2GZGA

Crystal structure of the e9 dnase domain with a mutant immunity protein im9 (y55f)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
LKHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIYFPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin-E9 immunity protein
publication title Crystal Structure of the Complex of the Colicin E9 DNase Domain with a Mutant Immunity Protein, IM9 (Y55F)
rcsb
source organism Escherichia coli k12
molecule tags Antibiotic/antibiotic inhibitor
total genus 28
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gzgA00
2JBGA 2WPTA 2VLNA 1GXGA 1UJZA 3GKLC 2VLQA 4F37A 1IMPA 1MZ8A 1AYIA 7CEIA 1CEIA 1ZNVA 2K5XA 1FR2A 3GJNA 2GZGA 2GZIA 4QKOA 2JAZA 1IMQA 4UHPB 2ERHA 2NO8A 2VLPA 2VLOA 2JB0A 1UNKA 2GZJA 5EW5E 3U43A 1GXHA 1EMVA 1E0HA 1BXIA 2K0DX 2GZFA 2GZEA 2GYKA
chains in the Genus database with same CATH superfamily
1YJNP 2N98A 2FVEA 4U0CA 1Q81Q 4BPFA 2KR5A 3VRLC 5F2KA 3HYBA 4UHPB 2OTJP 4H2WC 1X3OA 3DS5A 2VSQA 2XZ1C 2KGCA 2ONTA 4U0FA 3GKLC 2BHVA 4HKGA 2Z44A 1YI2P 5DCKA 2N6ZA 2KWLA 1Q86Q 1OR5A 3P05A 4PXHB 2N5HA 3CMEP 1DV5A 2AVAA 2K5XA 3G71P 3NY7B 2KOPA 4U0AA 4XRQA 2LPKA 2NO8A 4H2XC 2GZJA 2OTLP 3DTJA 2N5IA 2LL8A 2JQ4A 2MF4A 1YJWP 2VLNA 3B4QA 3M1MA 1VQ8P 2VLQA 3H47A 3LMOA 1M74A 3G4SP 1M6NA 2LF4A 2LTEA 4U0BA 3GZMA 5HVCA 1DNYA 1VQ5P 2MD9A 4IPYA 3Q20A 1K30A 5JPAA 4BPGA 2EG5A 1VQ6P 1KC8Q 1YJ9P 5EW5E 2EHSA 5KP6B 1ZMBA 2DGYA 1JJ2O 5F2OA 3CXCO 2M8PA 5F2NA 2GZGA 4QKOA 2BUOA 2AFEA 2GDXA 2KGDA 3CCSP 2JBGA 5I4TG 3HZQA 3CCMP 3CCQP 2PEJA 2FVAA 2PNGA 4F37A 2KG6A 1VQNP 2CWOA 1M6EX 2LKIA 2K92A 1N8RQ 2JAZA 2ERHA 2JO0A 2JU2A 2K0YA 1UNKA 1F80D 1GXHA 1EMVA 2L0QA 1VQPP 5CZDB 3DS1A 2FQ0A 3CC4P 2EIAA 1MZ8A 3RG2A 1CEIA 1ZNVA 4XFZA 2K94A 2XZ0D 2JYLA 1ACPA 4XFXA 3GZLA 1VQ4P 2AFDA 3I56P 3CCLP 3MGEA 3EJDA 1E6JP 2X2BA 3G6EP 1QRJA 4U0EA 1VQKP 1M90Q 2JGPA 1S72P 3CPWO 2FVFA 4PH0A 2VLPA 3G29A 2JYGA 2KOSA 1K73Q 2QNWA 2Z46A 1UJZA 4M0IA 3CCRP 5BS2A 3G26A 4PWVB 3DS4A 4CA3A 1AUMA 2LOLA 3RG6C 2M8LA 2L22A 3EJEA 1NQ4A 5KP7B 1AF8A 2L4BA 2KGEA 2LIUA 2Z45A 2P9XA 2CQ8A 3CC7P 3I55P 1K8AQ 2FQ2A 3CCUP 3GJNA 4U0DA 3H4EA 4XROA 2XV6A 2PEQA 1BAJA 3CE7A 3CCEP 2CG5B 1QVFO 1A43A 2FQ1A 3G1GA 1YITP 1Z6MA 2WPTA 1L0HA 4COPA 2K0XA 2MY5A 2FACA 5KP8B 1AYIA 3H0DA 2LIWA 4BPHA 2OARA 1VQLP 2N6YA 5HV8A 1Q7YQ 1VQMP 1HQBA 3G0VA 2M8NA 1NJIQ 4IZ6A 2FADA 2CNRA 2FHSC 2PEMA 1IUQA 2PEKA 1D1DA 2GDWA 2KGAA 3G1IA 1IMPA 3LRYA 2L9FA 1KLPA 2GZIA 3NTEA 3CD6P 3CMAP 1VQOP 1M1KQ 2KODA 5EJDA 1T8KA 2DNWA 2ROQA 1BXIA 3DS0A 2GZFA 2LMLA 1KQSO 2PEIA 4DG9A 3OW2O 1GXGA 2E1MA 