2GZOA

Nmr structure of upf0301 protein so3346 from shewanella oneidensis: northeast structural genomics consortium target sor39
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
187
structure length
187
Chain Sequence
MESLQNHFLIAMPSLDDTFFERTVIYLCEHDEKGAMGLVINKPLGIEVNSLLEQMDLPTEQVSADLAMGSQVLMGGPVSQDRGFVLHTSQPYWANSTELGSGLMLTTSRDVLTAIGSKRSPDKFLVALGYAGWSKNQLEQELADNSWLTIPADHALLFDINHEDRWQQASRSLGFEAWQLSTQAGHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of UPF0301 PROTEIN SO3346 from Shewanella oneidensis: Northeast Structural Genomics Consortium target SOR39
rcsb
source organism Shewanella oneidensis
molecule tags Structural genomics, unknown function
molecule keywords UPF0301 protein SO3346
total genus 35
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02622 DUF179 Uncharacterized ACR, COG1678
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1300 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits VC0467-like domains 2gzoA02
3.40.1740.10 Alpha Beta 3-Layer(aba) Sandwich VC0467-like VC0467-like 2gzoA01
2HAFA 2AJ2A 2GS5A 2GZOA 2DO8A 2HRXA 2EW0A 2MUIA
chains in the Genus database with same CATH superfamily
3KLFA 1U49A 3W62A 1EETA 4I7FB 5LMNJ 4I4BA 3E51A 4GVBA 4DSFA 4FNHA 1TMJA 3PJWA 1HWUA 1WEZA 4C8ZA 2OTJS 3HDSA 4RW4A 1NH7A 3SDEA 4O4RA 4O0NA 2IYGA 2MQPA 3MEDB 4N8NA 4L6V3 4I67A 1GMVA 3QATA 1VQNS 4X4RA 3O2IA 2RU9A 2H65B 4V19X 1S1UB 3BO3A 4R0EA 2ZKTA 3GE9A 1R0AB 3GWCA 1RB0A 3FCVA 1RTDB 2AX1A 2HS3A 1IN0A 3LWMA 4R5PA 2JEIA 4C8MA 2C3MA 1YJWS 1I6JA 1JIHA 2XZWA 3EXYA 3MUVP 4X4QA 1NZAA 3ZZRA 2DO4A 1RTHB 3MFIA 2LU2A 1UA0A 2AWZA 5FLXY 1YRXA 4KJIA 1DTQA 4LF4J 4DR4J 3H40A 2O66A 2CZ9A 3KOAA 1TVRA 3ZO7A 1Q53A 4DV7J 1FI4A 4CH0S 5F8HA 4NWBA 2E1MC 3B82A 1IWGA 2B5JA 1KQGB 1PKUA 2HEKA 4URQU 4WP8A 4IOCQ 1VQMS 3OV7A 1VQLS 2FJBB 3CF5Q 1FXLA 3RYLA 4NEZA 3T5JA 2XYHB 2C2OB 1VBYA 1PC4A 3THTA 5CCMA 2BR0A 3TAMA 4JI5J 1HWKA 1NDLA 1U1MA 3JYTA 3OFEA 5D0HA 4DU7A 3K57A 2D3OR 2XMJA 2I6WA 4PQUB 1NSQA 1ZM9A 2VASA 4NI2B 2DD8S 1YZ7A 4XAKA 4A8WA 3UDVA 1UVIA 3PCOB 2YH0A 1JWWA 1FTRA 2BANB 2GHVC 4C0HA 1C1CA 3KK1B 1U6ZA 3M2VA 4CO1A 2B43A 2RQ4A 3AJ1A 3C66A 3GONA 1IUJA 3BN4A 3KK3A 2FC9A 4DX7A 2JLGA 2FVSA 2DO8A 4J9NA 1FESA 5KFTA 1TU0B 1FVSA 2WVFA 3PHTA 2HHWA 2KRRA 2L08A 1U1KA 4L72B 3F56A 9RUBA 4RZRA 1S10A 4M1KA 4KH1B 4LVNP 4ZCMA 1R0AA 2ZWOA 4OZJA 4WFYA 3NGRA 2V4QA 1TMMA 5J1PA 1JXEA 4J9PA 3FSYA 3MM7A 4ZPVR 5CZXA 4ZLLA 3GFYA 3TVZA 4LFCJ 4C3LA 4JYAF 4PG4A 2FHKA 4I7FA 5J2MA 1IBKJ 3MXHP 1UAWA 3HK2A 3IO1A 4IFYA 5KG0A 1FE4A 3V4IB 4NLUA 2ZBRA 4RW7B 4KO0B 2WSEC 3AA9A 3AOBA 3IR5B 3KLFB 1N88A 2E1AA 1D9DA 2CWXA 1JKHA 3PO4A 1R89A 2RUGA 2LVWA 2UUCJ 4F36A 1IKYB 1X4FA 5HQMA 1HHQA 3UW1A 1OQ3A 1SC1B 4LFBJ 4E2FB 2WOMB 5LXRA 5KG2A 2YTCA 2E9TA 2E9ZA 4UQTA 1UJ4A 4USTA 3VV2B 3EGWB 1BQNB 3OFGA 4YR0A 3ZFVA 2HK2A 4DL0C 5KFHA 3DI6A 4M5JA 1Q86T 2LDIA 2HHSA 1YDLA 2C2ZB 1BMQB 3D5MA 1PO6A 2BUNA 4GO5X 2DXFA 1OY9A 4V19J 3S6EA 1YJNS 2L9NA 2WONB 4IOBA 2H1YA 3CSKA 5D0EA 3W61A 2V8DA 3MR2A 4KKOB 5L38A 3BSAA 3GJSB 2W2NP 4PYDA 4G3IA 4DV1J 4EBCA 1CULA 3MMAA 4W92B 1JJ4A 1QJHA 4GMKA 2C2NA 3CULA 1YJ9S 3MM9A 3M05A 1IBMF 1VQPS 4B3OA 1DLOA 2HKEA 2FHOB 1D8YA 3C14B 4NCGB 4IG3A 2AJQA 2VG5A 3NS5A 4YFUA 4ERDA 2A6OA 3I82A 2JFDA 3R7NB 1WC6A 2QMWA 1WKLA 2YNFB 1RLDA 4HT7A 4DX8H 4LF8J 1U6BA 3UDEA 3A3PB 3VTIA 1X7VA 2U2FA 2HGMA 4DL3A 2JEJA 1HBUA 2XO6A 3OVAA 4DV5F 1Q8BA 1XR7A 3DM2A 1TKXB 1DLOB 1N4LA 1UZHA 5EGYA 2XC9A 1G3OA 4DCOB 2AQ4A 4P7TA 2LKZA 2AMCB 4KPCA 1BHNA 4OYOA 1ZAXA 1CULB 3MMAB 1NDPA 4PZVA 4CLKA 3DFEA 4PG5A 1C0UA 1PJ6A 2RMLA 2K06A 3D1OA 1Z1ZA 5IM0B 1OMSA 1SUQA 4YB1P 2R7XA 3RBZA 1URRA 2M52A 2XY7A 1UVMA 1QLNA 1X5OA 1JJ2R 2V8VA 4DV3J 2UU9J 1H74A 1HQEA 4KT0C 1H73A 3CJTA 2HLTA 1JXLA 4IO1A 3DI6B 1KVJA 3KK2A 4NPOA 3PFOA 4FS1A 1G6BA 4UY85 3NWGA 5THWA 4UY8T 3EXCX 3BPDA 1IBLF 2WOMA 4EK2A 3AODA 5KG1A 1KDNA 1KTQA 2RSQA 5L1JA 4M5NA 5IT9U 1IKYA 4FYXB 5DQHA 4B3RJ 4QU6A 1FXDA 5H9EJ 1R31A 3V81B 4JV5J 4ZDNA 4USUA 4DL5A 3AAWB 4KGXB 4OZ2A 2H48B 4RU2A 3ILIA 4ZN1A 2XMAA 1MROB 2JLFA 3NCPA 3DLBA 2VC0A 1HQ2A 2DGWA 2QA1A 4USJC 1NZ8A 1U09A 2CQ3A 2JL9A 3Q8RB 4IDKB 3Q23A 2HQCA 1H38A 2P5VA 1SXLA 4RBTA 4X4TA 2FZGB 2KVIA 3HJVA 4IDKA 3H25A 2AZ1A 3VAMA 3T5KA 1K0VA 2UV8G 4OZ5A 3EUNA 3NNCA 3UN5A 3PYEA 2CJYB 3ADAC 2NSBA 3QMQA 4PG6A 1UMJA 1IVZA 3LTOA 4ZCKA 1RGVA 3QGHA 1JLAB 3DU6A 3I87A 4GRSA 1HNWJ 1U25A 2HHXA 3G82B 2FGOA 2Z0GA 3MECA 1VGYA 2CRLA 2VQEF 4DL6A 3HZEA 4LMZA 1MMLA 2RD5C 3RU0A 4JI6F 4BS2A 2HVDA 1EQ0A 4ZVHA 3OXGA 3QJLA 3CDUA 3OR1A 1NK9A 4B9SA 2IM3A 1DQ9A 3ZZPA 4CNYA 4DMZA 3PIOQ 4A8MP 2VB6A 1FJGF 1TUVA 4WFZA 2HMIA 2RUSA 5KOXA 1MNEA 2FPHX 4B3SF 4NI2A 1NHVA 1WNEA 2FQQB 4RWWA 5CXTA 5K8PA 4DZDA 2VJUA 1SQGA 3DMJB 1X31C 3R97A 3SCIE 1K0TA 3DN9A 4M94A 2YVSA 4OZNA 4A4JA 3EYZA 3GIRA 4JI3J 2W1BA 1SUQB 3KFWX 2MDAA 4ZPDA 5L39A 2QGFB 1FVQA 1REGX 1C0UB 2PI5A 3W9IA 2GMJA 4BBYA 1TVRB 3J81Y 1RYSA 1RHKB 2OGUA 4WK1A 2HVEA 1G4CA 2F8MA 5KT6A 1EIYB 1T7PA 2JLEA 1DTQB 3DYAB 5K9FA 5HJYA 2DNOA 3ICLA 4A8XA 4N5SA 1J5OB 2DGUA 3H2LA 4WZMA 4RX6A 2R3VA 3CB4A 1NMEB 1HBUB 4OI0A 1V9OA 4Z7CA 4LSLA 3DOMA 3D1QA 4YB6A 1VQYA 2LXUA 2OKQA 1R7IA 5ETPA 5CABA 4TU8A 2VG5B 1DY3A 4DPWA 3K17A 2B8PA 2RQMA 2B0GA 3QPIA 1YQHA 2YKMB 2F1FA 1R6YA 4OJHA 2E29A 3B54A 3MR5A 4GVBB 1KLNA 3MEEB 4KKOA 3SIPB 3JQJA 1WF2A 3CCRS 4UQGA 1BXNA 2EVZA 2QV6A 4ZPAA 4J9UE 1TTHB 2J7KA 3C2PA 1H0HB 2HFNA 1AFIA 3AXKA 3H98A 5I4MA 2EKYA 4R0JA 2ROGA 4DV0F 3RTVA 4CO2A 1ROFA 3NRBA 1S59A 4PEOA 3I55S 4CDIA 2E1CA 1ZBTA 2QEXS 2LQJA 2VG6A 5A8WB 4J9QA 2PFDA 2V34A 3N0VA 3GZ7A 1NK6A 2HHUA 4RU9A 1RWKB 3J7AN 1VS3A 4ELTA 3OUYB 5IV3A 3V6JA 3IFEA 5SZTA 2JRSA 3BM7A 4LVOP 5KFYA 3QIDA 4U8VA 4WBFA 5A8WA 5B0CA 3MUMP 1NK8A 1H7WA 2Y8WA 4CQ1A 1I3OB 2E5HA 2MZJA 3AY0A 2QIFA 4ILLA 2OJ3A 3VGVA 1QY7A 2H5EA 3M6XA 3LF0A 3QNWB 1ZTWA 2O67A 4RW7A 4X4UA 2ZHBA 2C3OA 2POKA 4IFYB 4OX7A 5HVGA 4JI7J 1MN7A 4J9OA 1S6PA 1UWAA 2GVDB 2CQHA 3IBFB 3TJ8A 3AA8A 2AGOA 1QE1A 2YKMA 4MKAA 4EO8A 2DIVA 3VQSA 1JK9B 2H54B 1VDHA 1NO8A 2GVZB 2KT3A 2CADA 2EFOA 2EFNA 3AFGA 3G2XA 3KJFB 3MCOA 2P9EA 3MM7B 3NWRA 2FLPA 4FYDA 2F5GA 5F8JA 4Z37A 4DV2F 3N6MA 1S99A 4WU3A 4CLSA 3TVKA 1XMQJ 4FBUA 4JI1J 1DURA 2YPZA 1U1QA 4RUHA 2ZDPA 1FRKA 1XQIA 4K4UA 1VC5A 2MUIA 2P6TA 1X0PA 4FXVA 3KMSA 2RHQB 3ILLA 6FD1A 3KUGA 1GMWD 5GAHU 3THVA 2JC0A 1WTBA 2Q6BA 1RUSA 1RWVB 5M2PA 3G6YA 2O1PA 2Q43A 3KK3B 1RBAA 1UPPA 3M2VB 2BYCA 2W01A 2JVRA 2QA2A 1C1CB 2OPPA 2YKAA 2BANA 3K5OA 4P6QA 4DOZA 2H3EB 2XLJA 3KK1A 4IRDA 2Y8YA 4DR6J 4K5SA 3TA1A 4DEZA 3EMTA 2G2YA 4K4ZA 2XMTA 4NLWA 2KZZA 2EWHA 3CCWA 4PQUA 3JYTB 3DMJA 3Q0AA 2V9WA 4F25A 4U8YA 1YBTA 4ZVSB 4A48A 4C3KA 2R7RA 4HYKA 4ICLB 4K0KJ 2B5JB 5B0FA 2CVIA 3M2UB 2AYMA 3R1HA 2IMWP 4DV1F 3TI0A 3I56S 2DGXA 1QAJA 2EC2A 2GQ2A 4I64A 1RTHA 3MECB 2D7SA 2FJAB 3G82A 5A2QU 5KFPA 1LKZA 2XHCA 4QOTA 3R9LA 1SJ3P 1TAUA 2X3GA 2DNGA 3MOJB 2MJUA 4X65F 1S1UA 2LYVA 5KFNA 3BB5A 3HVAA 1F9EB 3PM9A 4O3PA 2R2TA 2GMLA 4LF8F 1Y5LB 3VAKA 2FTRA 3CWJA 2AJ4A 2HLUA 4QIFA 3MEDA 3VWSA 1Q7LB 2DNPA 1M5SA 3SDEB 4I56A 1KFSA 2VUGA 4UT4A 2XBPA 2Y3YA 3QT8A 3W7BA 1HBMA 2XS5A 1NPKA 1MROA 3M8ZA 4Y2KA 2UXBJ 1YRTA 3OT9A 4FPIA 4OYPA 3D3BJ 3D68A 3PW0A 3V4IA 2FLOA 4H4MB 1IKVA 3MPVA 3LOUA 3G96A 4M95A 3DGVA 2HRXA 1IXKA 3FJ2A 2RKIB 4C2MA 3V81A 1N8RT 2GAHC 2WVCA 2FJWA 3V6DB 3MCSA 5KFDA 1TZ0A 1FKPA 1BQXA 2O01C 3ILJA 4OYWA 4WFXA 2KG1A 3FQKA 2ZBQA 3EX7B 1RXOB 4N77A 4M5LA 4B3TF 3ZC4A 5GMKa 2UXDF 5DG9A 3CJKB 4I2PA 4MTPA 1YRUA 4Q8FA 4OHZA 2DTJA 1HNXJ 3ENQA 1L3KA 4DLEA 3KK2B 2HHTA 2N82B 2HBYB 3GR0A 1TQLA 2FDNA 3W66A 4ATNA 4JI4F 3CJSA 2RIJA 2XG8A 3BGRA 3IG1B 1HQEB 3TW0A 4Q43A 4OI4A 5A0YB 3C6UA 1D8ZA 2DNNA 2RHSB 2OTLS 4Q2MA 2D9PA 4Z7YA 3TEHB 3G6XA 4GKKF 2OSQA 2VFTA 1HBNB 3TAQA 3D0GE 4C3MA 4DG1A 2DO0A 1LXJA 2MZRA 1I51B 1R0BG 1X4EA 3MR7A 1SH0A 1NK4A 2B7BB 2CQDA 2W25A 3NXZA 1TKXA 1XK8A 4J9SA 3DM2B 1UW4A 2B6AB 1RACB 3A8JA 3QO9B 4IR9A 4JV2A 3NMRA 3BBCA 1NDKA 1HWJA 5CAAA 2CWKA 6AT1B 1N5YB 5AXLA 3HVWA 4YY3F 2DNMA 1FRMA 1CVJA 1LEOA 3KHRA 3C14A 1E6YA 3X3UA 1HHTP 2N7YA 2YBVA 3HHLD 4E8UA 3CD0A 1HNWF 4UOCA 3MM9B 1NJIT 1WC4A 1LW2A 2G2OA 1NXIA 3CJRA 3TZXA 2L9WA 4Y2CA 3AJ2A 4U6PA 5G4DA 4ZIVA 3OW2R 5DGAA 4F8RA 2W7AA 2WONA 4JOUA 5CYQB 3WDOA 2HGNA 2G9OA 4LF1A 4IOAQ 1CS4A 5AXNA 3IWNC 5JVHQ 5ETKA 1C4CA 2C3UA 3HFVA 5FIIA 4A8SA 5F0WA 1WELA 3IGNA 4FYVB 5DRKA 3M9NB 1SJRA 2HHPA 4DCPB 4BWMA 5AE2A 3VAFA 5HK4A 5B08A 2D41A 2ZC4A 4ZA1A 4C8LA 1TUWA 4KSEB 4WYLA 2GJIA 1K9MT 2H5JB 3HFKA 3M8PB 1JJHA 2EK6A 3L7PA 4YEAA 3HMJG 2J9CA 1J5EJ 2VDIA 4X66J 4E98A 1YHQS 1PBAA 1OJ4A 5BR8F 1YK9A 2WB4A 3DLKA 3A8EA 2DISA 3CW2C 1AW0A 2QA4G 1S9EA 1ZM3A 2MLXA 2HHVA 1Y5IB 1RA6A 2XTJP 4RW8A 4UTGA 2F7VA 3WX4A 1JKHB 2DRDA 2KYZA 2ZE2B 3M1VA 2WBMA 4G1IA 2E1RA 1AB8A 4IYQA 4KO0A 4WXWA 3U27A 3ULHA 1RWMB 4M5KA 5KG3A 2IFXA 2Y0BB 4CWBA 2PFFB 2MY8A 1WJ9A 2IRYA 5J2MB 1PILA 4PCQA 3TYTA 3JB9k 5JMNA 3W64A 2MQQA 3MHYA 1T9YA 4W90B 5F8MA 3UFCX 4XIUA 1FJCA 3AD9C 3H0PA 4KV8A 2NUUG 1HPZB 2HFUA 3OL6A 1TELA 1BD6A 4TN2A 5KFLA 3QSYB 2GQCA 2HSEB 5F0UA 5KFJA 2RRBA 3VZHA 2IVMA 1IJFB 3HD1A 4DQSA 4EZ6A 3UN3A 2AP6A 3TWZA 5BJRA 1XJWB 5KT7A 2BQUA 4RNMA 2I2YA 4Y2IA 3GSIA 3M6UA 4H4KA 2KG0A 5H1SV 1LFPA 1SQEA 1YJUA 3JTOA 5EDWA 4AL7A 2BKPA 5D4NA 4J7CA 3UD4P 3BF4A 4R25A 2JVOA 4EFAC 3AHPA 4KHPF 2RF2B 5DLFA 1U2FA 2Q1LA 5D4PA 4TU7A 4ED2A 4Q0BB 2WW4A 1CLFA 3HKWA 3MD1A 5DM6Q 2WZ1A 4RBUA 3PTWA 4QYRA 3Q8QB 1C1BA 2IBOA 5E3QA 4R8UB 3DOLB 2ASJA 2CNNB 3PRBA 4LT6A 1NSKL 2UUTA 2H51B 3TARA 3R7BB 4J90A 4EUVA 4X66F 5EUHA 1DZ5A 3FBBA 1S0MA 3CDAA 