A 4CA3A 4U0EA 2QA4P 4U0AA 2JGPA 4GR6A 1Q81Q 3I56P 1FR2A 3DS3A 4XRQA 2MVUA 3DS0A 4BPHA 1GXGA 4QNBA 3Q20A 2VLQA 2KR5A 1DV5A 1VQ5P 2K0DX 3G6EP 3DS1A 2K92A 2PEKA 1ZMBA 3CCEP 3CCLP 1Z6MA 2CG5B 4IZ6A 1IMPA 1Q82Q 2LKIA 2P9XA 3G71P 2MF4A 1YJ9P 5F2KA 3H47A 4MRTC 2FADA 1VQ6P 3EJDA 3CCQP 4H2XC 1YI2P 2PY8A 1IUQA 2EFJA 1L0IA 2MVVA 1F80D 1EOQA 2VLOA 5CZDB 1QVGO 2L9FA 1RO2A 3LRYA 4H2YC 2KOSA 1UNKA 3GZLA 1JJ2O 3B5IA 3GJNA 5F2NA 3DTJA 2BHVA 2KOQA 4XFXA 3CCVP 2VLPA 4H2WC 5BS1A 1M74A 2AVAA 3G1GA 1VHNA 3CCSP 2GYKA 1VQMP 2MY5A 2XZ1C 2LOLA 4WYMA 1EIAA 3CCMP 1VQPP 4BPGA 1A43A 2JU2A 3MGEA 2KG8A 1DNYA 3GZMA 2M8PA 1RO0A 1M90Q 2EIAA 2PENA 2FACA 2K2QA 1T8KA 5BS2A 3HZQA 2GDXA 1AF8A 2QEXP 1M6NA 5KP7B 2AF8A 1ACPA 1MZ8A 1K73Q 3GKLC 3CMEP 2WPTA 4COPA 2GDWA 2N50A 2OTLP 2K5XA 2PEJA 1VQ7P 1KQSO 2QNWA 3CE7A 3DS5A 4NEOA 2XT1A 2DNWA 2LF4A 4BPFA 2X2BA 2CQ8A 3CCJP 2JYLA 2KG6A 1VKUA 1K8AQ 5EW5E 2JU1A 3E2DA 1OR5A 3HYBA 2Z46A 4XFYA 2Z45A 1D1DA 1BXIA 3I55P 1K30A 2M5RA 2EHSA 4DG9A 4XROA 1VQKP 4HKGA 3EJEA 3RG6C 4PH1A 2XZ0D 2CGQA 4U0BA 3G0VA 4UHPB 5HGNA 2VSQA 2FVAA 2KOPA 5HGOA 2ONTA 3G29A 2GDYA 3WBHA 5DCKA 4IPYA 2K93A 5HGMA 4U0FA 2K0XA 2CWOA 2L6EA 3DS2A 2OARA 4F37A 2ERHA 2DGYA 3M1MA 5HGLA 2CNRA 3CC7P 4U0CA 2KODA 4R0MA 2KWLA 1S72P 1BAJA 2OTJP 4PH0A 2N5IA 2GZJA 3CCUP 1YJNP 2FVFA 3OW2O 1Q7YQ 2JYGA 2K94A 3G1IA 1E6JP 1YITP 2KG9A 5EJDA
chains in the Genus database with same CATH topology
2GZIA 2GYKA 5EW5E 2K5XA 1FR2A 1CEIA 2VLNA 2VLOA 1GXGA 2JB0A 1IMPA 1BXIA 2VLQA 2GZJA 1EMVA 1UJZA 1UNKA 2K0DX 3U43A 2GZFA 7CEIA 1E0HA 2NO8A 1MZ8A 1IMQA 3GKLC 2GZGA 2GZEA 2JBGA 3GJNA 2WPTA 4F37A 2ERHA 2JAZA 1AYIA 2VLPA 1ZNVA 1GXHA 4QKOA 4UHPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZI A;  2GYK A;  5EW5 E;  2K5X A;  1FR2 A;  1CEI A;  2VLN A;  2VLO A;  1GXG A;  2JB0 A;  1IMP A;  1BXI A;  2VLQ A;  2GZJ A;  1EMV A;  1UJZ A;  1UNK A;  2K0D X;  3U43 A;  2GZF A;  7CEI A;  1E0H A;  2NO8 A;  1MZ8 A;  1IMQ A;  3GKL C;  2GZG A;  2GZE A;  2JBG A;  3GJN A;  2WPT A;  4F37 A;  2ERH A;  2JAZ A;  1AYI A;  2VLP A;  1ZNV A;  1GXH A;  4QKO A;  4UHP B; 