4XFYA 2M5RA 7CEIA 2XT1A 1RO2A 2GDYA 2QA4P 1FR2A 4MRTC 5HGLA 3DPHA 5HGNA 1VHNA 2PY8A 5BS1A 2KORA 2VLOA 2JB0A 2N50A 2GZEA 1HY8A 4GR2A 3EJBA 1YIJP 2CGQA 4GR6A 1EIAA 2AF8A 2QEXP 2KOOA 4QNBA 2KOQA 5HGMA 4WYMA 1W2BO 3CCJP 1QVGO 2KG8A 1E0HA 4PH1A 1L0IA 3B5IA 1EOQA 2GYKA 3WBHA 1A8OA 3G21A 4NEOA 2JU1A 1RNIA 1YHQP 2FAEA 1IMQA 1Q82Q 4H2YC 3E2DA 3CC2P 2K2QA 2KW2A 2MVUA 2K0DX 1VQ9P 1GPJA 3DS3A 1VQ7P 1VKUA 2EHTA 2PENA 2KG9A 4R0MA 2MVVA 3G28A 2PEOA 2L6EA 2EFJA 2XXMA 2MR7A 1RO0A 5HGOA 3DS2A 3U43A 1K9MQ 3CCVP 2MR8A 1KD1Q 2K93A 4COCA
chains in the Genus database with same CATH topology
2JBGA 2WPTA 2VLNA 1GXGA 1UJZA 3GKLC 2VLQA 4F37A 1IMPA 1MZ8A 1AYIA 7CEIA 1CEIA 1ZNVA 2K5XA 1FR2A 3GJNA 2GZGA 2GZIA 4QKOA 2JAZA 1IMQA 4UHPB 2ERHA 2NO8A 2VLPA 2VLOA 2JB0A 1UNKA 2GZJA 5EW5E 3U43A 1GXHA 1EMVA 1E0HA 1BXIA 2K0DX 2GZFA 2GZEA 2GYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JBG A;  2WPT A;  2VLN A;  1GXG A;  1UJZ A;  3GKL C;  2VLQ A;  4F37 A;  1IMP A;  1MZ8 A;  1AYI A;  7CEI A;  1CEI A;  1ZNV A;  2K5X A;  1FR2 A;  3GJN A;  2GZG A;  2GZI A;  4QKO A;  2JAZ A;  1IMQ A;  4UHP B;  2ERH A;  2NO8 A;  2VLP A;  2VLO A;  2JB0 A;  1UNK A;  2GZJ A;  5EW5 E;  3U43 A;  1GXH A;  1EMV A;  1E0H A;  1BXI A;  2K0D X;  2GZF A;  2GZE A;  2GYK A; 
#chains in the Genus database with same CATH topology
 1YJN P;  2N98 A;  2FVE A;  4U0C A;  1Q81 Q;  4BPF A;  2KR5 A;  3VRL C;  5F2K A;  3HYB A;  4UHP B;  2OTJ P;  4H2W C;  1X3O A;  3DS5 A;  2VSQ A;  2XZ1 C;  2KGC A;  2ONT A;  4U0F A;  3GKL C;  2BHV A;  4HKG A;  2Z44 A;  1YI2 P;  5DCK A;  2N6Z A;  2KWL A;  1Q86 Q;  1OR5 A;  3P05 A;  4PXH B;  2N5H A;  3CME P;  1DV5 A;  2AVA A;  2K5X A;  3G71 P;  3NY7 B;  2KOP A;  4U0A A;  4XRQ A;  2LPK A;  2NO8 A;  4H2X C;  2GZJ A;  2OTL P;  3DTJ A;  2N5I A;  2LL8 A;  2JQ4 A;  2MF4 A;  1YJW P;  2VLN A;  3B4Q A;  3M1M A;  1VQ8 P;  2VLQ A;  3H47 A;  3LMO A;  1M74 A;  3G4S P;  1M6N A;  2LF4 A;  2LTE A;  4U0B A;  3GZM A;  5HVC A;  1DNY A;  1VQ5 P;  2MD9 A;  4IPY A;  3Q20 A;  1K30 A;  5JPA A;  4BPG A;  2EG5 A;  1VQ6 P;  1KC8 Q;  1YJ9 P;  5EW5 E;  2EHS A;  5KP6 B;  1ZMB A;  2DGY A;  1JJ2 O;  5F2O A;  3CXC O;  2M8P A;  5F2N A;  2GZG A;  4QKO A;  2BUO A;  2AFE A;  2GDX A;  2KGD A;  3CCS P;  2JBG A;  5I4T G;  3HZQ A;  3CCM P;  3CCQ P;  2PEJ A;  2FVA A;  2PNG A;  4F37 A;  2KG6 A;  1VQN P;  2CWO A;  1M6E X;  2LKI A;  2K92 A;  1N8R Q;  2JAZ A;  2ERH A;  2JO0 A;  2JU2 A;  2K0Y A;  1UNK A;  1F80 D;  1GXH A;  1EMV A;  2L0Q A;  1VQP P;  5CZD B;  3DS1 A;  2FQ0 A;  3CC4 P;  2EIA A;  1MZ8 A;  3RG2 A;  1CEI