2J76E 2RNEA 3TAMB 3Q8VA 3PZPA 2NZ4A 2XI2A 2DKOB 3SYZA 4FPRA 2BRKA 4OI6A 1LXNA 2C3YA 2Y0SD 5E3CA 1RTIB 2ZH1A 1U1PA 2KFYA 2XS2A 4UUWA 4CLFA 1H3DA 2JWNA 4YDXA 5GADU 1K8AT 3FMWA 2MKJA 3NS7B 2KFZA 3IMQJ 4ZJOA 1RAAB 1KQFB 4ZKAA 4QR1A 1N34J 1EKSA 2QFIA 2Z2MA 3OXFA 4OL8A 1N5SA 2YKNA 5HROB 2E7XA 1M1GA 3PYGA 4KTQA 1VJQA 1X60A 5GAEU 2ROPA 2JHEA 4MKBA 4AD6A 4R5PB 2XY6A 3VVUA 1AROP 5DQIA 1K1QA 4DV2J 4QJVA 5IQQA 1RTDA 4ELVA 4OLOA 5FDLB 3GCXP 2XM3A 4IUFA 3FUYA 3V4MA 3G6VA 2VPZB 1FXRA 3AQPA 2V8PA 3EICA 3ILOA 4ZVUB 2W7OA 2DEIA 3KLGB 3EGNA 3E3XA 1SVDA 4RW4B 3TUPA 1VLOA 1L3VA 5HN0A 4ETZA 1NSPA 5K14B 4HHUA 3PX6A 1LFWA 3CC7S 2KRBA 1U1OA 2E44A 1EETB 1SQFA 2I9SA 3GJRB 1KQSR 3MMCB 1XBWA 4DR1F 2YX4A 1SPBP 4LBIA 3EVWA 3JAMU 4YDDB 1F3VA 4AXJA 1K44A 4H4OA 2ZD1A 5IT0A 2LDYA 4HVZA 3THPA 5KG4A 2F63A 3C8YA 4JI6J 1JLBA 1FKOA 3VGTA 1F5BA 2QT7A 1F9FA 2ZM6J 5K20B 2ZWPA 3CJ3A 3CD7A 4WWSA 2QSWA 3R5CA 5E2QA 1S1XA 2P8IA 3ET6A 4U9RA 4MT1A 1AUDA 3CT9A 5AXKA 3OR2A 2HZAA 3AXMA 3UPFA 2K7JA 1HLWA 3PW2A 4C8NA 3RRHA 4NXNJ 4Q8EA 1GQEA 1FDBA 4LIWA 2W24A 2FHJD 4YOEA 4OHYA 2HVHA 4DSLA 1U0HB 5ETMA 2ZDOA 2BE7D 5A8RA 1NPPA 1RT2A 2AJ1A 2LEPA 3Q8YA 2IVFB 4ES2A 1X9WA 4NYZA 4IFVB 3L95X 3M30A 1PYSB 3Q89A 4K50A 4F4ZA 1TK5A 1LK5A 2Y9HA 1CJKA 1SBRA 2PEBA 3H2VE 2M5YA 3GILA 4DL2A 2EFPA 2OH2A 1DFDA 1AFJA 4ECQA 3DLEB 1U0SA 3PX4A 1CJTA 5ITHA 2ZEJA 5B0GA 2I5JA 1FX2A 1CPZA 3GV7B 4S0MA 1RHJB 2GO8A 5JUMA 3QT6A 1RAHB 2KI2A 1Q1KA 4ES1A 1JXVA 4TYAA 4O3QA 2HAFA 2EG2A 4RPFA 1LWFB 4ETXA 4B17A 5IWAJ 3T1HF 2UUAJ 2B51A 1SC3B 3AT1B 4FZVA 1RWNB 4KH0B 5CQGA 1SKWA 5E3PA 1T9UA 4OYXA 3D4JA 2RILA 4TXSA 4WIIA 5HVFA 3RBXA 1HNXF 1Q8LA 1SH3A 1DTTA 4OYMA 3K59A 3K8WA 2CPDA 4K4XA 2ZZNA 4PXDA 2E7VA 3EPIA 3J7YI 2CJKA 4O3SA 1ACMB 2HPUA 4J9VA 4CH7A 3CE8A 3DRPB 2GW8A 2MKSA 3DGPA 1JB0C 3IM9A 4X62J 3OTOF 3NS6A 1IJEB 3IAS9 2V4JB 3GFHA 4NRUA 2N3OA 2XLKA 3W5XA 3C16A 4ID8A 2OPQB 1OPZA 1RAFB 1IKWB 3OLAA 3CXCR 3B6BA 2Y1JA 3SI8A 5DO2A 1GNKA 1JQGA 2DK2A 3UCGA 3Q2SC 3WIUA 5LJ3Y 3BS9A 3KLHA 3MPYA 3CCES 2BE2A 1TL7B 2FGCA 4OJGA 4WP9A 4F50A 4MFBB 3CDWA 1T9WA 1WKKA 3QGGA 1R0CB 2MTLA 1HNVB 2DJWA 2DNZA 3D3CJ 5E0OA 1NAQA 1VOMA 2Z2LA 3B4DA 4KBIA 4WFAQ 4DR3J 5HVHA 1HNIB 2FD2A 2C2EA 2ASYA 5G0RA 4DU8A 2IBKA 1WORA 2OUGA 3RUBL 3H4BA 1RT6B 2EW9A 2WTFA 1DAXA 3MAQA 3GR1A 4OV6A 4KPYA 4CYUB 4ZPTR 3UI3A 1T3OA 4NMLA 3N5FA 1MMDA 3TUJC 2OIHA 5C5JA 1REVA 5ADZA 4U95A 2FJDB 1TKTB 2KJVA 5D8HB 2HQFA 3U7JA 1M1HA 3BN7A 2XO7A 5DDPC 1ZPVA 2R8GA 3MMBB 4CLWA 1MSWD 2NXEA 1IBLJ 2DGQA 1S97A 4PUOA 5IT9Y 3PFEA 5B09A 1Q16B 1VJWA 2FC8A 3PDNA 4M5DA 4CNZA 3D1HA 5IFMA 2PA8D 2ZH8A 2RAQA 4QIVA 3SQGA 4N41A 4ILMA 3DLGB 2G2ZA 4A8QA 4DR6F 2XZDB 5J2PB 1HR0J 4X62F 4P73A 1TL1A 1IBCB 1M5OC 2XYGB 4ED5A 1HNZJ 3Q86A 3SXLA 2YKPA 3M2RB 1WUUA 4A46A 4RNNA 2HZVA 2UU9F 2K1RB 1RI7A 4YR3A 3GIJA 4TLQA 3NBPA 3W63A 2D69A 4UZBA 3P4UB 1K1SA 1JLFA 1Y5NB 3MMJA 3CCSS 2LQ5A 4I0WA 5C25A 1FERA 2UZAA 4JI0F 5HL7Q 3NGDA 1V6HA 3T5LA 4DX6A 4XTTA 2VF3A 4U96A 4WKRA 2B9YA 1U2CA 3BGFA 3T41A 3LPEA 2YXLA 4M5IA 3QRQA 4OQJA 2E1PA 2MZTA 4O23A 4MYUA 1OYEA 2GA7A 3SSRA 1S9GB 1UP1A 2ZBPA 1HYSB 2B4PA 4NL5A 2XWXA 4B08A 1PJ7A 2RT3A 3OSNA 1RAJA 5J2QB 3PR5B 2VQEJ 2VIHA 1F2GA 1EKRA 2BZ2A 2ZH3A 1FNOA 2D3UA 1IBKF 2DPJA 3CO0P 3KKFA 4LSNA 3SMZA 2OPSA 1J27A 2DGVA 3MF5A 4G1PA 1XR5A 4DV7F 5HLFA 5A8KB 4DR5J 4OMFG 2UXCJ 5LOQA 1RT1A 3I5AA 1D9AA 1SKRA 1HBOA 1FK9B 3HHLC 2HMIB 1Q78A 4LREA 1RT5B 2RQKA 5BYRA 1SKSA 2UUCF 3E2EA 4YR2A 3K7RA 4ZITA 4KGZB 3AOAA 2YNGB 3FVYA 1VI7A 3QBCA 2CJXB 4IH5A 4C0OC 3T9ZA 2N7CA 4CLLA 1SL0A 3HD2A 1J2VA 1S6UA 1R43A 3TR5A 2CQ4A 1X5PA 3NP5A 4K59A 3E01A 4M5HA 3FEYB 4JI3F 4Z2XA 3PEJA 1ITPA 5B0EA 1WF0A 2GJ2A 8AT1B 3ENWA 3K5NA 4ECSA 4HI2A 2RDDA 4DF4A 1UPMB 1ZS6A 2HRUA 4NA2A 2DY1A 4PXEA 4AXIA 5BXIA 2VHGA 2K2PA 2W2MP 4OX6A 2IPOB 4NLYA 1MLAA 2M0GB 3M8YA 3OLBA 3PX0A 3D6FB 1FJGJ 1PYOB 4KGKA 2DPIA 1S1WB 4C8KA 1IR0A 4OZLA 3W5YA 4F4YA 1X9MA 2QLJB 4C8OA 4IH6A 2R2UA 4AQYJ 1TKDA 1TR0A 1D0EA 4JI4J 3IS9B 4O3RA 1F0XA 2D1CA 4DFPA 2AJ0A 3SV4A 2F4FA 4PAAA 2HBZB 4Y2MA 3MCNA 4Q2LA 3DC2A 1LW0A 5CCLA 5J1EA 2R8HA 1UFKA 4LFCF 5EX3A 3JSRA 4URSA 1VQ6S 4CO3A 2DT9A 2UXCF 5I3UB 3IA0A 5ETSA 2ZH2A 1CJVA 3S01A 2KB2A 1U8SA 4EU0A 1VYAA 4FF4A 4NLDA 3T3FA 4LQ3A 1RT3B 3D6HB 1JLGA 5K5MA 1YBAA 3RW7A 1ZM2A 4K7QA 5F3ZA 4ZPBA 3OQ2A 1CC8A 2VPXB 1G1XA 1BC6A 3GFXA 2JEFA 2M3DA 1BGXT 4WU2A 2XULA 4HL9A 1N0UA 3D0IE 4CLZA 3HM9A 3ZTRA 2NQPA 4DV3F 1TL5A 1NHKL 5D0RA 3Q22A 4X4VA 4FBTA 2OPRA 5HQ8A 2HFSA 1U7LA 3I0SB 4M8LA 4PWUA 4TNOA 3TA0A 2HNYA 2V69A 4FXWA 2J7UA 3PNIA 1KFDA 3UDCA 4URGA 4ER8A 2ERRA 1QAYA 3CMES 2VL1A 1JLCB 1QDUB 1YJVA 1PSDA 5BYSA 4F7VA 2BV3A 3JSMA 2VFUA 1T9VA 2OEMA 4WE1B 2IJRA 1Y7PA 1IR2A 3J7YU 2J9DA 5HATA 5KFEA 3QLHA 3CUNA 2FLNA 3UCZP 1IKXB 2UUWA 3NNAA 1YJRA 4MIAA 2MB0B 2KZMA 1OWXA 4ZVGA 2E5IA 2EC0A 1B0TA 4KR0B 4ANDA 2G0IA 3BSOA 4IG0B 1NKBA 2PIIA 2CNOB 3S7RA 2OSRA 2O5DA 3GU0A 2DH7A 4P10A 1VK8A 2MYFA 1IBMJ 4ECYA 1W2IA 4HHJA 1FD8A 3M32A 5KFFA 2LEAA 1WEXA 1VCTA 2ILZA 2PD1A 1TL4A 4P75A 2W9BB 4FF1A 5CYJA 2LECA 3QRRA 4KGVB 2ZH7A 3GG1A 4DV4F 4ZLNA 1XC9A 3KG4A 5HMXA 1LOUA 1R6VA 1VRTB 3DRSA 3HFZB 5J1NA 5LSRA 4LF7F 3N6NA 5HMZA 1GMWA 5HBMB 4L75A 2FUG9 5CHCB 5ETLA 5DQGA 3DXBA 4QYZJ 4KRWA 4RW9B 1BQMA 1UFLA 3L09A 1Q81T 2VA2A 2ZBIA 3CC4S 3MEGA 1RZMA 2IA0A 4IQXA 4DN0A 2P6SA 2ZH5A 4LUBA 3R5GA 4P2FA 2FHMA 3DLHA 2C28A 2HW3A 3SFGA 2IM1A 4MKVA 3FGVA 3QWUA 4WTYA 3WQPA 4ED0A 3RAQA 3BDPA 4M5MA 1S57A 5KOWA 1SJ1A 4LF4F 2M4MA 2VBXA 1NB2A 1WOPA 3QIPA 3IR6B 2HQIA 5JXSA 1RCOB 1WC3A 3KJQB 4DZ6A 1KONA 1N33J 4Q45A 4OHXA 2OEJA 2ABYA 3EZUA 4EEYA 4PABA 1Y9OA 3W2WA 3I9ZA 2NREA 3CMQA 2MKIA 1F3FA 5IC4B 3KDNA 5M2RA 1FT8A 3HXMA 4WZQA 5GVQA 1KS2A 1R8PA 2X3DA 2Z56B 4OYZA 3GQCA 2MGZB 5KFWA 4GVLA 3NMAA 1NHUA 1U24A 1H2TZ 2DNRA 3N9UC 4LIRA 9ATCB 2AGQA 4TY8B 2KVQE 4JV0A 2CZ4A 2LQ9A 4K5RA 2W4CA 2KHCA 3M4XA 4YB5A 3VF0B 4YMEA 3OBIA 3P96A 5LXYA 3KJVA 2AKWB 2CG4A 2G1DA 3M8QA 4EGLA 3KHHA 2LQ8A 4LF2A 3SFUA 5KFGA 4C48A 2G4BA 4YQWA 2QL7B 4NMXA 5JVGQ 4DV4J 4X65J 3C46A 2YKOA 1WF1A 3TO8A 3N6LA 3HHLA 3JQKA 2CVEA 2M2BA 5CA5A 3Q2TC 3BZQA 4H4KC 1WOOA 3TJAA 5L1LA 2VBZA 3QZ8A 4K0KF 3C3LA 3JSBA 1QUVA 1VLYA 2ZOFA 3FBFA 3L7OA 3PEHA 1RT4B 3RJMB 3L7UA 1KOOA 3MTKA 2CQGA 2IIHA 1RHUB 4O44B 5IT4A 2DNQA 4Y00A 3UVJB 4A8KA 2X7IA 1P1LA 1Z4UA 3F41A 3RG6A 4ECWA 2YX7A 4ZLJA 2JOQA 2GFFA 4B9MA 2WB1D 2LXFA 4QZVB 2IHR1 3NGUA 1YKWA 5L1IA 2MLYA 2LA4A 7FDRA 2AJFE 3MPUB 3TZYA 2F8EX 3LANA 5KFVA 4QCLA 1URNA 4CI0B 1GH8A 2KU7A 2W8LA 2N4CA 3EGZA 4WFNQ 1UEVA 2I0XA 2JJ4D 4DR7J 3F44A 1B3TA 1RKIA 4EO6A 2IAJB 3H42A 5CD4H 2MZQA 4HT5A 1U48A 2CQBA 5T14A 3GYXB 4LFAF 1YI2S 1FWKA 1RT7A 4WKYA 4NLTA 3V5RA 3Q83A 1FA0A 1WEYA 3V2UC 3EZ5A 1NNDA 3TAPA 4CO5A 5C42A 2R2RA 2HNDB 1UETA 4UF4A 5LL6d 4F0KA 1SIWB 1TAQA 5DZ6A 2X1FA 2UUBJ 4BWJA 3FFIA 1Y11A 1T95A 3PJ9A 4J91A 4TQSA 2MLZA 2HHHJ 4CTAB 4F3QA 5GAGU 1TL3B 3KNAA 2V2QA 3IXQA 1N36F 4F02A 4HH1A 3T6BA 1H98A 4LF5F 3CD5A 2MPUA 2X1AA 4X2BA 2NUHA 2GHPA 3W2VA 4HDHA 2E66A 3MM8B 3MM5B 2ZH4A 1EP4B 1SV5B 1WG1A 3HSGA 3UNYA 2M88A 3CDEA 3BJYA 2J0QD 2LA6A 1APSA 1T03A 4EWTA 1CQMA 3IAM9 2CXEA 2BKOA 3BBBA 2EEYA 2MQLA 3T19A 2XCAA 2QLWA 2HRTA 4G1QA 3KJNB 1D09B 4G6VB 4BC9A 4ID5B 4WYWA 2WW8A 3I6PA 4CO0A 1NK0A 2E5JA 2WHOA 2V9KA 2YNHB 3BPSP 1VQ8S 4C11B 1KKHA 3MEKA 2MXYA 1C0TB 2IC3A 3TNVA 3D6MB 1RLCL 2K3KA 3EDRB 4L3KA 1S49A 2YWHA 4LFAJ 4NYOA 3ITHA 1ZYQA 2V6AA 2CZVC 4KFBB 1CJUB 3BSNA 5E5NA 2NPIA 2V63A 4O3NA 4X4SA 2AX0A 3I0RA 2R8KA 4QWEA 2DHGA 1C4AA 5IWAF 1LWEB 1AA1B 3KUHA 1NK7A 2IA6A 1JLQB 4QW8A 4CLYA 1NSAA 2RH3A 3GMGA 4ZCLA 3ZTQA 2F4VJ 2BMBA 1TKZB 3C6TB 3WX8A 3POTB 4QBUA 4O4GB 4UOFA 5B0DA 1KLMB 1UVJA 3QJJA 2DYAA 3UCUP 5KFUA 4QW9A 3DU5A 3W5ZA 1SC4B 2GNKA 4PPDA 4LF5J 4HKQA 2Z4PA 2HWIA 3OFHA 5LM7E 4N8OA 1KNZA 1P1TA 3H8YA 1FFWB 2DH9A 1ZETA 1ZA1B 1LK7A 2HFVA 2IM0A 4YHHJ 4GKJF 4PRFA 1T0TV 2X51A 2YQ1A 3BGLA 3NGKA 1JLEB 3KLEA 4DLGA 5D3GB 1N48A 5KFCA 4C4WA 3OJUA 5HP1B 1ZPWX 2RQCA 4K4TA 1XMQF 1RK8A 1NBEB 4OX9J 1HW8A 5C7PA 1XNQF 3QJPA 4WPAA 5HP1A 4ZVTB 3PW5A 1S1VA 3MAAB 1VBXA 3DCAA 3KXDA 5DS7A 3GTYX 2CPEA 4RUAA 2LQBA 3TP2A 1QSSA 5EWFA 3OTEA 2FY1A 2FIUA 1NUEA 2A10A 3DKDA 2MZSA 2C1EB 1H7XA 3ZXWA 2D3ZA 1SJFA 4LBPA 1UCNA 2GS8A 3KWMA 3QZ7A 1KOHA 2MEWA 3NAHA 4NOHA 5KAKA 5I42A 3UR3C 5KFBA 1N56A 3POTA 3C6TA 1TKZA 3DLLQ 1HQUB 1RTZA 2ATLA 5CYMB 1OY8A 1UWBA 1QTMA 4PXCA 1N6QA 4DDFA 3MPDA 2XMUA 5IXUA 2XSJA 1UVLA 2HHQA 4DI6A 2R7TA 2COLA 2BA9A 1B99A 3I0RB 3M8SA 1NM2A 2YNIB 3CCMS 3QAEA 2W2OP 4DPTA 4KFBA 1WSVA 2ZVSA 2NR0A 2AF6A 3DOKB 3BYPA 1MU2A 2QL9B 2VFSA 4HACB 1ZOTA 3ZTPA 3W9JA 3BGUA 2PSZA 3LP1A 2HIQA 3LP0A 5H9FK 1XIQA 4XDDA 5EX0A 3PXGa 3TOQA 2KHDA 3NKYA 1XN9A 3NGTA 3NNHA 2L3MA 2F8HA 2D9OA 3A3NB 3CJ2A 3H90A 1FRLA 5A6PA 2ZFHA 2V5HG 1S0OA 4ZVFA 1Y0HA 5IOLA 2F9JA 2MY7A 2OEKA 5J2NB 1HD1A 3LALA 2W9CB 2RS8A 3W8PA 2ZZTA 1NJXA 1Q82T 2D3O1 2B9XA 3IRXA 5KFAA 3SSQA 3MM5A 4JI0J 4WP3A 2BM0A 1VQ7S 3OVSA 2H4WB 4JV5F 3M8RA 2DHAA 4ED3A 4PYAA 2ACMA 1RWUA 4DUYJ 2XI3A 2GO9A 3KLIB 3VCDA 1ZM4A 1UFWA 1LQ9A 1TV6A 5DJBA 2QX0A 1QAXA 3HVRA 2VD3A 1CG2A 3SQOP 1O8BA 2C2KB 5L46A 1SJ4P 3UDLA 1VRUB 3FFIB 4ZVOB 4ES3A 3UQSA 2QL5B 2VKRA 3PRVA 1RTJB 2DBBA 2JNJA 1WD6A 3EDQB 5C24A 3CJ0A 3EPGA 3CMAS 1VMBA 2HNDA 1WDDA 1WC5A 1RWWB 4KIAA 5D4OA 5C42B 3KYLA 2ZJPQ 4DF8A 3H5SA 3LO3A 2BJDA 1N5TA 4MK9A 2M9KA 2VC1A 5IQ6A 4DR5F 4B3TJ 2UXDJ 3PO5A 2HQ3A 4U67Q 1TUGB 4PWDA 2B3TB 4B9UA 3OVBA 4I6WA 4ZHRB 3UD3P 2HURA 2BX6A 1AUSL 3LUYA 4B9VA 3L3CA 2VDHA 2XSFA 1FWLA 4N47A 1PJ5A 4OLPA 3LAKA 4U7UK 1RBLA 1UVKA 5DM7Q 2KT2A 2OI2A 2WBRA 3BKUA 