#chains in the Genus database with same CATH topology
 3CC2 P;  1NQ4 A;  2FHS C;  5F2O A;  3H4E A;  5JPA A;  2FQ0 A;  2M8L A;  2MD9 A;  3CXC O;  1N8R Q;  1QRJ A;  2N98 A;  3G26 A;  2GZI A;  2N6Z A;  1VQ8 P;  1RNI A;  3LMO A;  2KOR A;  2PEQ A;  1GPJ A;  1M1K Q;  2MR7 A;  2LIW A;  1W2B O;  1KLP A;  3U43 A;  7CEI A;  2JBG A;  3G21 A;  2PEM A;  4QKO A;  2PEI A;  1X3O A;  1YJW P;  1VQO P;  5HV8 A;  2PNG A;  2AFE A;  2PEO A;  4XFZ A;  2NO8 A;  1Q86 Q;  1A8O A;  1KC8 Q;  2FAE A;  2XV6 A;  2JAZ A;  1VQN P;  3NY7 B;  3NTE A;  2KW2 A;  1M6E X;  2N6Y A;  3B4Q A;  4COC A;  1CEI A;  2VLN A;  2KGC A;  1YIJ P;  3DS4 A;  1VQ9 P;  1K9M Q;  2KGA A;  4U0D A;  2GZG A;  2Z44 A;  3CPW O;  2E1M A;  2M8N A;  4M0I A;  3DPH A;  3CD6 P;  2EG5 A;  2JB0 A;  1VQ4 P;  2KGD A;  2LIU A;  3VRL C;  1UJZ A;  2AFD A;  2L4B A;  2L22 A;  2KGE A;  1IMQ A;  2GZE A;  5KP8 B;  1AYI A;  1KD1 Q;  1ZNV A;  3G28 A;  5HVC A;  1AUM A;  2LPK A;  1VQL P;  2FQ2 A;  1L0H A;  3H0D A;  4PXH B;  3P05 A;  5I4T G;  2FQ1 A;  2L0Q A;  4PWV B;  5KP6 B;  1NJI Q;  1QVF O;  2XXM A;  1YHQ P;  2KOO A;  1GXH A;  2MR8 A;  3CCR P;  2LL8 A;  3CC4 P;  3G4S P;  2FVE A;  2N5H A;  2ROQ A;  2LTE A;  2JQ4 A;  1HY8 A;  2EHT A;  3EJB A;  1EMV A;  3RG2 A;  3CMA P;  2K0Y A;  2LML A;  1HQB A;  2BUO A;  2GZF A;  1E0H A;  4GR2 A;  2JO0 A;  4CA3 A;  4U0E A;  2QA4 P;  4U0A A;  2JGP A;  4GR6 A;  1Q81 Q;  3I56 P;  1FR2 A;  3DS3 A;  4XRQ A;  2MVU A;  3DS0 A;  4BPH A;  1GXG A;  4QNB A;  3Q20 A;  2VLQ A;  2KR5 A;  1DV5 A;  1VQ5 P;  2K0D X;  3G6E P;  3DS1 A;  2K92 A;  2PEK A;  1ZMB A;  3CCE P;  3CCL P;  1Z6M A;  2CG5 B;  4IZ6 A;  1IMP A;  1Q82 Q;  2LKI A;  2P9X A;  3G71 P;  2MF4 A;  1YJ9 P;  5F2K A;  3H47 A;  4MRT C;  2FAD A;  1VQ6 P;  3EJD A;  3CCQ P;  4H2X C;  1YI2 P;  2PY8 A;  1IUQ A;  2EFJ A;  1L0I A;  2MVV A;  1F80 D;  1EOQ A;  2VLO A;  5CZD B;  1QVG