A;  1ZNV A;  4XFZ A;  2K94 A;  2XZ0 D;  2JYL A;  1ACP A;  4XFX A;  3GZL A;  1VQ4 P;  2AFD A;  3I56 P;  3CCL P;  3MGE A;  3EJD A;  1E6J P;  2X2B A;  3G6E P;  1QRJ A;  4U0E A;  1VQK P;  1M90 Q;  2JGP A;  1S72 P;  3CPW O;  2FVF A;  4PH0 A;  2VLP A;  3G29 A;  2JYG A;  2KOS A;  1K73 Q;  2QNW A;  2Z46 A;  1UJZ A;  4M0I A;  3CCR P;  5BS2 A;  3G26 A;  4PWV B;  3DS4 A;  4CA3 A;  1AUM A;  2LOL A;  3RG6 C;  2M8L A;  2L22 A;  3EJE A;  1NQ4 A;  5KP7 B;  1AF8 A;  2L4B A;  2KGE A;  2LIU A;  2Z45 A;  2P9X A;  2CQ8 A;  3CC7 P;  3I55 P;  1K8A Q;  2FQ2 A;  3CCU P;  3GJN A;  4U0D A;  3H4E A;  4XRO A;  2XV6 A;  2PEQ A;  1BAJ A;  3CE7 A;  3CCE P;  2CG5 B;  1QVF O;  1A43 A;  2FQ1 A;  3G1G A;  1YIT P;  1Z6M A;  2WPT A;  1L0H A;  4COP A;  2K0X A;  2MY5 A;  2FAC A;  5KP8 B;  1AYI A;  3H0D A;  2LIW A;  4BPH A;  2OAR A;  1VQL P;  2N6Y A;  5HV8 A;  1Q7Y Q;  1VQM P;  1HQB A;  3G0V A;  2M8N A;  1NJI Q;  4IZ6 A;  2FAD A;  2CNR A;  2FHS C;  2PEM A;  1IUQ A;  2PEK A;  1D1D A;  2GDW A;  2KGA A;  3G1I A;  1IMP A;  3LRY A;  2L9F A;  1KLP A;  2GZI A;  3NTE A;  3CD6 P;  3CMA P;  1VQO P;  1M1K Q;  2KOD A;  5EJD A;  1T8K A;  2DNW A;  2ROQ A;  1BXI A;  3DS0 A;  2GZF A;  2LML A;  1KQS O;  2PEI A;  4DG9 A;  3OW2 O;  1GXG A;  2E1M A;  4XFY A;  2M5R A;  7CEI A;  2XT1 A;  1RO2 A;  2GDY A;  2QA4 P;  1FR2 A;  4MRT C;  5HGL A;  3DPH A;  5HGN A;  1VHN A;  2PY8 A;  5BS1 A;  2KOR A;  2VLO A;  2JB0 A;  2N50 A;  2GZE A;  1HY8 A;  4GR2 A;  3EJB A;  1YIJ P;  2CGQ A;  4GR6 A;  1EIA A;  2AF8 A;  2QEX P;  2KOO A;  4QNB A;  2KOQ A;  5HGM A;  4WYM A;  1W2B O;  3CCJ P;  1QVG O;  2KG8 A;  1E0H A;  4PH1 A;  1L0I A;  3B5I A;  1EOQ A;  2GYK A;  3WBH A;  1A8O A;  3G21 A;  4NEO A;  2JU1 A;  1RNI A;  1YHQ P;  2FAE A;  1IMQ A;  1Q82 Q;  4H2Y C;  3E2D A;  3CC2 P;  2K2Q A;  2KW2 A;  2MVU A;  2K0D X;  1VQ9 P;  1GPJ A;  3DS3 A;  1VQ7 P;  1VKU A;  2EHT A;  2PEN A;  2KG9 A;  4R0M A;  2MVV A;  3G28 A;  2PEO A;  2L6E A;  2EFJ A;  2XXM A;  2MR7 A;  1RO0 A;  5HGO A;  3DS2 A;  3U43 A;  1K9M Q;  3CCV P;  2MR8 A;  1KD1 Q;  2K93 A;  4COC A; 
#chains in the Genus database with same CATH homology
 2JBG A;  2WPT A;  2VLN A;  1GXG A;  1UJZ A;  3GKL C;  2VLQ A;  4F37 A;  1IMP A;  1MZ8 A;  1AYI A;  7CEI A;  1CEI A;  1ZNV A;  2K5X A;  1FR2 A;  3GJN A;  2GZG A;  2GZI A;  4QKO A;  2JAZ A;  1IMQ A;  4UHP B;  2ERH A;  2NO8 A;  2VLP A;  2VLO A;  2JB0 A;  1UNK A;  2GZJ A;  5EW5 E;  3U43 A;  1GXH A;  1EMV A;  1E0H A;  1BXI A;  2K0D X;  2GZF A;  2GZE A;  2GYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...