3QYYA 2JDJA 2Z2ZA 4ZHRA 1WTFA 3A1YG 1T94A 3RB4A 4Y2AA 1KVIA 2A0FB 4DS4A 3GFZA 2NXCA 3WC2A 1TP7A 3JS9A 1MWZA 2PMZD 2PA3A 3BQ2A 3MWBA 5BR8J 1AZSA 2BJ1A 2XEXA 2UV8A 3LGHA 3H7HB 4NA3A 5KFIA 2GC8A 4MJKA 3GV5B 5CD4A 4NCAA 1X5TA 1NCLA 1RDRA 4ZMMA 1H2UX 4W4MA 2DR7A 2HNZB 2VG7A 3DRRA 3NOGA 4ZOSA 1OYDA 1VRUA 3IBWA 4X4OA 4MIWA 4I2QA 1R8CA 2DR6A 2V50A 3DHXA 3HVTB 1S79A 4RW6B 3LWLA 2QFJA 3TANA 5H9FJ 2UVWA 1QTNB 2N3LA 1M5HA 3N4WA 3TX8A 4ILRA 3H4DA 4X64J 2W4DA 3NCRA 3LP2B 2HFOA 5T7LB 1VQSA 4L74A 3G9CA 2HBQB 1HMVA 1SIZA 2VFVA 1EARA 3QT7A 3ZZZA 1KD1T 2ZH9A 4O3OA 1Q5YA 3FZ2A 3RZAA 4FNIA 4HTJA 3M8QB 4JI8J 3MM6B 3BQ1A 4P52A 4FP9A 2CJQA 4NASA 4AUKA 5F9NA 3F73A 4DR7F 4F3OA 3KTQA 4P7VA 2K3IA 3N5BA 3R2DJ 1XMBA 3VQTA 2WK4A 4X4PA 1ULRA 4RNHA 4HACA 1Y3KA 5KFOA 4CCHA 4RLEA 1S7IA 1JX4A 4FXDA 4TLRA 1S1TB 1P6TA 3M6VA 4N7TA 4FYWB 1S1TA 2PO4A 3W2WB 4YS2A 3CCVS 4EBDA 4KC5A 4C9DA 1GXLA 4HR2A 1J5EF 1DBDA 4F2RA 5E3RA 3EZOA 1NB7A 5LJ5Y 2XSJB 1RKJA 1Q8KA 1IWAA 1I94F 3R6GB 4ZVPB 3S8SA 2QN6B 1MWQA 5ETQA 3WBZA 4OYBA 3A8KA 3EM1A 3OD2A 2VPWB 3AD7C 1HI1A 1OQ6A 3FC9A 1B70B 3ZZUA 4F67A 5IS2A 3DDKA 2HQGA 4C98A 5A2QY 4NXMF 5I42B 1RISA 4JP8A 2DCLA 2GAGC 2A3JA 7AT1B 3A8IA 4WXOA 5ETTA 2OMOA 3MPWA 1YG0A 3O1LA 5RUBA 1SCJB 2LCWA 3GIKA 2DXDA 3OXLA 4RW9A 5DDQC 2UP1A 1S12A 4P2MA 4DUZJ 4J9LA 1U02A 4FKYA 3OTOJ 2ZHOA 1RWOB 3GCWP 5MAOA 1UJ6A 1QVFR 4F04B 2XZTB 5ETOA 3D54A 4W98A 3CTRA 1HL6A 1M90T 4KE5A 2GJFA 3MAHA 1RABB 2H9ZA 4I2QB 2VOOA 5C2CA 4DHVA 5L8RC 3X1LB 6FDRA 4F4WA 2AV5A 2FJEB 3DRRB 4Y3CA 5D3GA 1LV5A 4IQMA 4NEYA 1BUXA 4OYAA 2DY9A 3FEZA 4E0DA 4IG0A 5MLCV 1U2RA 1EB0A 1WHVA 4USKA 3J81j 1EHWA 4QQBA 4KGMA 2UXBF 1AZSB 3D67A 3Q8PB 3ONQA 4BCAA 2KL8A 3KMQA 4PR6A 2EFGA 2HVZA 1X9SA 2XMMA 2WVBA 1LNQA 2GIFA 4DQIA 4ANCA 2W8KA 1GEHA 1U47A 2ATCB 1QAIA 2BKNA 1E6VA 1FRJA 2BJ8A 4J37A 1B0PA 1FFGB 2V68A 2VFRA 3CNQP 5E7OB 4F26A 1FRXA 4F4XA 2KDOA 4ED1A 4MYTA 3BO4A 1S4EA 1CBKA 1LWEA 1TK0A 2RE1A 2XMVA 1XERA 3C15A 4TYBA 4ECZA 1JNRB 2ZM6F 1UEUA 1T05A 4ZPWR 4IH7A 4ZJLA 2F4VF 2H4YB 1CJUA 1GAOA 1TK8A 5DDOC 1FDDA 2B9WA 5LSLA 3CD6S 3ITHB 2JEGA 1LWCB 1RE1B 1VQOS 4L73A 2CQ0A 2GX8A 3O44A 4ENOA 4FF3A 3PW4A 4DCJB 1W2BR 2XMKA 1I5OB 4O0IA 4J9RA 1M5VC 1DARA 5D6GA 1HHSA 3AQOA 1FE0A 5KFRA 1GX5A 2MKKA 2V2ZA 3C19A 4HDGA 2G1HA 2GGPB 3PVXA 1GTEA 4DQRA 1N5QA 4G1QB 1TV6B 4ZP7A 2FLLA 3KLIA 4NLVA 2NXJA 3ETMA 1A7GE 1HIYA 1S6QA 1KN6A 4I6AA 4Y65A 5KFXA 4AT1B 1NJZA 3R2CJ 1VBKA 3ZTSA 1EP4A 1SV5A 1WC0A 5E3AA 3MR6A 3I4PA 1S0VA 1OO0B 1WKJA 2GIQA 1S6QB 3IS9A 5EWEA 2KH9A 3MFHA 3GV8B 3DNCA 4BLGA 1NKCA 3CGIA 5J2NA 4G65A 4WFBQ 1RAIB 4ANEA 4DQPA 1JJCB 3J7ZT 1TL3A 2CPHA 8RUCA 3BO2A 2CPYA 2FHJA 1VHFA 2GGPA 4NLXA 4D3HA 1NK5A 3CEDA 2BBEA 1N54B 4XPEA 1S76D 2QC3A 4U7CA 3ISZA 1SL2A 3LP0B 5GAHI 2QTWA 4CRJA 2R7QA 1WSRA 3LP1B 3JXOA 3PR4A 3LA0A 1U1RA 1PAUB 1S7HA 1LWCA 2IYIA 4TKTA 5KT3A 4JI2J 2BOPA 2KFNA 4MH8A 1X5SA 1HI8A 2CDRB 5E33A 2XYPB 3E01B 1RT7B 3KNGA 4DPUA 2ZJQQ 2W9AA 2YNIA 2C22A 5IV4A 3HHNB 2DXEA 2OFHX 3I4HX 3PHEA 4NZ0A 1F5AA 3FKBA 3B8HA 3OHBA 2LEBA 1T05B 3C15B 3MUTP 4JI5F 3I96A 3GSDA 1C2PA 4WF9Q 2OLWA 1PIEA 5B7WA 3LPYA 4NXNF 3T5HA 4F4AA 3MURP 4B9LA 5HSPA 1U45A 2BACA 3HHDA 1E6VB 1HQUA 4IKAA 1G7CB 2EI5A 2BW7A 4DPXA 3VVTA 1Y4ZB 5A8KA 3BKFA 2V0NA 1Z2LA 2OPSB 4HH0A 2RS2A 5DZ7A 2C2DA 3SSSA 3N79A 3HLUA 1OIAA 3E8OA 5T41A 3RRGA 2E5GA 3P8BB 2B56A 5J2QA 3P6YC 3PY8A 5KT5A 1HFEL 2KM8B 1X8DA 3WIVA 3GIIA 3HSZA 1FWPA 1S1VB 3MAAA 1NKEA 4MKYA 1QSLA 1SI9A 1UW9A 2HGLA 3TVYA 3IN5A 2B7CB 3UVJA 4DR3F 2PI4A 4AFFA 3P45B 3B78A 4EBEA 3FRYA 1L3TA 2CQCA 2EK1A 4JUZA 2ZBCA 4RUCA 4IRCA 1VFJA 1RHMB 1WG5A 1SKUB 3ISNC 2B9EA 3H5XA 3UO0A 2J8AA 2K1RA 2VKZG 2UUAF 3M2RA 4DFJA 1KLMA 1T9XA 4O4GA 2BXJA 5F8LA 1JMTA 2CYYA 2OHDA 4FDFA 1DQ8A 3B4MA 2OD4A 4EI2A 2EBGA 3DLGA 4QWCA 4DL4A 2DR8A 4TY8A 4PPZA 2GCFA 4KY3A 2MGZA 2MKCA 3JQMA 4PUOB 2AD9A 1Q8IA 4LFBF 3VGSA 1YGYA 1B0VA 3BKTA 3ISND 1Q4RA 4P9SA 4LRDA 4LSZB 3RB6A 2JFKA 1D3WA 1PBUA 2V2KA 3RB0A 1OSDA 1Y3JA 2IRUA 3QRPA 1TKTA 4OYIA 4DUTA 1IM6A 4K2JA 3T9NA 2IY5B 3U02A 1I1GA 5KTQA 1C0TA 2IC3B 3VHQA 4C8YA 1DQAA 2XHWA 3DRYA 2CNLB 2NPFA 2R7SA 4C11A 2YNHA 2AGPA 4XK8C 2DHHA 2DVIA 1OSCA 2PT0A 4ID5A 1GTHA 3MM6A 1ZZFA 5F8NA 2EW0A 2CPJA 4HLBA 3RBDA 2CQIA 4TQRA 4QWDA 1ICEB 4QYZK 3AOCA 5KFMA 1A0OB 1PG5B 3UR0A 4ZP8A 4F0MA 1RYRA 3MEGB 1T03B 2KYXA 5KFZA 2MHEA 4MFBA 1HMVB 1Q79A 2ASLA 4PKDB 2B8QA 1FEEA 1FF2A 3H5UA 3U1LA 2BE2B 3VAIA 2ZITA 3LP2A 5HAOA 3IR7B 5T7LA 1IR1A 3SCLE 3OFFA 2NSCA 2ADCA 4RWXA 1EJ7L 3DRSB 3GLJA 4WIQA 2L48A 3FDSA 2PEHA 4IR1A 2V4JA 2XNQA 5JJBA 3HVTA 4RW6A 3CDBA 3HO1A 3A13A 2W9BA 4ED4A 3GYNA 4DV5J 3IC1A 2E9RX 3WC0A 4CZCA 2HNZA 2OAUA 2VG7B 2ZC3A 2CQ1A 3WZ0A 2QO3A 5A76A 2JH3A 3T6JA 4UOGA 4ZJQA 2NS1B 4DV0J 4OZ0A 3AH6A 2MZ1A 1M1KT 1F9HA 3IP0A 5I3PA 1SJQA 1YZ6A 5F9LA 5EN1A 2NLWA 4RNOA 1X4DA 3JTPA 1EQMA 2MKYA 2V8GA 2FYXA 4QWAA 4DR1J 4BC7A 2KN4A 1F60B 1YJ7A 4NLOA 3JSYA 3JSMB 1HNZF 3I9V9 1GT8A 3BQ0A 2U1AA 4CM2A 2PMHA 1FNMA 2BABA 3CCZA 3I0SA 3FCHA 1L3UA 4XPCA 1N33F 2R4FA 4LR8A 3N28A 2EFQA 1VC0A 4PWDB 2HFZA 1O5JA 5B0BA 1M5PC 1N32F 1V3RA 2EKNA 3H5YA 3U1MA 1CJTB 4KHRA 3RBEA 1RT3A 3DLEA 5KT2A 1WOSA 2CQPA 2W2PP 3S1TA 4DXLA 5C24B 1RTJA 2FVQA 1CJVB 8ATCB 2WVEA 3M30B 3TQ1A 5I3UA 4IFVA 4CP5A 1EAYC 5D4LA 3HP6A 3ZTOA 4A8OA 2XGQA 3AD8C 1KQKA 1ZAWA 1FO1A 3W9HA 4NE9C 1AYEA 4O44A 4DR2F 2DHXA 4DSKA 2NZCA 3BEGB 1RT4A 2IMOA 4L76A 4KB7A 1RU2A 2Z58B 3G4SS 4JBCA 1LW0B 3DDNA 3MD3A 2QLXA 2WAQD 1TFWA 3J80U 4F4KA 3IRXB 2VICA 2E5LJ 2ASDA 1U26A 1YIJS 5HMWA 2RJZA 2UVUA 2AEMA 2CIMA 1ZZNA 5LT5A 3CCTA 4K2XA 5ETVA 2W9CA 3NEKA 5LMUJ 2RRAA 2BE9B 2YPYA 1ZH5A 2VOPA 3IBCB 4OFZA 3G71S 4LF6F 2ACYA 1FFSB 5KG6A 1ZAVA 1S1WA 1R8AA 3KJVB 2ZJRQ 1FEHA 3U1NA 5M2UA 5EHHA 3NCQA 2QYCA 4Y34A 1KWMA 1N0VC 5DETA 4DR4F 2A6MA 2GV1A 1NDCA 4OHVA 3K2YA 1MU2B 3OL9A 3LGNA 1PAEX 3DOKA 4H4OB 4USVA 3RR8A 2OFGX 2R42A 2QMUB 3R5BA 4LF6J 3CC2S 3K0JA 2MQ8A 4YP3A 1FJEB 2GS5A 2ZKUA 3MMCA 4DX5A 3NY0A 4FVMA 2DH8A 1MN9A 3ZNUA 3BSCA 1Q7YT 1YWXA 3QIPB 5K14A 1QVGR 1N36J 4OJ1A 2I38A 4GC7A 1N6QB 4B9NA 1WWHA 2BEFA 1S77D 4BHQA 1UWBB 2CNKB 3AJDA 4M63A 4QIWD 5CYMA 1HBOB 4QR0A 3TEGA 3W60A 2ZNYA 2RRNA 2FJVA 4HI1A 5FDLA 3PIPQ 2P2CB 1U6FA 3T1YJ 4JYAJ 4LSNB 5KFSA 2R2SA 4DSJA 3GG0A 1H72C 2BW2A 2HS4A 2HK3A 2OELA 4ZN3A 2Q66A 3CVKA 3O5TB 2J9DE 1F2HA 1WHWA 2DB1A 2QYGA 4Q44A 2E5LF 2FB0A 2PC6A 3ENVA 2HHHF 2VBYA 2JC1A 5LMUF 1VRTA 2KO1A 2O3DA 3BR9A 1MMNA 4J9MA 3OTBA 5F8IA 2ZNZA 3UWTA 2W7PA 4LBHA 3PYFA 4LJMA 1WHYA 4UOHA 2C2RA 4A8FA 1JLEA 4FYYB 4ZVEA 3KLEB 2UVVA 1S5ZA 3QQCD 4B3MF 3HCXA 1YTYA 5KG5A 1XWLA 1YJTA 2XCPA 2GQQA 2Z8QA 4B02A 2BQ3A 2HAIA 1FRHA 3J7Z5 5D77A 2IDEA 4NCBA 3WHIA 1IKXA 1KP6A 2FZKB 4JI8F 1TL1B 3I31A 5K8OA 4WE1A 4R8UA 3BDEA 1C1BB 3HX9A 4LR9A 1AT1B 4NLGA 3UNGC 1JLCA 5J2PA 3PV8A 4B3SJ 4ECVA 3SQGB 2MMYA 1JLQA 2ALZA 4Q0BA 2RF2A 3FK4A 3MCMA 2ZZMA 4XO0A 3M6WA 4J5OA 2FJXA 2XWYA 2C42A 4GKJJ 1RSCA 2F3JA 1B64A 4EYIB 1UJ5A 1HR0F 2ADBA 4QPTA 2QJ3A 3CIMA 3J80Y 3VALA 2IRXA 4WTOB 3FEXB 2G13A 2IM2A 5GADI 2HIYA 4MAKA 1WI8A 1BWEA 1JLGB 3D9BA 2BOAA 3BR8A 3ZZTA 4CYUA 5KT4A 1T8EA 4LF7J 2CQ2A 2DCUB 3V6HA 3JAMY 4KV8B 2J6SA 3FBCA 2F40A 3W3SA 3CJQA 1FCAA 3H20A 2NYHA 5G0RB 1U1NA 2VV5A 4USMA 3EE3A 1XR6A 4TVAB 5U47A 2KM8C 4AL5A 4LRFA 2YWKA 2ZVIA 4CLPA 1H2VZ 2HS0A 1HNVA 2N4DA 3Q8UA 4C6AA 5BYQA 1KHWA 1BLUA 5J1EB 3M1VB 3TZWA 5AE3A 5I3QA 4YHHF 2AYGA 3FZBA 3MOZA 4LRAA 2V94A 3G8TA 1S9EB 2VJVA 1VRQC 1FD2A 2J8SA 2Y1RI 3MM8A 3NLCA 4WK3A 2DGTA 5F41A 3W2VB 4AYBD 4CLUA 3KLHB 2UVRA 1XTZA 4I1TA 1IKWA 1YSJA 2OPQA 3HSDA 2J0SD 2CPIA 2J0WA 4I6YA 5E41A 4LF9J 4FKXA 1VQKS 2LFVA 1V3SA 3NG8A 4CTAA 2AEFA 2HG4A 3MZIA 3PG9A 4EZ9A 2MQNA 2Z30B 1IQZA 3T1AA 1HA1A 4K4WA 1UVNA 4DPOA 2NXNA 4NYPA 2W4PA 3VGUA 5K8MA 4GC6A 3BV8A 3KDOA 3J81U 5CZVA 1RAGB 3BREA 4KHMA 3ZZOA 1DTTB 1MWYA 1F6TA 1CS4B 2BDPA 3PRDA 2IDLA 3KG0A 5DG7A 1HWIA 1UEKA 4NLSA 4DV6F 3P5BP 3CJ8A 3HI9A 2CPXA 3IWLA 1X4HA 2CPFA 4Y28C 3TRGA 2YNGA 3AB4B 5A6WA 5D15A 2IAJA 3W1YC 1V5IB 2QE5A 4OHWA 1P8GA 2UUBF 1FK9A 2R7WA 4ECUA 4DWIA 4YN3B 4C7QA 2MHNA 2A2CA 2OD6A 1N5YA 4N76A 1M0SA 2I5JB 1YBUA 2MQOA 3OJSA 4DBQA 1RHQB 1YVFA 3VR1A 4WCEQ 1KBRA 1P9YA 2PN6A 4QIGA 2QLBB 4OI3A 2GMHA 2Q79A 3FNNA 3GYGA 2Y1LB 2A1BA 2LP4A 4QR2A 3CCJS 2XLIA 1HYSA 5GAGI 2BJ9A 2YWWA 4ZVRB 3FMBA 4CT9A 1GX6A 2KT5A 3QFHA 4PWWA 5A8RB 2CJAA 1RU1A 1T9TA 4FVCA 4X84A 5HMYA 4C97A 2VQFJ 5HJXA 2I1RA 3DRXA 4M5GA 1JLFB 2YKQA 2ZHAA 5A0YA 3CO9A 1MG7A 3HHLB 2HYIB 1IQTA 1FX4A 1RAOA 3GJQB 4NRTA 4PQAA 4ZP9A 5L9NA 5AJ3J 1VHIA 1G2EA 2HQDA 2IVYA 2V2VA 3TX0A 4H54A 1JNZB 3GP9A 1R3NA 4ALZA 4JV1A 1N52B 2CG8A 2RDIA 2AYBA 1O6XA 1S1XB 1Q95G 2RVJA 2ZUAA 4I68A 3SCKE 3H2UB 1Q0NA 3A3OB 4UUXA 3ZZYA 4DV6J 3TJ9A 2XY5A 1T3NA 2F9DA 2X1BA 1S4FA 2G0CA 3L9ZA 4M5DB 1OY6A 2V8HA 5AT1B 4CM0A 2R8JA 2PE8A 3V6DA 2CKWA 2C3PA 2L9DA 1ELOA 3F0NA 3MMBA 2KXNB 2QZ8A 5LSOA 3K5MA 5KFQA 3ENAA 3VAHA 1FDNA 3NAIA 2AZ3A 3BYRA 2WRMA 4JB8B 1IKVB 1PYTA 2GZOA 1S6OA 1REVB 4DSEA 2BJEA 2WSFC 3D28A 3G8SA 4NLPA 4P74A 4K4YA 1VR6A 2EG1A 2LMIA 2VH7A 2R7OA 2ZOMA 1L3SA 4LQ9A 3BBFA 1RAEB 2EXUA 4MMOA 4P72A 5ETRA 3M9OB 3EGVA 5C2GA 1X0FA 1GXTA 1RT6A 3O3LA 1QM9A 3KLGA 5L9XA 3K8VA 1ZTTA 1KR4A 4B9TA 2XS7A 5CH7B 3G8QA 3NOCA 1UKUA 4QU7A 1EX8A 1HNIA 4XDCA 1VQ5S 1VIXA 1RWPB 2YY3A 3LH2S 4EMDA 2MQMA 3PYDA 1UTAA 5IC6B 5F8GA 4DR2J 1OS5A 3QGIA 4OX8A 3BH7B 1BQMB 2R8IA 3IM8A 5FLXU 5HQLA 2LLZA 3R6LB 4ZS6A 4PG8A 3RAXA 3HHEA 2VZ9A 1BE4A 2WSCC 5HBMA 5HROA 3HSJA 3HZGA 4QIEA 1R8BA 3G87A 4FN5A 1T11A 2KKHA 4HEA9 3HKZD 4K8RA 5AJ3F 4DS5A 1VBZA 3GPAA 4X4NA 3GB0A 1RJJA 3IGVA 3VAGA 1RTIA 