O;  2L9F A;  1RO2 A;  3LRY A;  4H2Y C;  2KOS A;  1UNK A;  3GZL A;  1JJ2 O;  3B5I A;  3GJN A;  5F2N A;  3DTJ A;  2BHV A;  2KOQ A;  4XFX A;  3CCV P;  2VLP A;  4H2W C;  5BS1 A;  1M74 A;  2AVA A;  3G1G A;  1VHN A;  3CCS P;  2GYK A;  1VQM P;  2MY5 A;  2XZ1 C;  2LOL A;  4WYM A;  1EIA A;  3CCM P;  1VQP P;  4BPG A;  1A43 A;  2JU2 A;  3MGE A;  2KG8 A;  1DNY A;  3GZM A;  2M8P A;  1RO0 A;  1M90 Q;  2EIA A;  2PEN A;  2FAC A;  2K2Q A;  1T8K A;  5BS2 A;  3HZQ A;  2GDX A;  1AF8 A;  2QEX P;  1M6N A;  5KP7 B;  2AF8 A;  1ACP A;  1MZ8 A;  1K73 Q;  3GKL C;  3CME P;  2WPT A;  4COP A;  2GDW A;  2N50 A;  2OTL P;  2K5X A;  2PEJ A;  1VQ7 P;  1KQS O;  2QNW A;  3CE7 A;  3DS5 A;  4NEO A;  2XT1 A;  2DNW A;  2LF4 A;  4BPF A;  2X2B A;  2CQ8 A;  3CCJ P;  2JYL A;  2KG6 A;  1VKU A;  1K8A Q;  5EW5 E;  2JU1 A;  3E2D A;  1OR5 A;  3HYB A;  2Z46 A;  4XFY A;  2Z45 A;  1D1D A;  1BXI A;  3I55 P;  1K30 A;  2M5R A;  2EHS A;  4DG9 A;  4XRO A;  1VQK P;  4HKG A;  3EJE A;  3RG6 C;  4PH1 A;  2XZ0 D;  2CGQ A;  4U0B A;  3G0V A;  4UHP B;  5HGN A;  2VSQ A;  2FVA A;  2KOP A;  5HGO A;  2ONT A;  3G29 A;  2GDY A;  3WBH A;  5DCK A;  4IPY A;  2K93 A;  5HGM A;  4U0F A;  2K0X A;  2CWO A;  2L6E A;  3DS2 A;  2OAR A;  4F37 A;  2ERH A;  2DGY A;  3M1M A;  5HGL A;  2CNR A;  3CC7 P;  4U0C A;  2KOD A;  4R0M A;  2KWL A;  1S72 P;  1BAJ A;  2OTJ P;  4PH0 A;  2N5I A;  2GZJ A;  3CCU P;  1YJN P;  2FVF A;  3OW2 O;  1Q7Y Q;  2JYG A;  2K94 A;  3G1I A;  1E6J P;  1YIT P;  2KG9 A;  5EJD A; 
#chains in the Genus database with same CATH homology
 2GZI A;  2GYK A;  5EW5 E;  2K5X A;  1FR2 A;  1CEI A;  2VLN A;  2VLO A;  1GXG A;  2JB0 A;  1IMP A;  1BXI A;  2VLQ A;  2GZJ A;  1EMV A;  1UJZ A;  1UNK A;  2K0D X;  3U43 A;  2GZF A;  7CEI A;  1E0H A;  2NO8 A;  1MZ8 A;  1IMQ A;  3GKL C;  2GZG A;  2GZE A;  2JBG A;  3GJN A;  2WPT A;  4F37 A;  2ERH A;  2JAZ A;  1AYI A;  2VLP A;  1ZNV A;  1GXH A;  4QKO A;  4UHP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...