3LGMA 4ZP6A 4IRKA 3M32B 4LRCA 5GMEA 5L1KA 4YUDA 2OP5A 4A8YA 1Z2ZA 5DLGA 4DL7A 2M8DB 1RHRB 2VBWA 3AB2B 2ILYA 4OIXA 1Y00A 3US5A 4ZIWA 4DFMA 1QUPA 4K4SA 4NZ7A 1WC1A 1HWLA 1NRKA 2DRAA 2QMXA 3KHLA 2DEJA 4NX9A 3HPOA 1ZA2B 3QLHB 3KG1A 2DRBA 4TU9A 2CA9A 3M7VA 1VIOA 1Q5VA 3KLVA 2BJ7A 2QLFB 4DN9A 3RGIA 1W7WA 2DR9A 3TQEA 1CEZA 2HNYB 1LWFA 2PDAA 3I5BA 2HRYA 2OMLA 2OPRB 3PACA 4DJBA 1HARA 2BM1A 1NH8A 1O51A 2GIRA 1WDTA 2E7WA 3SBMA 4I69A 1KC8T 2VONA 4Y6IA 1V5VA 1GFWB 3BH6B 2P9CA 2PMWA 2HZCA 4GKKJ 4JI1F 3OHAA 2CPZA 4RO0A 1CQNA 5LMNF 3T1YF 1KTVA 1P27B 4Q5VA 4GO7X 2W2QP 4RNFA 4YB7A 1F5CA 2FY8A 2C2MB 3UN2A 3MGJA 4NLRA 4NXMJ 1KHVA 2GVZA 2FZCB 3CCUS 2YQ0A 1QE1B 3K58A 3EWGA 2FVRA 4JI7F 1RT2B 2H5IB 4KQZA 1PC5A 3KHGA 2RDJA 5FD1A 4BDPA 3J7A1 4FS2A 3FSIA 1U0HA 2WCXA 2J6UA 1XMOF 3OTDA 1Y10A 3Q8SB 2B4OA 2J7WA 2VPYB 2ZE2A 1QD1A 4DUZF 2DNKA 3PJXA 4RW8B 3N01A 4PXBA 4IO9Q 1R8HA 4MK8A 2AYEA 4B3MJ 4CH1A 3RR7A 2ZH6A 5FJ4A 2VU5A 1HKAA 4AE5A 3DHWC 4ZCIA 3OL7A 3K5LA 4F3MA 4J9KA 2X1GA 3MDFA 4RKUC 1VQ9S 5KG7A 2J9EA 3D7SB 3TZZA 4DQQA 1NLKL 1S9FA 2J6TA 3MI7X 2DNYA 1X4GA 7FD1A 3CPWR 2HWTA 1K73T 1HI0P 1RQ0A 3EVMA 2M70A 3I32A 2APOA 2MKHA 1JLBB 1FKOB 1GK8A 2NXUA 3FQLA 4OZ3A 5F3TA 3SV3A 1A9NB 2NYIA 3HULA 3R5JB 1WG4A 3M9MB 4B3RF 2JSXA 3EJMA 3BGOP 3HF5A 3QFWA 4RUBA 1NPRA 4NLQA 1DHMA 3D2WA 3KUEA 3M8WA 2MSSA 5H9EK 5HI7A 3MEEA 4UZCA 2MSTA 2DNLA 3UE2A 2V4RA 1RT5A 2ROEA 5D78A 5GMDA 4QPXA 1RA7A 1E6YB 1KVKA 1N32J 1RT1B 2K8GA 3I5CA 3ZNJ1 2ALYB 3MR3A 2DIUA 5HLFB 1S48A 1RWXB 2HWHA 1W25A 2Z2YB 2LU1A 3JTNA 2AW0A 4DUYF 3DOMB 2AJ2A 2RU3A 1YX2A 3RB3A 5B0AA 3UD5A 4PG7A 3NGSA 4LSLB 1XMOJ 5D0GA 3QT5A 2Y1IA 3QO9A 1VC6A 1UZDA 2B6AA 2OO4A 2YWFA 1W26A 2YKNB 1S9GA 4OI2A 3DDIA 1RBOB 4F0HA 3DYAA 3TUZC 1J5OA 2R7VA 4ELUA 1RP5A 5HO4A 4ITSA 2KXHA 1S72S 1MW7A 1IM4A 4USHA 3K89A 4JI2F 3GJTB 3RRKA 3R8YA 2M8HA 1F1BB 5C25B 1QSYA 1YLXA 3NBPB 4KYZA 3CCLS 4ECTA 4LRBA 3IG1A 3R5DA 4KHPJ 1GMUA 2KXFA 4KAIA 3O8WA 3R1LA 3ELHA 2B4UA 2EFVA 1FNXH 3DOLA 3D6TB 3CJ4A 2CDQA 4ZLPA 4ZVQB 3TUIC 1B7YB 3OR1B 4NZ6A 1X4AA 5EWGA 4ED7A 2BJ3A 2BQRA 5AXMA 2J5AA 4A47A 3K5PA 4Q7AA 2AEJA 3V6KA 5ETNA 3PKMA 1BWVA 1NU4A 2RKIA 4P2XA 2QA4S 1JLAA 2QSFA 2FVPA 2KTQA 1WACA 1WHXA 2ZUGA 4AL6A 1VK3A 4TY9A 4QWBA 3OSPA 3FSXA 4HTIA 3Q24A 1FRIA 2A2DA 4V1Ak 3W8GA 2YH1A 1KSPA 3NL0A 1HBMB 2Q6CA 4ED8A 2Z57B 1N34F 1HPZA 2DNHA 4X64F 2K7KA 3P49B 3HT3A 2B4VA 4ZK7M 3OPKA 1S0NA 3P3DA 1FKAF 1R27B 4OV1A 5DDRC 1VISA 1WI6A 3A4TA 4OX9F 3R7SB 3MTJA 3O6QA 4DPYA 2DHSA 3RAMA 2ZOGA 5DG8A 1XNQJ 2PGCA 2VQFF 1FJ7A 1KEKA 2D74B 2V67A 2WVDA 3TA2A 4Y0FA 1NJWA 1NJYA 4WJBA 2LXIA 1H6KX 2XNRA 1TL7A 4NA1A 1SH2A 1RADB 3R5AA 1M5KC 3IRWP 4CO4A 3DLKB 1FHTA 1FTCA 5AE1A 5IZHA 3A12A 3SZ2A 4RBVA 3FCWA 3ZZ0A 3C16B 3IWXA 4RL1A 1D1UA 3M2UA 3QSIA 2DGSA 3M8PA 4ECRA 4YY3J 4F2SA 3DGPB 4ICLA 3HHKA 3DRPA 2JZ5A 3R3TA 4USWA 1XNRJ 4CIOA 3CIZA 2IJNA 3G86A 4C0BA 1UA1A 3T1HJ 4P2SA 1U4BA 1U1LA 2CFXA 5SUHA 3GIMA 2Q3PA 3DXSX 2XB2D 3CJ5A 4RJVA 4CLTA 1PCAA 4OZ1A 3QAUA 4OJ3A 5KFKA 1PGZA 2BVZA 1RCXB 3ETOA 1I94J 4DSIA 2P9GA 3H59A 2R9LA 2HVIA 3QWPA 5CYQA 2SXLA 4HHHA 5IM0A 2OPPB 3EVOA 3LW5C 3PKYA 3OL8A 2AU0A 1YITS 2VODA 2YWGA 4OI1A 2CJ9A 4P71A 2F65A 4AQYF 2J0XA 1LW2B 3VZIA 2AIRB 2KJWA 1B7FA 2EBEA 1K47A 2RB7A 1SL1A 1D9FA 3OTCA 2R7UA 4LR7A 1BY9A 2MJNA 4RR5A 2GHWA 2QG9B 2QRRA 4EYHB 1UL3A 2YQ3A 4UW2A 2FVCA 1U8WA 4MIBA 1NEEA 4D3GA 2I8EA 2YNFA 1LWXA 3SEOA 3G6ES 2DR5A 5HANA 2XGPA 3LQVA 4IG3B 4NCGA 1CJKB 2CJBA 1VQ4S 3DLJA 3HT0A 4B3OB 1FDAA 2IJFA 3QGPA 4ZPCA 1AXQA 2DGOA 2NCKL 4USIA 1L5UA 1EZZB 2A18A 4DG1B 1DJ0A 1S6PB 2GVDA 2HBRB 3VAJA 3P5TL 1DRZA 1HBNA 2CUYA 3PW7A 3LAMA 2AT1B 2YWEA 1CSJA 2XQCA 3D0HE 1XNRF 3C6UB 1T02A 3R27A 2DITA 3HJFA 1GXUA 2JX2A 3D66A 1N5VA 4K4VA 1OPIA 3BGRB 2YX1A 3L4BC 1SC6A 4LF9F 3FRZA 1BQNA 4FF2A 3OR2B 3RW6A 2EPIA 4N56A 3SCJE 3ET6B 1V3ZA 5K8NA 2L41A 4I2PB 3CJKA 4L3NA 3OUYA 1B4SA 4CT8A 1TFYA 5DGBA 4ECXA 5GAEI 1SB6A 1XEZA 2G0JA 1X4CA 2VG6B 2VA3A 1FKPB 1CC7A 4MK7A 2CAJA 3W65A 1HD0A 4DFKA 4U7UD 2AHOB 1P9QC 2M7SA 2ZD1B 1X4BA 4ED6A 1KRPA 3FBEA 2BRLA 1O0PA 1A6LA 2XMWA 4H4MA 1HW9A 3CCQS
chains in the Genus database with same CATH topology
2HAFA 2AJ2A 2GS5A 2GZOA 2DO8A 2HRXA 2EW0A 2MUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HAF A;  2AJ2 A;  2GS5 A;  2GZO A;  2DO8 A;  2HRX A;  2EW0 A;  2MUI A; 
#chains in the Genus database with same CATH topology
 3KLF A;  1U49 A;  3W62 A;  1EET A;  4I7F B;  5LMN J;  4I4B A;  3E51 A;  4GVB A;  4DSF A;  4FNH A;  1TMJ A;  3PJW A;  1HWU A;  1WEZ A;  4C8Z A;  2OTJ S;  3HDS A;  4RW4 A;  1NH7 A;  3SDE A;  4O4R A;  4O0N A;  2IYG A;  2MQP A;  3MED B;  4N8N A;  4L6V 3;  4I67 A;  1GMV A;  3QAT A;  1VQN S;  4X4R A;  3O2I A;  2RU9 A;  2H65 B;  4V19 X;  1S1U B;  3BO3 A;  4R0E A;  2ZKT A;  3GE9 A;  1R0A B;  3GWC A;  1RB0 A;  3FCV A;  1RTD B;  2AX1 A;  2HS3 A;  1IN0 A;  3LWM A;  4R5P A;  2JEI A;  4C8M A;  2C3M A;  1YJW S;  1I6J A;  1JIH A;  2XZW A;  3EXY A;  3MUV P;  4X4Q A;  1NZA A;  3ZZR A;  2DO4 A;  1RTH B;  3MFI A;  2LU2 A;  1UA0 A;  2AWZ A;  5FLX Y;  1YRX A;  4KJI A;  1DTQ A;  4LF4 J;  4DR4 J;  3H40 A;  2O66 A;  2CZ9 A;  3KOA A;  1TVR A;  3ZO7 A;  1Q53 A;  4DV7 J;  1FI4 A;  4CH0 S;  5F8H A;  4NWB A;  2E1M C;  3B82 A;  1IWG A;  2B5J A;  1KQG B;  1PKU A;  2HEK A;  4URQ U;  4WP8 A;  4IOC Q;  1VQM S;  3OV7 A;  1VQL S;  2FJB B;  3CF5 Q;  1FXL A;  3RYL A;  4NEZ A;  3T5J A;  2XYH B;  2C2O B;  1VBY A;  1PC4 A;  3THT A;  5CCM A;  2BR0 A;  3TAM A;  4JI5 J;  1HWK A;  1NDL A;  1U1M A;  3JYT A;  3OFE A;  5D0H A;  4DU7 A;  3K57 A;  2D3O R;  2XMJ A;  2I6W A;  4PQU B;  1NSQ A;  1ZM9 A;  2VAS A;  4NI2 B;  2DD8 S;  1YZ7 A;  4XAK A;  4A8W A;  3UDV A;  1UVI A;  3PCO B;  2YH0 A;  1JWW A;  1FTR A;  2BAN B;  2GHV C;  4C0H A;  1C1C A;  3KK1 B;  1U6Z A;  3M2V A;  4CO1 A;  2B43 A;  2RQ4 A;  3AJ1 A;  3C66 A;  3GON A;  1IUJ A;  3BN4 A;  3KK3 A;  2FC9 A;  4DX7 A;  2JLG A;  2FVS A;  2DO8 A;  4J9N A;  1FES A;  5KFT A;  1TU0 B;  1FVS A;  2WVF A;  3PHT A;  2HHW A;  2KRR A;  2L08 A;  1U1K A;  4L72 B;  3F56 A;  9RUB A;  4RZR A;  1S10 A;  4M1K A;  4KH1 B;  4LVN P;  4ZCM A;  1R0A A;  2ZWO A;  4OZJ A;  4WFY A;  3NGR A;  2V4Q A;  1TMM A;  5J1P A;  1JXE A;  4J9P A;  3FSY A;  3MM7 A;  4ZPV R;  5CZX A;  4ZLL A;  3GFY A;  3TVZ A;  4LFC J;  4C3L A;  4JYA F;  4PG4 A;  2FHK A;  4I7F A;  5J2M A;  1IBK J;  3MXH P;  1UAW A;  3HK2 A;  3IO1 A;  4IFY A;  5KG0 A;  1FE4 A;  3V4I B;  4NLU A;  2ZBR A;  4RW7 B;  4KO0 B;  2WSE C;  3AA9 A;  3AOB A;  3IR5 B;  3KLF B;  1N88 A;  2E1A A;  1D9D A;  2CWX A;  1JKH A;  3PO4 A;  1R89 A;  2RUG A;  2LVW A;  2UUC J;  4F36 A;  1IKY B;  1X4F A;  5HQM A;  1HHQ A;  3UW1 A;  1OQ3 A;  1SC1 B;  4LFB J;  4E2F B;  2WOM B;  5LXR A;  5KG2 A;  2YTC A;  2E9T A;  2E9Z A;  4UQT A;  1UJ4 A;  4UST A;  3VV2 B;  3EGW B;  1BQN B;  3OFG A;  4YR0 A;  3ZFV A;  2HK2 A;  4DL0 C;  5KFH A;  3DI6 A;  4M5J A;  1Q86 T;  2LDI A;  2HHS A;  1YDL A;  2C2Z B;  1BMQ B;  3D5M A;  1PO6 A;  2BUN A;  4GO5 X;  2DXF A;  1OY9 A;  4V19 J;  3S6E A;  1YJN S;  2L9N A;  2WON B;  4IOB A;  2H1Y A;  3CSK A;  5D0E A;  3W61 A;  2V8D A;  3MR2 A;  4KKO B;  5L38 A;  3BSA A;  3GJS B;  2W2N P;  4PYD A;  4G3I A;  4DV1 J;  4EBC A;  1CUL A;  3MMA A;  4W92 B;  1JJ4 A;  1QJH A;  4GMK A;  2C2N A;  3CUL A;  1YJ9 S;  3MM9 A;  3M05 A;  1IBM F;  1VQP S;  4B3O A;  1DLO A;  2HKE A;  2FHO B;  1D8Y A;  3C14 B;  4NCG B;  4IG3 A;  2AJQ A;  2VG5 A;  3NS5 A;  4YFU A;  4ERD A;  2A6O A;  3I82 A;  2JFD A;  3R7N B;  1WC6 A;  2QMW A;  1WKL A;  2YNF B;  1RLD A;  4HT7 A;  4DX8 H;  4LF8 J;  1U6B A;  3UDE A;  3A3P B;  3VTI A;  1X7V A;  2U2F A;  2HGM A;  4DL3 A;  2JEJ A;  1HBU A;  2XO6 A;  3OVA A;  4DV5 F;  1Q8B A;  1XR7 A;  3DM2 A;  1TKX B;  1DLO B;  1N4L A;  1UZH A;  5EGY A;  2XC9 A;  1G3O A;  4DCO B;  2AQ4 A;  4P7T A;  2LKZ A;  2AMC B;  4KPC A;  1BHN A;  4OYO A;  1ZAX A;  1CUL B;  3MMA B;  1NDP A;  4PZV A;  4CLK A;  3DFE A;  4PG5 A;  1C0U A;  1PJ6 A;  2RML A;  2K06 A;  3D1O A;  1Z1Z A;  5IM0 B;  1OMS A;  1SUQ A;  4YB1 P;  2R7X A;  3RBZ A;  1URR A;  2M52 A;  2XY7 A;  1UVM A;  1QLN A;  1X5O A;  1JJ2 R;  2V8V A;  4DV3 J;  2UU9 J;  1H74 A;  1HQE A;  4KT0 C;  1H73 A;  3CJT A;  2HLT A;  1JXL A;  4IO1 A;  3DI6 B;  1KVJ A;  3KK2 A;  4NPO A;  3PFO A;  4FS1 A;  1G6B A;  4UY8 5;  3NWG A;  5THW A;  4UY8 T;  3EXC X;  3BPD A;  1IBL F;  2WOM A;  4EK2 A;  3AOD A;  5KG1 A;  1KDN A;  1KTQ A;  2RSQ A;  5L1J A;  4M5N A;  5IT9 U;  1IKY A;  4FYX B;  5DQH A;  4B3R J;  4QU6 A;  1FXD A;  5H9E J;  1R31 A;  3V81 B;  4JV5 J;  4ZDN A;  4USU A;  4DL5 A;  3AAW B;  4KGX B;  4OZ2 A;  2H48 B;  4RU2 A;  3ILI A;  4ZN1 A;  2XMA A;  1MRO B;  2JLF A;  3NCP A;  3DLB A;  2VC0 A;  1HQ2 A;  2DGW A;  2QA1 A;  4USJ C;  1NZ8 A;  1U09 A;  2CQ3 A;  2JL9 A;  3Q8R B;  4IDK B;  3Q23 A;  2HQC A;  1H38 A;  2P5V A;  1SXL A;  4RBT A;  4X4T A;  2FZG B;  2KVI A;  3HJV A;  4IDK A;  3H25 A;  2AZ1 A;  3VAM A;  3T5K A;  1K0V A;  2UV8 G;  4OZ5 A;  3EUN A;  3NNC A;  3UN5 A;  3PYE A;  2CJY B;  3ADA C;  2NSB A;  3QMQ A;  4PG6 A;  1UMJ A;  1IVZ A;  3LTO A;  4ZCK A;  1RGV A;  3QGH A;  1JLA B;  3DU6 A;  3I87 A;  4GRS A;  1HNW J;  1U25 A;  2HHX A;  3G82 B;  2FGO A;  2Z0G A;  3MEC A;  1VGY A;  2CRL A;  2VQE F;  4DL6 A;  3HZE A;  4LMZ A;  1MML A;  2RD5 C;  3RU0 A;  4JI6 F;  4BS2 A;  2HVD A;  1EQ0 A;  4ZVH A;  3OXG A;  3QJL A;  3CDU A;  3OR1 A;  1NK9 A;  4B9S A;  2IM3 A;  1DQ9 A;  3ZZP A;  4CNY A;  4DMZ A;  3PIO Q;  4A8M P;  2VB6 A;  1FJG F;  1TUV A;  4WFZ A;  2HMI A;  2RUS A;  5KOX A;  1MNE A;  2FPH X;  4B3S F;  4NI2 A;  1NHV A;  1WNE A;  2FQQ B;  4RWW A;  5CXT A;  5K8P A;  4DZD A;  2VJU A;  1SQG A;  3DMJ B;  1X31 C;  3R97 A;  3SCI E;  1K0T A;  3DN9 A;  4M94 A;  2YVS A;  4OZN A;  4A4J A;  3EYZ A;  3GIR A;  4JI3 J;  2W1B A;  1SUQ B;  3KFW X;  2MDA A;  4ZPD A;  5L39 A;  2QGF B;  1FVQ A;  1REG X;  1C0U B;  2PI5 A;  3W9I A;  2GMJ A;  4BBY A;  1TVR B;  3J81 Y;  1RYS A;  1RHK B;  2OGU A;  4WK1 A;  2HVE A;  1G4C A;  2F8M A;  5KT6 A;  1EIY B;  1T7P A;  2JLE A;  1DTQ B;  3DYA B;  5K9F A;  5HJY A;  2DNO A;  3ICL A;  4A8X A;  4N5S A;  1J5O B;  2DGU A;  3H2L A;  4WZM A;  4RX6 A;  2R3V A;  3CB4 A;  1NME B;  1HBU B;  4OI0 A;  1V9O A;  4Z7C A;  4LSL A;  3DOM A;  3D1Q A;  4YB6 A;  1VQY A;  2LXU A;  2OKQ A;  1R7I A;  5ETP A;  5CAB A;  4TU8 A;  2VG5 B;  1DY3 A;  4DPW A;  3K17 A;  2B8P A;  2RQM A;  2B0G A;  3QPI A;  1YQH A;  2YKM B;  2F1F A;  1R6Y A;  4OJH A;  2E29 A;  3B54 A;  3MR5 A;  4GVB B;  1KLN A;  3MEE B;  4KKO A;  3SIP B;  3JQJ A;  1WF2 A;  3CCR S;  4UQG A;  1BXN A;  2EVZ A;  2QV6 A;  4ZPA A;  4J9U E;  1TTH B;  2J7K A;  3C2P A;  1H0H B;  2HFN A;  1AFI A;  3AXK A;  3H98 A;  5I4M A;  2EKY A;  4R0J A;  2ROG A;  4DV0 F;  3RTV A;  4CO2 A;  1ROF A;  3NRB A;  1S59 A;  4PEO A;  3I55 S;  4CDI A;  2E1C A;  1ZBT A;  2QEX S;  2LQJ A;  2VG6 A;  5A8W B;  4J9Q A;  2PFD A;  2V34 A;  3N0V A;  3GZ7 A;  1NK6 A;  2HHU A;  4RU9 A;  1RWK B;  3J7A N;  1VS3 A;  4ELT A;  3OUY B;  5IV3 A;  3V6J A;  3IFE A;  5SZT A;  2JRS A;  3BM7 A;  4LVO P;  5KFY A;  3QID A;  4U8V A;  4WBF A;  5A8W A;  5B0C A;  3MUM P;  1NK8 A;  1H7W A;  2Y8W A;  4CQ1 A;  1I3O B;  2E5H A;  2MZJ A;  3AY0 A;  2QIF A;  4ILL A;  2OJ3 A;  3VGV A;  1QY7 A;  2H5E A;  3M6X A;  3LF0 A;  3QNW B;  1ZTW A;  2O67 A;  4RW7 A;  4X4U A;  2ZHB A;  2C3O A;  2POK A;  4IFY B;  4OX7 A;  5HVG A;  4JI7 J;  1MN7 A;  4J9O A;  1S6P A;  1UWA A;  2GVD B;  2CQH A;  3IBF B;  3TJ8 A;  3AA8 A;  2AGO A;  1QE1 A;  2YKM A;  4MKA A;  4EO8 A;  2DIV A;  3VQS A;  1JK9 B;  2H54 B;  1VDH A;  1NO8 A;  2GVZ B;  2KT3 A;  2CAD A;  2EFO A;  2EFN A;  3AFG A;  3G2X A;  3KJF B;  3MCO A;  2P9E A;  3MM7 B;  3NWR A;  2FLP A;  4FYD A;  2F5G A;  5F8J A;  4Z37 A;  4DV2 F;  3N6M A;  1S99 A;  4WU3 A;  4CLS A;  3TVK A;  1XMQ J;  4FBU A;  4JI1 J;  1DUR A;  2YPZ A;  1U1Q A;  4RUH A;  2ZDP A;  1FRK A;  1XQI A;  4K4U A;  1VC5 A;  2MUI A;  2P6T A;  1X0P A;  4FXV A;  3KMS A;  2RHQ B;  3ILL A;  6FD1 A;  3KUG A;  1GMW D;  5GAH U;  3THV A;  2JC0 A;  1WTB A;  2Q6B A;  1RUS A;  1RWV B;  5M2P A;  3G6Y A;  2O1P A;  2Q43 A;  3KK3 B;  1RBA A;  1UPP A;  3M2V B;  2BYC A;  2W01 A;  2JVR A;  2QA2 A;  1C1C B;  2OPP A;  2YKA A;  2BAN A;  3K5O A;  4P6Q A;  4DOZ A;  2H3E B;  2XLJ A;  3KK1 A;  4IRD A;  2Y8Y A;  4DR6 J;  4K5S A;  3TA1 A;  4DEZ A;  3EMT A;  2G2Y A;  4K4Z A;  2XMT A;  4NLW A;  2KZZ A;  2EWH A;  3CCW A;  4PQU A;  3JYT B;  3DMJ A;  3Q0A A;  2V9W A;  4F25 A;  4U8Y A;  1YBT A;  4ZVS B;  4A48 A;  4C3K A;  2R7R A;  4HYK A;  4ICL B;  4K0K J;  2B5J B;  5B0F A;  2CVI A;  3M2U B;  2AYM A;  3R1H A;  2IMW P;  4DV1 F;  3TI0 A;  3I56 S;  2DGX A;  1QAJ A;  2EC2 A;  2GQ2 A;  4I64 A;  1RTH A;  3MEC B;  2D7S A;  2FJA B;  3G82 A;  5A2Q U;  5KFP A;  1LKZ A;  2XHC A;  4QOT A;  3R9L A;  1SJ3 P;  1TAU A;  2X3G A;  2DNG A;  3MOJ B;  2MJU A;  4X65 F;  1S1U A;  2LYV A;  5KFN A;  3BB5 A;  3HVA A;  1F9E B;  3PM9 A;  4O3P A;  2R2T A;  2GML A;  4LF8 F;  1Y5L B;  3VAK A;  2FTR A;  3CWJ A;  2AJ4 A;  2HLU A;  4QIF A;  3MED A;  3VWS A;  1Q7L B;  2DNP A;  1M5S A;  3SDE B;  4I56 A;  1KFS A;  2VUG A;  4UT4 A;  2XBP A;  2Y3Y A;  3QT8 A;  3W7B A;  1HBM A;  2XS5 A;  1NPK A;  1MRO A;  3M8Z A;  4Y2K A;  2UXB J;  1YRT A;  3OT9 A;  4FPI A;  4OYP A;  3D3B J;  3D68 A;  3PW0 A;  3V4I A;  2FLO A;  4H4M B;  1IKV A;  3MPV A;  3LOU A;  3G96 A;  4M95 A;  3DGV A;  2HRX A;  1IXK A;  3FJ2 A;  2RKI B;  4C2M A;  3V81 A;  1N8R T;  2GAH C;  2WVC A;  2FJW A;  3V6D B;  3MCS A;  5KFD A;  1TZ0 A;  1FKP A;  1BQX A;  2O01 C;  3ILJ A;  4OYW A;  4WFX A;  2KG1 A;  3FQK A;  2ZBQ A;  3EX7 B;  1RXO B;  4N77 A;  4M5L A;  4B3T F;  3ZC4 A;  5GMK a;  2UXD F;  5DG9 A;  3CJK B;  4I2P A;  4MTP A;  1YRU A;  4Q8F A;  4OHZ A;  2DTJ A;  1HNX J;  3ENQ A;  1L3K A;  4DLE A;  3KK2 B;  2HHT A;  2N82 B;  2HBY B;  3GR0 A;  1TQL A;  2FDN A;  3W66 A;  4ATN A;  4JI4 F;  3CJS A;  2RIJ A;  2XG8 A;  3BGR A;  3IG1 B;  1HQE B;  3TW0 A;  4Q43 A;  4OI4 A;  5A0Y B;  3C6U A;  1D8Z A;  2DNN A;  2RHS B;  2OTL S;  4Q2M A;  2D9P A;  4Z7Y A;  3TEH B;  3G6X A;  4GKK F;  2OSQ A;  2VFT A;  1HBN B;  3TAQ A;  3D0G E;  4C3M A;  4DG1 A;  2DO0 A;  1LXJ A;  2MZR A;  1I51 B;  1R0B G;  1X4E A;  3MR7 A;  1SH0 A;  1NK4 A;  2B7B B;  2CQD A;  2W25 A;  3NXZ A;  1TKX A;  1XK8 A;  4J9S A;  3DM2 B;  1UW4 A;  2B6A B;  1RAC B;  3A8J A;  3QO9 B;  4IR9 A;  4JV2 A;  3NMR A;  3BBC A;  1NDK A;  1HWJ A;  5CAA A;  2CWK A;  6AT1 B;  1N5Y B;  5AXL A;  3HVW A;  4YY3 F;  2DNM A;  1FRM A;  1CVJ A;  1LEO A;  3KHR A;  3C14 A;  1E6Y A;  3X3U A;  1HHT P;  2N7Y A;  2YBV A;  3HHL D;  4E8U A;  3CD0 A;  1HNW F;  4UOC A;  3MM9 B;  1NJI T;  1WC4 A;  1LW2 A;  2G2O A;  1NXI A;  3CJR A;  3TZX A;  2L9W A;  4Y2C A;  3AJ2 A;  4U6P A;  5G4D A;  4ZIV A;  3OW2 R;  5DGA A;  4F8R A;  2W7A A;  2WON A;  4JOU A;  5CYQ B;  3WDO A;  2HGN A;  2G9O A;  4LF1 A;  4IOA Q;  1CS4 A;  5AXN A;  3IWN C;  5JVH Q;  5ETK A;  1C4C A;  2C3U A;  3HFV A;  5FII A;  4A8S A;  5F0W A;  1WEL A;  3IGN A;  4FYV B;  5DRK A;  3M9N B;  1SJR A;  2HHP A;  4DCP B;  4BWM A;  5AE2 A;  3VAF A;  5HK4 A;  5B08 A;  2D41 A;  2ZC4 A;  4ZA1 A;  4C8L A;  1TUW A;  4KSE B;  4WYL A;  2GJI A;  1K9M T;  2H5J B;  3HFK A;  3M8P B;  1JJH A;  2EK6 A;  3L7P A;  4YEA A;  3HMJ G;  2J9C A;  1J5E J;  2VDI A;  4X66 J;  4E98 A;  1YHQ S;  1PBA A;  1OJ4 A;  5BR8 F;  1YK9 A;  2WB4 A;  3DLK A;  3A8E A;  2DIS A;  3CW2 C;  1AW0 A;  2QA4 G;  1S9E A;  1ZM3 A;  2MLX A;  2HHV A;  1Y5I B;  1RA6 A;  2XTJ P;  4RW8 A;  4UTG A;  2F7V A;  3WX4 A;  1JKH B;  2DRD A;  2KYZ A;  2ZE2 B;  3M1V A;  2WBM A;  4G1I A;  2E1R A;  1AB8 A;  4IYQ A;  4KO0 A;  4WXW A;  3U27 A;  3ULH A;  1RWM B;  4M5K A;  5KG3 A;  2IFX A;  2Y0B B;  4CWB A;  2PFF B;  2MY8 A;  1WJ9 A;  2IRY A;  5J2M B;  1PIL A;  4PCQ A;  3TYT A;  3JB9 k;  5JMN A;  3W64 A;  2MQQ A;  3MHY A;  1T9Y A;  4W90 B;  5F8M A;  3UFC X;  4XIU A;  1FJC A;  3AD9 C;  3H0P A;  4KV8 A;  2NUU G;  1HPZ B;  2HFU A;  3OL6 A;  1TEL A;  1BD6 A;  4TN2 A;  5KFL A;  3QSY B;  2GQC A;  2HSE B;  5F0U A;  5KFJ A;  2RRB A;  3VZH A;  2IVM A;  1IJF B;  3HD1 A;  4DQS A;  4EZ6 A;  3UN3 A;  2AP6 A;  3TWZ A;  5BJR A;  1XJW B;  5KT7 A;  2BQU A;  4RNM A;  2I2Y A;  4Y2I A;  3GSI A;  3M6U A;  4H4K A;  2KG0 A;  5H1S V;  1LFP A;  1SQE A;  1YJU A;  3JTO A;  5EDW A;  4AL7 A;  2BKP A;  5D4N A;  4J7C A;  3UD4 P;  3BF4 A;  4R25 A;  2JVO A;  4EFA C;  3AHP A;  4KHP F;  2RF2 B;  5DLF A;  1U2F A;  2Q1L A;  5D4P A;  4TU7 A;  4ED2 A;  4Q0B B;  2WW4 A;  1CLF A;  3HKW A;  3MD1 A;  5DM6 Q;  2WZ1 A;  4RBU A;  3PTW A;  4QYR A;  3Q8Q B;  1C1B A;  2IBO A;  5E3Q A;  4R8U B;  3DOL B;  2ASJ A;  2CNN B;  3PRB A;  4LT6 A;  1NSK L;  2UUT A;  2H51 B;  3TAR A;  3R7B B;  4J90 A;  4EUV A;  4X66 F;  5EUH A;  1DZ5 A;  3FBB A;  1S0M A;  3CDA A;  2J76 E;  2RNE A;  3TAM B;  3Q8V A;  3PZP A;  2NZ4 A;  2XI2 A;  2DKO B;  3SYZ A;  4FPR A;  2BRK A;  4OI6 A;  1LXN A;  2C3Y A;  2Y0S D;  5E3C A;  1RTI B;  2ZH1 A;  1U1P A;  2KFY A;  2XS2 A;  4UUW A;  4CLF A;  1H3D A;  2JWN A;  4YDX A;  5GAD U;  1K8A T;  3FMW A;  2MKJ A;  3NS7 B;  2KFZ A;  3IMQ J;  4ZJO A;  1RAA B;  1KQF B;  4ZKA A;  4QR1 A;  1N34 J;  1EKS A;  2QFI A;  2Z2M A;  3OXF A;  4OL8 A;  1N5S A;  2YKN A;  5HRO B;  2E7X A;  1M1G A;  3PYG A;  4KTQ A;  1VJQ A;  1X60 A;  5GAE U;  2ROP A;  2JHE A;  4MKB A;  4AD6 A;  4R5P B;  2XY6 A;  3VVU A;  1ARO P;  5DQI A;  1K1Q A;  4DV2 J;  4QJV A;  5IQQ A;  1RTD A;  4ELV A;  4OLO A;  5FDL B;  3GCX P;  2XM3 A;  4IUF A;  3FUY A;  3V4M A;  3G6V A;  2VPZ B;  1FXR A;  3AQP A;  2V8P A;  3EIC A;  3ILO A;  4ZVU B;  2W7O A;  2DEI A;  3KLG B;  3EGN A;  3E3X A;  1SVD A;  4RW4 B;  3TUP A;  1VLO A;  1L3V A;  5HN0 A;  4ETZ A;  1NSP A;  5K14 B;  4HHU A;  3PX6 A;  1LFW A;  3CC7 S;  2KRB A;  1U1O A;  2E44 A;  1EET B;  1SQF A;  2I9S A;  3GJR B;  1KQS R;  3MMC B;  1XBW A;  4DR1 F;  2YX4 A;  1SPB P;  4LBI A;  3EVW A;  3JAM U;  4YDD B;  1F3V A;  4AXJ A;  1K44 A;  4H4O A;  2ZD1 A;  5IT0 A;  2LDY A;  4HVZ A;  3THP A;  5KG4 A;  2F63 A;  3C8Y A;  4JI6 J;  1JLB A;  1FKO A;  3VGT A;  1F5B A;  2QT7 A;  1F9F A;  2ZM6 J;  5K20 B;  2ZWP A;  3CJ3 A;  3CD7 A;  4WWS A;  2QSW A;  3R5C A;  5E2Q A;  1S1X A;  2P8I A;  3ET6 A;  4U9R A;  4MT1 A;  1AUD A;  3CT9 A;  5AXK A;  3OR2 A;  2HZA A;  3AXM A;  3UPF A;  2K7J A;  1HLW A;  3PW2 A;  4C8N A;  3RRH A;  4NXN J;  4Q8E A;  1GQE A;  1FDB A;  4LIW A;  2W24 A;  2FHJ D;  4YOE A;  4OHY A;  2HVH A;  4DSL A;  1U0H B;  5ETM A;  2ZDO A;  2BE7 D;  5A8R A;  1NPP A;  1RT2 A;  2AJ1 A;  2LEP A;  3Q8Y A;  2IVF B;  4ES2 A;  1X9W A;  4NYZ A;  4IFV B;  3L95 X;  3M30 A;  1PYS B;  3Q89 A;  4K50 A;  4F4Z A;  1TK5 A;  1LK5 A;  2Y9H A;  1CJK A;  1SBR A;  2PEB A;  3H2V E;  2M5Y A;  3GIL A;  4DL2 A;  2EFP A;  2OH2 A;  1DFD A;  1AFJ A;  4ECQ A;  3DLE B;  1U0S A;  3PX4 A;  1CJT A;  5ITH A;  2ZEJ A;  5B0G A;  2I5J A;  1FX2 A;  1CPZ A;  3GV7 B;  4S0M A;  1RHJ B;  2GO8 A;  5JUM A;  3QT6 A;  1RAH B;  2KI2 A;  1Q1K A;  4ES1 A;  1JXV A;  4TYA A;  4O3Q A;  2HAF A;  2EG2 A;  4RPF A;  1LWF B;  4ETX A;  4B17 A;  5IWA J;  3T1H F;  2UUA J;  2B51 A;  1SC3 B;  3AT1 B;  4FZV A;  1RWN B;  4KH0 B;  5CQG A;  1SKW A;  5E3P A;  1T9U A;  4OYX A;  3D4J A;  2RIL A;  4TXS A;  4WII A;  5HVF A;  3RBX A;  1HNX F;  1Q8L A;  1SH3 A;  1DTT A;  4OYM A;  3K59 A;  3K8W A;  2CPD A;  4K4X A;  2ZZN A;  4PXD A;  2E7V A;  3EPI A;  3J7Y I;  2CJK A;  4O3S A;  1ACM B;  2HPU A;  4J9V A;  4CH7 A;  3CE8 A;  3DRP B;  2GW8 A;  2MKS A;  3DGP A;  1JB0 C;  3IM9 A;  4X62 J;  3OTO F;  3NS6 A;  1IJE B;  3IAS 9;  2V4J B;  3GFH A;  4NRU A;  2N3O A;  2XLK A;  3W5X A;  3C16 A;  4ID8 A;  2OPQ B;  1OPZ A;  1RAF B;  1IKW B;  3OLA A;  3CXC R;  3B6B A;  2Y1J A;  3SI8 A;  5DO2 A;  1GNK A;  1JQG A;  2DK2 A;  3UCG A;  3Q2S C;  3WIU A;  5LJ3 Y;  3BS9 A;  3KLH A;  3MPY A;  3CCE S;  2BE2 A;  1TL7 B;  2FGC A;  4OJG A;  4WP9 A;  4F50 A;  4MFB B;  3CDW A;  1T9W A;  1WKK A;  3QGG A;  1R0C B;  2MTL A;  1HNV B;  2DJW A;  2DNZ A;  3D3C J;  5E0O A;  1NAQ A;  1VOM A;  2Z2L A;  3B4D A;  4KBI A;  4WFA Q;  4DR3 J;  5HVH A;  1HNI B;  2FD2 A;  2C2E A;  2ASY A;  5G0R A;  4DU8 A;  2IBK A;  1WOR A;  2OUG A;  3RUB L;  3H4B A;  1RT6 B;  2EW9 A;  2WTF A;  1DAX A;  3MAQ A;  3GR1 A;  4OV6 A;  4KPY A;  4CYU B;  4ZPT R;  3UI3 A;  1T3O A;  4NML A;  3N5F A;  1MMD A;  3TUJ C;  2OIH A;  5C5J A;  1REV A;  5ADZ A;  4U95 A;  2FJD B;  1TKT B;  2KJV A;  5D8H B;  2HQF A;  3U7J A;  1M1H A;  3BN7 A;  2XO7 A;  5DDP C;  1ZPV A;  2R8G A;  3MMB B;  4CLW A;  1MSW D;  2NXE A;  1IBL J;  2DGQ A;  1S97 A;  4PUO A;  5IT9 Y;  3PFE A;  5B09 A;  1Q16 B;  1VJW A;  2FC8 A;  3PDN A;  4M5D A;  4CNZ A;  3D1H A;  5IFM A;  2PA8 D;  2ZH8 A;  2RAQ A;  4QIV A;  3SQG A;  4N41 A;  4ILM A;  3DLG B;  2G2Z A;  4A8Q A;  4DR6 F;  2XZD B;  5J2P B;  1HR0 J;  4X62 F;  4P73 A;  1TL1 A;  1IBC B;  1M5O C;  2XYG B;  4ED5 A;  1HNZ J;  3Q86 A;  3SXL A;  2YKP A;  3M2R B;  1WUU A;  4A46 A;  4RNN A;  2HZV A;  2UU9 F;  2K1R B;  1RI7 A;  4YR3 A;  3GIJ A;  4TLQ A;  3NBP A;  3W63 A;  2D69 A;  4UZB A;  3P4U B;  1K1S A;  1JLF A;  1Y5N B;  3MMJ A;  3CCS S;  2LQ5 A;  4I0W A;  5C25 A;  1FER A;  2UZA A;  4JI0 F;  5HL7 Q;  3NGD A;  1V6H A;  3T5L A;  4DX6 A;  4XTT A;  2VF3 A;  4U96 A;  4WKR A;  2B9Y A;  1U2C A;  3BGF A;  3T41 A;  3LPE A;  2YXL A;  4M5I A;  3QRQ A;  4OQJ A;  2E1P A;  2MZT A;  4O23 A;  4MYU A;  1OYE A;  2GA7 A;  3SSR A;  1S9G B;  1UP1 A;  2ZBP A;  1HYS B;  2B4P A;  4NL5 A;  2XWX A;  4B08 A;  1PJ7 A;  2RT3 A;  3OSN A;  1RAJ A;  5J2Q B;  3PR5 B;  2VQE J;  2VIH A;  1F2G A;  1EKR A;  2BZ2 A;  2ZH3 A;  1FNO A;  2D3U A;  1IBK F;  2DPJ A;  3CO0 P;  3KKF A;  4LSN A;  3SMZ A;  2OPS A;  1J27 A;  2DGV A;  3MF5 A;  4G1P A;  1XR5 A;  4DV7 F;  5HLF A;  5A8K B;  4DR5 J;  4OMF G;  2UXC J;  5LOQ A;  1RT1 A;  3I5A A;  1D9A A;  1SKR A;  1HBO A;  1FK9 B;  3HHL C;  2HMI B;  1Q78 A;  4LRE A;  1RT5 B;  2RQK A;  5BYR A;  1SKS A;  2UUC F;  3E2E A;  4YR2 A;  3K7R A;  4ZIT A;  4KGZ B;  3AOA A;  2YNG B;  3FVY A;  1VI7 A;  3QBC A;  2CJX B;  4IH5 A;  4C0O C;  3T9Z A;  2N7C A;  4CLL A;  1SL0 A;  3HD2 A;  1J2V A;  1S6U A;  1R43 A;  3TR5 A;  2CQ4 A;  1X5P A;  3NP5 A;  4K59 A;  3E01 A;  4M5H A;  3FEY B;  4JI3 F;  4Z2X A;  3PEJ A;  1ITP A;  5B0E A;  1WF0 A;  2GJ2 A;  8AT1 B;  3ENW A;  3K5N A;  4ECS A;  4HI2 A;  2RDD A;  4DF4 A;  1UPM B;  1ZS6 A;  2HRU A;  4NA2 A;  2DY1 A;  4PXE A;  4AXI A;  5BXI A;  2VHG A;  2K2P A;  2W2M P;  4OX6 A;  2IPO B;  4NLY A;  1MLA A;  2M0G B;  3M8Y A;  3OLB A;  3PX0 A;  3D6F B;  1FJG J;  1PYO B;  4KGK A;  2DPI A;  1S1W B;  4C8K A;  1IR0 A;  4OZL A;  3W5Y A;  4F4Y A;  1X9M A;  2QLJ B;  4C8O A;  4IH6 A;  2R2U A;  4AQY J;  1TKD A;  1TR0 A;  1D0E A;  4JI4 J;  3IS9 B;  4O3R A;  1F0X A;  2D1C A;  4DFP A;  2AJ0 A;  3SV4 A;  2F4F A;  4PAA A;  2HBZ B;  4Y2M A;  3MCN A;  4Q2L A;  3DC2 A;  1LW0 A;  5CCL A;  5J1E A;  2R8H A;  1UFK A;  4LFC F;  5EX3 A;  3JSR A;  4URS A;  1VQ6 S;  4CO3 A;  2DT9 A;  2UXC F;  5I3U B;  3IA0 A;  5ETS A;  2ZH2 A;  1CJV A;  3S01 A;  2KB2 A;  1U8S A;  4EU0 A;  1VYA A;  4FF4 A;  4NLD A;  3T3F A;  4LQ3 A;  1RT3 B;  3D6H B;  1JLG A;  5K5M A;  1YBA A;  3RW7 A;  1ZM2 A;  4K7Q A;  5F3Z A;  4ZPB A;  3OQ2 A;  1CC8 A;  2VPX B;  1G1X A;  1BC6 A;  3GFX A;  2JEF A;  2M3D A;  1BGX T;  4WU2 A;  2XUL A;  4HL9 A;  1N0U A;  3D0I E;  4CLZ A;  3HM9 A;  3ZTR A;  2NQP A;  4DV3 F;  1TL5 A;  1NHK L;  5D0R A;  3Q22 A;  4X4V A;  4FBT A;  2OPR A;  5HQ8 A;  2HFS A;  1U7L A;  3I0S B;  4M8L A;  4PWU A;  4TNO A;  3TA0 A;  2HNY A;  2V69 A;  4FXW A;  2J7U A;  3PNI A;  1KFD A;  3UDC A;  4URG A;  4ER8 A;  2ERR A;  1QAY A;  3CME S;  2VL1 A;  1JLC B;  1QDU B;  1YJV A;  1PSD A;  5BYS A;  4F7V A;  2BV3 A;  3JSM A;  2VFU A;  1T9V A;  2OEM A;  4WE1 B;  2IJR A;  1Y7P A;  1IR2 A;  3J7Y U;  2J9D A;  5HAT A;  5KFE A;  3QLH A;  3CUN A;  2FLN A;  3UCZ P;  1IKX B;  2UUW A;  3NNA A;  1YJR A;  4MIA A;  2MB0 B;  2KZM A;  1OWX A;  4ZVG A;  2E5I A;  2EC0 A;  1B0T A;  4KR0 B;  4AND A;  2G0I A;  3BSO A;  4IG0 B;  1NKB A;  2PII A;  2CNO B;  3S7R A;  2OSR A;  2O5D A;  3GU0 A;  2DH7 A;  4P10 A;  1VK8 A;  2MYF A;  1IBM J;  4ECY A;  1W2I A;  4HHJ A;  1FD8 A;  3M32 A;  5KFF A;  2LEA A;  1WEX A;  1VCT A;  2ILZ A;  2PD1 A;  1TL4 A;  4P75 A;  2W9B B;  4FF1 A;  5CYJ A;  2LEC A;  3QRR A;  4KGV B;  2ZH7 A;  3GG1 A;  4DV4 F;  4ZLN A;  1XC9 A;  3KG4 A;  5HMX A;  1LOU A;  1R6V A;  1VRT B;  3DRS A;  3HFZ B;  5J1N A;  5LSR A;  4LF7 F;  3N6N A;  5HMZ A;  1GMW A;  5HBM B;  4L75 A;  2FUG 9;  5CHC B;  5ETL A;  5DQG A;  3DXB A;  4QYZ J;  4KRW A;  4RW9 B;  1BQM A;  1UFL A;  3L09 A;  1Q81 T;  2VA2 A;  2ZBI A;  3CC4 S;  3MEG A;  1RZM A;  2IA0 A;  4IQX A;  4DN0 A;  2P6S A;  2ZH5 A;  4LUB A;  3R5G A;  4P2F A;  2FHM A;  3DLH A;  2C28 A;  2HW3 A;  3SFG A;  2IM1 A;  4MKV A;  3FGV A;  3QWU A;  4WTY A;  3WQP A;  4ED0 A;  3RAQ A;  3BDP A;  4M5M A;  1S57 A;  5KOW A;  1SJ1 A;  4LF4 F;  2M4M A;  2VBX A;  1NB2 A;  1WOP A;  3QIP A;  3IR6 B;  2HQI A;  5JXS A;  1RCO B;  1WC3 A;  3KJQ B;  4DZ6 A;  1KON A;  1N33 J;  4Q45 A;  4OHX A;  2OEJ A;  2ABY A;  3EZU A;  4EEY A;  4PAB A;  1Y9O A;  3W2W A;  3I9Z A;  2NRE A;  3CMQ A;  2MKI A;  1F3F A;  5IC4 B;  3KDN A;  5M2R A;  1FT8 A;  3HXM A;  4WZQ A;  5GVQ A;  1KS2 A;  1R8P A;  2X3D A;  2Z56 B;  4OYZ A;  3GQC A;  2MGZ B;  5KFW A;  4GVL A;  3NMA A;  1NHU A;  1U24 A;  1H2T Z;  2DNR A;  3N9U C;  4LIR A;  9ATC B;  2AGQ A;  4TY8 B;  2KVQ E;  4JV0 A;  2CZ4 A;  2LQ9 A;  4K5R A;  2W4C A;  2KHC A;  3M4X A;  4YB5 A;  3VF0 B;  4YME A;  3OBI A;  3P96 A;  5LXY A;  3KJV A;  2AKW B;  2CG4 A;  2G1D A;  3M8Q A;  4EGL A;  3KHH A;  2LQ8 A;  4LF2 A;  3SFU A;  5KFG A;  4C48 A;  2G4B A;  4YQW A;  2QL7 B;  4NMX A;  5JVG Q;  4DV4 J;  4X65 J;  3C46 A;  2YKO A;  1WF1 A;  3TO8 A;  3N6L A;  3HHL A;  3JQK A;  2CVE A;  2M2B A;  5CA5 A;  3Q2T C;  3BZQ A;  4H4K C;  1WOO A;  3TJA A;  5L1L A;  2VBZ A;  3QZ8 A;  4K0K F;  3C3L A;  3JSB A;  1QUV A;  1VLY A;  2ZOF A;  3FBF A;  3L7O A;  3PEH A;  1RT4 B;  3RJM B;  3L7U A;  1KOO A;  3MTK A;  2CQG A;  2IIH A;  1RHU B;  4O44 B;  5IT4 A;  2DNQ A;  4Y00 A;  3UVJ B;  4A8K A;  2X7I A;  1P1L A;  1Z4U A;  3F41 A;  3RG6 A;  4ECW A;  2YX7 A;  4ZLJ A;  2JOQ A;  2GFF A;  4B9M A;  2WB1 D;  2LXF A;  4QZV B;  2IHR 1;  3NGU A;  1YKW A;  5L1I A;  2MLY A;  2LA4 A;  7FDR A;  2AJF E;  3MPU B;  3TZY A;  2F8E X;  3LAN A;  5KFV A;  4QCL A;  1URN A;  4CI0 B;  1GH8 A;  2KU7 A;  2W8L A;  2N4C A;  3EGZ A;  4WFN Q;  1UEV A;  2I0X A;  2JJ4 D;  4DR7 J;  3F44 A;  1B3T A;  1RKI A;  4EO6 A;  2IAJ B;  3H42 A;  5CD4 H;  2MZQ A;  4HT5 A;  1U48 A;  2CQB A;  5T14 A;  3GYX B;  4LFA F;  1YI2 S;  1FWK A;  1RT7 A;  4WKY A;  4NLT A;  3V5R A;  3Q83 A;  1FA0 A;  1WEY A;  3V2U C;  3EZ5 A;  1NND A;  3TAP A;  4CO5 A;  5C42 A;  2R2R A;  2HND B;  1UET A;  4UF4 A;  5LL6 d;  4F0K A;  1SIW B;  1TAQ A;  5DZ6 A;  2X1F A;  2UUB J;  4BWJ A;  3FFI A;  1Y11 A;  1T95 A;  3PJ9 A;  4J91 A;  4TQS A;  2MLZ A;  2HHH J;  4CTA B;  4F3Q A;  5GAG U;  1TL3 B;  3KNA A;  2V2Q A;  3IXQ A;  1N36 F;  4F02 A;  4HH1 A;  3T6B A;  1H98 A;  4LF5 F;  3CD5 A;  2MPU A;  2X1A A;  4X2B A;  2NUH A;  2GHP A;  3W2V A;  4HDH A;  2E66 A;  3MM8 B;  3MM5 B;  2ZH4 A;  1EP4 B;  1SV5 B;  1WG1 A;  3HSG A;  3UNY A;  2M88 A;  3CDE A;  3BJY A;  2J0Q D;  2LA6 A;  1APS A;  1T03 A;  4EWT A;  1CQM A;  3IAM 9;  2CXE A;  2BKO A;  3BBB A;  2EEY A;  2MQL A;  3T19 A;  2XCA A;  2QLW A;  2HRT A;  4G1Q A;  3KJN B;  1D09 B;  4G6V B;  4BC9 A;  4ID5 B;  4WYW A;  2WW8 A;  3I6P A;  4CO0 A;  1NK0 A;  2E5J A;  2WHO A;  2V9K A;  2YNH B;  3BPS P;  1VQ8 S;  4C11 B;  1KKH A;  3MEK A;  2MXY A;  1C0T B;  2IC3 A;  3TNV A;  3D6M B;  1RLC L;  2K3K A;  3EDR B;  4L3K A;  1S49 A;  2YWH A;  4LFA J;  4NYO A;  3ITH A;  1ZYQ A;  2V6A A;  2CZV C;  4KFB B;  1CJU B;  3BSN A;  5E5N A;  2NPI A;  2V63 A;  4O3N A;  4X4S A;  2AX0 A;  3I0R A;  2R8K A;  4QWE A;  2DHG A;  1C4A A;  5IWA F;  1LWE B;  1AA1 B;  3KUH A;  1NK7 A;  2IA6 A;  1JLQ B;  4QW8 A;  4CLY A;  1NSA A;  2RH3 A;  3GMG A;  4ZCL A;  3ZTQ A;  2F4V J;  2BMB A;  1TKZ B;  3C6T B;  3WX8 A;  3POT B;  4QBU A;  4O4G B;  4UOF A;  5B0D A;  1KLM B;  1UVJ A;  3QJJ A;  2DYA A;  3UCU P;  5KFU A;  4QW9 A;  3DU5 A;  3W5Z A;  1SC4 B;  2GNK A;  4PPD A;  4LF5 J;  4HKQ A;  2Z4P A;  2HWI A;  3OFH A;  5LM7 E;  4N8O A;  1KNZ A;  1P1T A;  3H8Y A;  1FFW B;  2DH9 A;  1ZET A;  1ZA1 B;  1LK7 A;  2HFV A;  2IM0 A;  4YHH J;  4GKJ F;  4PRF A;  1T0T V;  2X51 A;  2YQ1 A;  3BGL A;  3NGK A;  1JLE B;  3KLE A;  4DLG A;  5D3G B;  1N48 A;  5KFC A;  4C4W A;  3OJU A;  5HP1 B;  1ZPW X;  2RQC A;  4K4T A;  1XMQ F;  1RK8 A;  1NBE B;  4OX9 J;  1HW8 A;  5C7P A;  1XNQ F;  3QJP A;  4WPA A;  5HP1 A;  4ZVT B;  3PW5 A;  1S1V A;  3MAA B;  1VBX A;  3DCA A;  3KXD A;  5DS7 A;  3GTY X;  2CPE A;  4RUA A;  2LQB A;  3TP2 A;  1QSS A;  5EWF A;  3OTE A;  2FY1 A;  2FIU A;  1NUE A;  2A10 A;  3DKD A;  2MZS A;  2C1E B;  1H7X A;  3ZXW A;  2D3Z A;  1SJF A;  4LBP A;  1UCN A;  2GS8 A;  3KWM A;  3QZ7 A;  1KOH A;  2MEW A;  3NAH A;  4NOH A;  5KAK A;  5I42 A;  3UR3 C;  5KFB A;  1N56 A;  3POT A;  3C6T A;  1TKZ A;  3DLL Q;  1HQU B;  1RTZ A;  2ATL A;  5CYM B;  1OY8 A;  1UWB A;  1QTM A;  4PXC A;  1N6Q A;  4DDF A;  3MPD A;  2XMU A;  5IXU A;  2XSJ A;  1UVL A;  2HHQ A;  4DI6 A;  2R7T A;  2COL A;  2BA9 A;  1B99 A;  3I0R B;  3M8S A;  1NM2 A;  2YNI B;  3CCM S;  3QAE A;  2W2O P;  4DPT A;  4KFB A;  1WSV A;  2ZVS A;  2NR0 A;  2AF6 A;  3DOK B;  3BYP A;  1MU2 A;  2QL9 B;  2VFS A;  4HAC B;  1ZOT A;  3ZTP A;  3W9J A;  3BGU A;  2PSZ A;  3LP1 A;  2HIQ A;  3LP0 A;  5H9F K;  1XIQ A;  4XDD A;  5EX0 A;  3PXG a;  3TOQ A;  2KHD A;  3NKY A;  1XN9 A;  3NGT A;  3NNH A;  2L3M A;  2F8H A;  2D9O A;  3A3N B;  3CJ2 A;  3H90 A;  1FRL A;  5A6P A;  2ZFH A;  2V5H G;  1S0O A;  4ZVF A;  1Y0H A;  5IOL A;  2F9J A;  2MY7 A;  2OEK A;  5J2N B;  1HD1 A;  3LAL A;  2W9C B;  2RS8 A;  3W8P A;  2ZZT A;  1NJX A;  1Q82 T;  2D3O 1;  2B9X A;  3IRX A;  5KFA A;  3SSQ A;  3MM5 A;  4JI0 J;  4WP3 A;  2BM0 A;  1VQ7 S;  3OVS A;  2H4W B;  4JV5 F;  3M8R A;  2DHA A;  4ED3 A;  4PYA A;  2ACM A;  1RWU A;  4DUY J;  2XI3 A;  2GO9 A;  3KLI B;  3VCD A;  1ZM4 A;  1UFW A;  1LQ9 A;  1TV6 A;  5DJB A;  2QX0 A;  1QAX A;  3HVR A;  2VD3 A;  1CG2 A;  3SQO P;  1O8B A;  2C2K B;  5L46 A;  1SJ4 P;  3UDL A;  1VRU B;  3FFI B;  4ZVO B;  4ES3 A;  3UQS A;  2QL5 B;  2VKR A;  3PRV A;  1RTJ B;  2DBB A;  2JNJ A;  1WD6 A;  3EDQ B;  5C24 A;  3CJ0 A;  3EPG A;  3CMA S;  1VMB A;  2HND A;  1WDD A;  1WC5 A;  1RWW B;  4KIA A;  5D4O A;  5C42 B;  3KYL A;  2ZJP Q;  4DF8 A;  3H5S A;  3LO3 A;  2BJD A;  1N5T A;  4MK9 A;  2M9K A;  2VC1 A;  5IQ6 A;  4DR5 F;  4B3T J;  2UXD J;  3PO5 A;  2HQ3 A;  4U67 Q;  1TUG B;  4PWD A;  2B3T B;  4B9U A;  3OVB A;  4I6W A;  4ZHR B;  3UD3 P;  2HUR A;  2BX6 A;  1AUS L;  3LUY A;  4B9V A;  3L3C A;  2VDH A;  2XSF A;  1FWL A;  4N47 A;  1PJ5 A;  4OLP A;  3LAK A;  4U7U K;  1RBL A;  1UVK A;  5DM7 Q;  2KT2 A;  2OI2 A;  2WBR A;  3BKU A;  3QYY A;  2JDJ A;  2Z2Z A;  4ZHR A;  1WTF A;  3A1Y G;  1T94 A;  3RB4 A;  4Y2A A;  1KVI A;  2A0F B;  4DS4 A;  3GFZ A;  2NXC A;  3WC2 A;  1TP7 A;  3JS9 A;  1MWZ A;  2PMZ D;  2PA3 A;  3BQ2 A;  3MWB A;  5BR8 J;  1AZS A;  2BJ1 A;  2XEX A;  2UV8 A;  3LGH A;  3H7H B;  4NA3 A;  5KFI A;  2GC8 A;  4MJK A;  3GV5 B;  5CD4 A;  4NCA A;  1X5T A;  1NCL A;  1RDR A;  4ZMM A;  1H2U X;  4W4M A;  2DR7 A;  2HNZ B;  2VG7 A;  3DRR A;  3NOG A;  4ZOS A;  1OYD A;  1VRU A;  3IBW A;  4X4O A;  4MIW A;  4I2Q A;  1R8C A;  2DR6 A;  2V50 A;  3DHX A;  3HVT B;  1S79 A;  4RW6 B;  3LWL A;  2QFJ A;  3TAN A;  5H9F J;  2UVW A;  1QTN B;  2N3L A;  1M5H A;  3N4W A;  3TX8 A;  4ILR A;  3H4D A;  4X64 J;  2W4D A;  3NCR A;  3LP2 B;  2HFO A;  5T7L B;  1VQS A;  4L74 A;  3G9C A;  2HBQ B;  1HMV A;  1SIZ A;  2VFV A;  1EAR A;  3QT7 A;  3ZZZ A;  1KD1 T;  2ZH9 A;  4O3O A;  1Q5Y A;  3FZ2 A;  3RZA A;  4FNI A;  4HTJ A;  3M8Q B;  4JI8 J;  3MM6 B;  3BQ1 A;  4P52 A;  4FP9 A;  2CJQ A;  4NAS A;  4AUK A;  5F9N A;  3F73 A;  4DR7 F;  4F3O A;  3KTQ A;  4P7V A;  2K3I A;  3N5B A;  3R2D J;  1XMB A;  3VQT A;  2WK4 A;  4X4P A;  1ULR A;  4RNH A;  4HAC A;  1Y3K A;  5KFO A;  4CCH A;  4RLE A;  1S7I A;  1JX4 A;  4FXD A;  4TLR A;  1S1T B;  1P6T A;  3M6V A;  4N7T A;  4FYW B;  1S1T A;  2PO4 A;  3W2W B;  4YS2 A;  3CCV S;  4EBD A;  4KC5 A;  4C9D A;  1GXL A;  4HR2 A;  1J5E F;  1DBD A;  4F2R A;  5E3R A;  3EZO A;  1NB7 A;  5LJ5 Y;  2XSJ B;  1RKJ A;  1Q8K A;  1IWA A;  1I94 F;  3R6G B;  4ZVP B;  3S8S A;  2QN6 B;  1MWQ A;  5ETQ A;  3WBZ A;  4OYB A;  3A8K A;  3EM1 A;  3OD2 A;  2VPW B;  3AD7 C;  1HI1 A;  1OQ6 A;  3FC9 A;  1B70 B;  3ZZU A;  4F67 A;  5IS2 A;  3DDK A;  2HQG A;  4C98 A;  5A2Q Y;  4NXM F;  5I42 B;  1RIS A;  4JP8 A;  2DCL A;  2GAG C;  2A3J A;  7AT1 B;  3A8I A;  4WXO A;  5ETT A;  2OMO A;  3MPW A;  1YG0 A;  3O1L A;  5RUB A;  1SCJ B;  2LCW A;  3GIK A;  2DXD A;  3OXL A;  4RW9 A;  5DDQ C;  2UP1 A;  1S12 A;  4P2M A;  4DUZ J;  4J9L A;  1U02 A;  4FKY A;  3OTO J;  2ZHO A;  1RWO B;  3GCW P;  5MAO A;  1UJ6 A;  1QVF R;  4F04 B;  2XZT B;  5ETO A;  3D54 A;  4W98 A;  3CTR A;  1HL6 A;  1M90 T;  4KE5 A;  2GJF A;  3MAH A;  1RAB B;  2H9Z A;  4I2Q B;  2VOO A;  5C2C A;  4DHV A;  5L8R C;  3X1L B;  6FDR A;  4F4W A;  2AV5 A;  2FJE B;  3DRR B;  4Y3C A;  5D3G A;  1LV5 A;  4IQM A;  4NEY A;  1BUX A;  4OYA A;  2DY9 A;  3FEZ A;  4E0D A;  4IG0 A;  5MLC V;  1U2R A;  1EB0 A;  1WHV A;  4USK A;  3J81 j;  1EHW A;  4QQB A;  4KGM A;  2UXB F;  1AZS B;  3D67 A;  3Q8P B;  3ONQ A;  4BCA A;  2KL8 A;  3KMQ A;  4PR6 A;  2EFG A;  2HVZ A;  1X9S A;  2XMM A;  2WVB A;  1LNQ A;  2GIF A;  4DQI A;  4ANC A;  2W8K A;  1GEH A;  1U47 A;  2ATC B;  1QAI A;  2BKN A;  1E6V A;  1FRJ A;  2BJ8 A;  4J37 A;  1B0P A;  1FFG B;  2V68 A;  2VFR A;  3CNQ P;  5E7O B;  4F26 A;  1FRX A;  4F4X A;  2KDO A;  4ED1 A;  4MYT A;  3BO4 A;  1S4E A;  1CBK A;  1LWE A;  1TK0 A;  2RE1 A;  2XMV A;  1XER A;  3C15 A;  4TYB A;  4ECZ A;  1JNR B;  2ZM6 F;  1UEU A;  1T05 A;  4ZPW R;  4IH7 A;  4ZJL A;  2F4V F;  2H4Y B;  1CJU A;  1GAO A;  1TK8 A;  5DDO C;  1FDD A;  2B9W A;  5LSL A;  3CD6 S;  3ITH B;  2JEG A;  1LWC B;  1RE1 B;  1VQO S;  4L73 A;  2CQ0 A;  2GX8 A;  3O44 A;  4ENO A;  4FF3 A;  3PW4 A;  4DCJ B;  1W2B R;  2XMK A;  1I5O B;  4O0I A;  4J9R A;  1M5V C;  1DAR A;  5D6G A;  1HHS A;  3AQO A;  1FE0 A;  5KFR A;  1GX5 A;  2MKK A;  2V2Z A;  3C19 A;  4HDG A;  2G1H A;  2GGP B;  3PVX A;  1GTE A;  4DQR A;  1N5Q A;  4G1Q B;  1TV6 B;  4ZP7 A;  2FLL A;  3KLI A;  4NLV A;  2NXJ A;  3ETM A;  1A7G E;  1HIY A;  1S6Q A;  1KN6 A;  4I6A A;  4Y65 A;  5KFX A;  4AT1 B;  1NJZ A;  3R2C J;  1VBK A;  3ZTS A;  1EP4 A;  1SV5 A;  1WC0 A;  5E3A A;  3MR6 A;  3I4P A;  1S0V A;  1OO0 B;  1WKJ A;  2GIQ A;  1S6Q B;  3IS9 A;  5EWE A;  2KH9 A;  3MFH A;  3GV8 B;  3DNC A;  4BLG A;  1NKC A;  3CGI A;  5J2N A;  4G65 A;  4WFB Q;  1RAI B;  4ANE A;  4DQP A;  1JJC B;  3J7Z T;  1TL3 A;  2CPH A;  8RUC A;  3BO2 A;  2CPY A;  2FHJ A;  1VHF A;  2GGP A;  4NLX A;  4D3H A;  1NK5 A;  3CED A;  2BBE A;  1N54 B;  4XPE A;  1S76 D;  2QC3 A;  4U7C A;  3ISZ A;  1SL2 A;  3LP0 B;  5GAH I;  2QTW A;  4CRJ A;  2R7Q A;  1WSR A;  3LP1 B;  3JXO A;  3PR4 A;  3LA0 A;  1U1R A;  1PAU B;  1S7H A;  1LWC A;  2IYI A;  4TKT A;  5KT3 A;  4JI2 J;  2BOP A;  2KFN A;  4MH8 A;  1X5S A;  1HI8 A;  2CDR B;  5E33 A;  2XYP B;  3E01 B;  1RT7 B;  3KNG A;  4DPU A;  2ZJQ Q;  2W9A A;  2YNI A;  2C22 A;  5IV4 A;  3HHN B;  2DXE A;  2OFH X;  3I4H X;  3PHE A;  4NZ0 A;  1F5A A;  3FKB A;  3B8H A;  3OHB A;  2LEB A;  1T05 B;  3C15 B;  3MUT P;  4JI5 F;  3I96 A;  3GSD A;  1C2P A;  4WF9 Q;  2OLW A;  1PIE A;  5B7W A;  3LPY A;  4NXN F;  3T5H A;  4F4A A;  3MUR P;  4B9L A;  5HSP A;  1U45 A;  2BAC A;  3HHD A;  1E6V B;  1HQU A;  4IKA A;  1G7C B;  2EI5 A;  2BW7 A;  4DPX A;  3VVT A;  1Y4Z B;  5A8K A;  3BKF A;  2V0N A;  1Z2L A;  2OPS B;  4HH0 A;  2RS2 A;  5DZ7 A;  2C2D A;  3SSS A;  3N79 A;  3HLU A;  1OIA A;  3E8O A;  5T41 A;  3RRG A;  2E5G A;  3P8B B;  2B56 A;  5J2Q A;  3P6Y C;  3PY8 A;  5KT5 A;  1HFE L;  2KM8 B;  1X8D A;  3WIV A;  3GII A;  3HSZ A;  1FWP A;  1S1V B;  3MAA A;  1NKE A;  4MKY A;  1QSL A;  1SI9 A;  1UW9 A;  2HGL A;  3TVY A;  3IN5 A;  2B7C B;  3UVJ A;  4DR3 F;  2PI4 A;  4AFF A;  3P45 B;  3B78 A;  4EBE A;  3FRY A;  1L3T A;  2CQC A;  2EK1 A;  4JUZ A;  2ZBC A;  4RUC A;  4IRC A;  1VFJ A;  1RHM B;  1WG5 A;  1SKU B;  3ISN C;  2B9E A;  3H5X A;  3UO0 A;  2J8A A;  2K1R A;  2VKZ G;  2UUA F;  3M2R A;  4DFJ A;  1KLM A;  1T9X A;  4O4G A;  2BXJ A;  5F8L A;  1JMT A;  2CYY A;  2OHD A;  4FDF A;  1DQ8 A;  3B4M A;  2OD4 A;  4EI2 A;  2EBG A;  3DLG A;  4QWC A;  4DL4 A;  2DR8 A;  4TY8 A;  4PPZ A;  2GCF A;  4KY3 A;  2MGZ A;  2MKC A;  3JQM A;  4PUO B;  2AD9 A;  1Q8I A;  4LFB F;  3VGS A;  1YGY A;  1B0V A;  3BKT A;  3ISN D;  1Q4R A;  4P9S A;  4LRD A;  4LSZ B;  3RB6 A;  2JFK A;  1D3W A;  1PBU A;  2V2K A;  3RB0 A;  1OSD A;  1Y3J A;  2IRU A;  3QRP A;  1TKT A;  4OYI A;  4DUT A;  1IM6 A;  4K2J A;  3T9N A;  2IY5 B;  3U02 A;  1I1G A;  5KTQ A;  1C0T A;  2IC3 B;  3VHQ A;  4C8Y A;  1DQA A;  2XHW A;  3DRY A;  2CNL B;  2NPF A;  2R7S A;  4C11 A;  2YNH A;  2AGP A;  4XK8 C;  2DHH A;  2DVI A;  1OSC A;  2PT0 A;  4ID5 A;  1GTH A;  3MM6 A;  1ZZF A;  5F8N A;  2EW0 A;  2CPJ A;  4HLB A;  3RBD A;  2CQI A;  4TQR A;  4QWD A;  1ICE B;  4QYZ K;  3AOC A;  5KFM A;  1A0O B;  1PG5 B;  3UR0 A;  4ZP8 A;  4F0M A;  1RYR A;  3MEG B;  1T03 B;  2KYX A;  5KFZ A;  2MHE A;  4MFB A;  1HMV B;  1Q79 A;  2ASL A;  4PKD B;  2B8Q A;  1FEE A;  1FF2 A;  3H5U A;  3U1L A;  2BE2 B;  3VAI A;  2ZIT A;  3LP2 A;  5HAO A;  3IR7 B;  5T7L A;  1IR1 A;  3SCL E;  3OFF A;  2NSC A;  2ADC A;  4RWX A;  1EJ7 L;  3DRS B;  3GLJ A;  4WIQ A;  2L48 A;  3FDS A;  2PEH A;  4IR1 A;  2V4J A;  2XNQ A;  5JJB A;  3HVT A;  4RW6 A;  3CDB A;  3HO1 A;  3A13 A;  2W9B A;  4ED4 A;  3GYN A;  4DV5 J;  3IC1 A;  2E9R X;  3WC0 A;  4CZC A;  2HNZ A;  2OAU A;  2VG7 B;  2ZC3 A;  2CQ1 A;  3WZ0 A;  2QO3 A;  5A76 A;  2JH3 A;  3T6J A;  4UOG A;  4ZJQ A;  2NS1 B;  4DV0 J;  4OZ0 A;  3AH6 A;  2MZ1 A;  1M1K T;  1F9H A;  3IP0 A;  5I3P A;  1SJQ A;  1YZ6 A;  5F9L A;  5EN1 A;  2NLW A;  4RNO A;  1X4D A;  3JTP A;  1EQM A;  2MKY A;  2V8G A;  2FYX A;  4QWA A;  4DR1 J;  4BC7 A;  2KN4 A;  1F60 B;  1YJ7 A;  4NLO A;  3JSY A;  3JSM B;  1HNZ F;  3I9V 9;  1GT8 A;  3BQ0 A;  2U1A A;  4CM2 A;  2PMH A;  1FNM A;  2BAB A;  3CCZ A;  3I0S A;  3FCH A;  1L3U A;  4XPC A;  1N33 F;  2R4F A;  4LR8 A;  3N28 A;  2EFQ A;  1VC0 A;  4PWD B;  2HFZ A;  1O5J A;  5B0B A;  1M5P C;  1N32 F;  1V3R A;  2EKN A;  3H5Y A;  3U1M A;  1CJT B;  4KHR A;  3RBE A;  1RT3 A;  3DLE A;  5KT2 A;  1WOS A;  2CQP A;  2W2P P;  3S1T A;  4DXL A;  5C24 B;  1RTJ A;  2FVQ A;  1CJV B;  8ATC B;  2WVE A;  3M30 B;  3TQ1 A;  5I3U A;  4IFV A;  4CP5 A;  1EAY C;  5D4L A;  3HP6 A;  3ZTO A;  4A8O A;  2XGQ A;  3AD8 C;  1KQK A;  1ZAW A;  1FO1 A;  3W9H A;  4NE9 C;  1AYE A;  4O44 A;  4DR2 F;  2DHX A;  4DSK A;  2NZC A;  3BEG B;  1RT4 A;  2IMO A;  4L76 A;  4KB7 A;  1RU2 A;  2Z58 B;  3G4S S;  4JBC A;  1LW0 B;  3DDN A;  3MD3 A;  2QLX A;  2WAQ D;  1TFW A;  3J80 U;  4F4K A;  3IRX B;  2VIC A;  2E5L J;  2ASD A;  1U26 A;  1YIJ S;  5HMW A;  2RJZ A;  2UVU A;  2AEM A;  2CIM A;  1ZZN A;  5LT5 A;  3CCT A;  4K2X A;  5ETV A;  2W9C A;  3NEK A;  5LMU J;  2RRA A;  2BE9 B;  2YPY A;  1ZH5 A;  2VOP A;  3IBC B;  4OFZ A;  3G71 S;  4LF6 F;  2ACY A;  1FFS B;  5KG6 A;  1ZAV A;  1S1W A;  1R8A A;  3KJV B;  2ZJR Q;  1FEH A;  3U1N A;  5M2U A;  5EHH A;  3NCQ A;  2QYC A;  4Y34 A;  1KWM A;  1N0V C;  5DET A;  4DR4 F;  2A6M A;  2GV1 A;  1NDC A;  4OHV A;  3K2Y A;  1MU2 B;  3OL9 A;  3LGN A;  1PAE X;  3DOK A;  4H4O B;  4USV A;  3RR8 A;  2OFG X;  2R42 A;  2QMU B;  3R5B A;  4LF6 J;  3CC2 S;  3K0J A;  2MQ8 A;  4YP3 A;  1FJE B;  2GS5 A;  2ZKU A;  3MMC A;  4DX5 A;  3NY0 A;  4FVM A;  2DH8 A;  1MN9 A;  3ZNU A;  3BSC A;  1Q7Y T;  1YWX A;  3QIP B;  5K14 A;  1QVG R;  1N36 J;  4OJ1 A;  2I38 A;  4GC7 A;  1N6Q B;  4B9N A;  1WWH A;  2BEF A;  1S77 D;  4BHQ A;  1UWB B;  2CNK B;  3AJD A;  4M63 A;  4QIW D;  5CYM A;  1HBO B;  4QR0 A;  3TEG A;  3W60 A;  2ZNY A;  2RRN A;  2FJV A;  4HI1 A;  5FDL A;  3PIP Q;  2P2C B;  1U6F A;  3T1Y J;  4JYA J;  4LSN B;  5KFS A;  2R2S A;  4DSJ A;  3GG0 A;  1H72 C;  2BW2 A;  2HS4 A;  2HK3 A;  2OEL A;  4ZN3 A;  2Q66 A;  3CVK A;  3O5T B;  2J9D E;  1F2H A;  1WHW A;  2DB1 A;  2QYG A;  4Q44 A;  2E5L F;  2FB0 A;  2PC6 A;  3ENV A;  2HHH F;  2VBY A;  2JC1 A;  5LMU F;  1VRT A;  2KO1 A;  2O3D A;  3BR9 A;  1MMN A;  4J9M A;  3OTB A;  5F8I A;  2ZNZ A;  3UWT A;  2W7P A;  4LBH A;  3PYF A;  4LJM A;  1WHY A;  4UOH A;  2C2R A;  4A8F A;  1JLE A;  4FYY B;  4ZVE A;  3KLE B;  2UVV A;  1S5Z A;  3QQC D;  4B3M F;  3HCX A;  1YTY A;  5KG5 A;  1XWL A;  1YJT A;  2XCP A;  2GQQ A;  2Z8Q A;  4B02 A;  2BQ3 A;  2HAI A;  1FRH A;  3J7Z 5;  5D77 A;  2IDE A;  4NCB A;  3WHI A;  1IKX A;  1KP6 A;  2FZK B;  4JI8 F;  1TL1 B;  3I31 A;  5K8O A;  4WE1 A;  4R8U A;  3BDE A;  1C1B B;  3HX9 A;  4LR9 A;  1AT1 B;  4NLG A;  3UNG C;  1JLC A;  5J2P A;  3PV8 A;  4B3S J;  4ECV A;  3SQG B;  2MMY A;  1JLQ A;  2ALZ A;  4Q0B A;  2RF2 A;  3FK4 A;  3MCM A;  2ZZM A;  4XO0 A;  3M6W A;  4J5O A;  2FJX A;  2XWY A;  2C42 A;  4GKJ J;  1RSC A;  2F3J A;  1B64 A;  4EYI B;  1UJ5 A;  1HR0 F;  2ADB A;  4QPT A;  2QJ3 A;  3CIM A;  3J80 Y;  3VAL A;  2IRX A;  4WTO B;  3FEX B;  2G13 A;  2IM2 A;  5GAD I;  2HIY A;  4MAK A;  1WI8 A;  1BWE A;  1JLG B;  3D9B A;  2BOA A;  3BR8 A;  3ZZT A;  4CYU A;  5KT4 A;  1T8E A;  4LF7 J;  2CQ2 A;  2DCU B;  3V6H A;  3JAM Y;  4KV8 B;  2J6S A;  3FBC A;  2F40 A;  3W3S A;  3CJQ A;  1FCA A;  3H20 A;  2NYH A;  5G0R B;  1U1N A;  2VV5 A;  4USM A;  3EE3 A;  1XR6 A;  4TVA B;  5U47 A;  2KM8 C;  4AL5 A;  4LRF A;  2YWK A;  2ZVI A;  4CLP A;  1H2V Z;  2HS0 A;  1HNV A;  2N4D A;  3Q8U A;  4C6A A;  5BYQ A;  1KHW A;  1BLU A;  5J1E B;  3M1V B;  3TZW A;  5AE3 A;  5I3Q A;  4YHH F;  2AYG A;  3FZB A;  3MOZ A;  4LRA A;  2V94 A;  3G8T A;  1S9E B;  2VJV A;  1VRQ C;  1FD2 A;  2J8S A;  2Y1R I;  3MM8 A;  3NLC A;  4WK3 A;  2DGT A;  5F41 A;  3W2V B;  4AYB D;  4CLU A;  3KLH B;  2UVR A;  1XTZ A;  4I1T A;  1IKW A;  1YSJ A;  2OPQ A;  3HSD A;  2J0S D;  2CPI A;  2J0W A;  4I6Y A;  5E41 A;  4LF9 J;  4FKX A;  1VQK S;  2LFV A;  1V3S A;  3NG8 A;  4CTA A;  2AEF A;  2HG4 A;  3MZI A;  3PG9 A;  4EZ9 A;  2MQN A;  2Z30 B;  1IQZ A;  3T1A A;  1HA1 A;  4K4W A;  1UVN A;  4DPO A;  2NXN A;  4NYP A;  2W4P A;  3VGU A;  5K8M A;  4GC6 A;  3BV8 A;  3KDO A;  3J81 U;  5CZV A;  1RAG B;  3BRE A;  4KHM A;  3ZZO A;  1DTT B;  1MWY A;  1F6T A;  1CS4 B;  2BDP A;  3PRD A;  2IDL A;  3KG0 A;  5DG7 A;  1HWI A;  1UEK A;  4NLS A;  4DV6 F;  3P5B P;  3CJ8 A;  3HI9 A;  2CPX A;  3IWL A;  1X4H A;  2CPF A;  4Y28 C;  3TRG A;  2YNG A;  3AB4 B;  5A6W A;  5D15 A;  2IAJ A;  3W1Y C;  1V5I B;  2QE5 A;  4OHW A;  1P8G A;  2UUB F;  1FK9 A;  2R7W A;  4ECU A;  4DWI A;  4YN3 B;  4C7Q A;  2MHN A;  2A2C A;  2OD6 A;  1N5Y A;  4N76 A;  1M0S A;  2I5J B;  1YBU A;  2MQO A;  3OJS A;  4DBQ A;  1RHQ B;  1YVF A;  3VR1 A;  4WCE Q;  1KBR A;  1P9Y A;  2PN6 A;  4QIG A;  2QLB B;  4OI3 A;  2GMH A;  2Q79 A;  3FNN A;  3GYG A;  2Y1L B;  2A1B A;  2LP4 A;  4QR2 A;  3CCJ S;  2XLI A;  1HYS A;  5GAG I;  2BJ9 A;  2YWW A;  4ZVR B;  3FMB A;  4CT9 A;  1GX6 A;  2KT5 A;  3QFH A;  4PWW A;  5A8R B;  2CJA A;  1RU1 A;  1T9T A;  4FVC A;  4X84 A;  5HMY A;  4C97 A;  2VQF J;  5HJX A;  2I1R A;  3DRX A;  4M5G A;  1JLF B;  2YKQ A;  2ZHA A;  5A0Y A;  3CO9 A;  1MG7 A;  3HHL B;  2HYI B;  1IQT A;  1FX4 A;  1RAO A;  3GJQ B;  4NRT A;  4PQA A;  4ZP9 A;  5L9N A;  5AJ3 J;  1VHI A;  1G2E A;  2HQD A;  2IVY A;  2V2V A;  3TX0 A;  4H54 A;  1JNZ B;  3GP9 A;  1R3N A;  4ALZ A;  4JV1 A;  1N52 B;  2CG8 A;  2RDI A;  2AYB A;  1O6X A;  1S1X B;  1Q95 G;  2RVJ A;  2ZUA A;  4I68 A;  3SCK E;  3H2U B;  1Q0N A;  3A3O B;  4UUX A;  3ZZY A;  4DV6 J;  3TJ9 A;  2XY5 A;  1T3N A;  2F9D A;  2X1B A;  1S4F A;  2G0C A;  3L9Z A;  4M5D B;  1OY6 A;  2V8H A;  5AT1 B;  4CM0 A;  2R8J A;  2PE8 A;  3V6D A;  2CKW A;  2C3P A;  2L9D A;  1ELO A;  3F0N A;  3MMB A;  2KXN B;  2QZ8 A;  5LSO A;  3K5M A;  5KFQ A;  3ENA A;  3VAH A;  1FDN A;  3NAI A;  2AZ3 A;  3BYR A;  2WRM A;  4JB8 B;  1IKV B;  1PYT A;  2GZO A;  1S6O A;  1REV B;  4DSE A;  2BJE A;  2WSF C;  3D28 A;  3G8S A;  4NLP A;  4P74 A;  4K4Y A;  1VR6 A;  2EG1 A;  2LMI A;  2VH7 A;  2R7O A;  2ZOM A;  1L3S A;  4LQ9 A;  3BBF A;  1RAE B;  2EXU A;  4MMO A;  4P72 A;  5ETR A;  3M9O B;  3EGV A;  5C2G A;  1X0F A;  1GXT A;  1RT6 A;  3O3L A;  1QM9 A;  3KLG A;  5L9X A;  3K8V A;  1ZTT A;  1KR4 A;  4B9T A;  2XS7 A;  5CH7 B;  3G8Q A;  3NOC A;  1UKU A;  4QU7 A;  1EX8 A;  1HNI A;  4XDC A;  1VQ5 S;  1VIX A;  1RWP B;  2YY3 A;  3LH2 S;  4EMD A;  2MQM A;  3PYD A;  1UTA A;  5IC6 B;  5F8G A;  4DR2 J;  1OS5 A;  3QGI A;  4OX8 A;  3BH7 B;  1BQM B;  2R8I A;  3IM8 A;  5FLX U;  5HQL A;  2LLZ A;  3R6L B;  4ZS6 A;  4PG8 A;  3RAX A;  3HHE A;  2VZ9 A;  1BE4 A;  2WSC C;  5HBM A;  5HRO A;  3HSJ A;  3HZG A;  4QIE A;  1R8B A;  3G87 A;  4FN5 A;  1T11 A;  2KKH A;  4HEA 9;  3HKZ D;  4K8R A;  5AJ3 F;  4DS5 A;  1VBZ A;  3GPA A;  4X4N A;  3GB0 A;  1RJJ A;  3IGV A;  3VAG A;  1RTI A;  3LGM A;  4ZP6 A;  4IRK A;  3M32 B;  4LRC A;  5GME A;  5L1K A;  4YUD A;  2OP5 A;  4A8Y A;  1Z2Z A;  5DLG A;  4DL7 A;  2M8D B;  1RHR B;  2VBW A;  3AB2 B;  2ILY A;  4OIX A;  1Y00 A;  3US5 A;  4ZIW A;  4DFM A;  1QUP A;  4K4S A;  4NZ7 A;  1WC1 A;  1HWL A;  1NRK A;  2DRA A;  2QMX A;  3KHL A;  2DEJ A;  4NX9 A;  3HPO A;  1ZA2 B;  3QLH B;  3KG1 A;  2DRB A;  4TU9 A;  2CA9 A;  3M7V A;  1VIO A;  1Q5V A;  3KLV A;  2BJ7 A;  2QLF B;  4DN9 A;  3RGI A;  1W7W A;  2DR9 A;  3TQE A;  1CEZ A;  2HNY B;  1LWF A;  2PDA A;  3I5B A;  2HRY A;  2OML A;  2OPR B;  3PAC A;  4DJB A;  1HAR A;  2BM1 A;  1NH8 A;  1O51 A;  2GIR A;  1WDT A;  2E7W A;  3SBM A;  4I69 A;  1KC8 T;  2VON A;  4Y6I A;  1V5V A;  1GFW B;  3BH6 B;  2P9C A;  2PMW A;  2HZC A;  4GKK J;  4JI1 F;  3OHA A;  2CPZ A;  4RO0 A;  1CQN A;  5LMN F;  3T1Y F;  1KTV A;  1P27 B;  4Q5V A;  4GO7 X;  2W2Q P;  4RNF A;  4YB7 A;  1F5C A;  2FY8 A;  2C2M B;  3UN2 A;  3MGJ A;  4NLR A;  4NXM J;  1KHV A;  2GVZ A;  2FZC B;  3CCU S;  2YQ0 A;  1QE1 B;  3K58 A;  3EWG A;  2FVR A;  4JI7 F;  1RT2 B;  2H5I B;  4KQZ A;  1PC5 A;  3KHG A;  2RDJ A;  5FD1 A;  4BDP A;  3J7A 1;  4FS2 A;  3FSI A;  1U0H A;  2WCX A;  2J6U A;  1XMO F;  3OTD A;  1Y10 A;  3Q8S B;  2B4O A;  2J7W A;  2VPY B;  2ZE2 A;  1QD1 A;  4DUZ F;  2DNK A;  3PJX A;  4RW8 B;  3N01 A;  4PXB A;  4IO9 Q;  1R8H A;  4MK8 A;  2AYE A;  4B3M J;  4CH1 A;  3RR7 A;  2ZH6 A;  5FJ4 A;  2VU5 A;  1HKA A;  4AE5 A;  3DHW C;  4ZCI A;  3OL7 A;  3K5L A;  4F3M A;  4J9K A;  2X1G A;  3MDF A;  4RKU C;  1VQ9 S;  5KG7 A;  2J9E A;  3D7S B;  3TZZ A;  4DQQ A;  1NLK L;  1S9F A;  2J6T A;  3MI7 X;  2DNY A;  1X4G A;  7FD1 A;  3CPW R;  2HWT A;  1K73 T;  1HI0 P;  1RQ0 A;  3EVM A;  2M70 A;  3I32 A;  2APO A;  2MKH A;  1JLB B;  1FKO B;  1GK8 A;  2NXU A;  3FQL A;  4OZ3 A;  5F3T A;  3SV3 A;  1A9N B;  2NYI A;  3HUL A;  3R5J B;  1WG4 A;  3M9M B;  4B3R F;  2JSX A;  3EJM A;  3BGO P;  3HF5 A;  3QFW A;  4RUB A;  1NPR A;  4NLQ A;  1DHM A;  3D2W A;  3KUE A;  3M8W A;  2MSS A;  5H9E K;  5HI7 A;  3MEE A;  4UZC A;  2MST A;  2DNL A;  3UE2 A;  2V4R A;  1RT5 A;  2ROE A;  5D78 A;  5GMD A;  4QPX A;  1RA7 A;  1E6Y B;  1KVK A;  1N32 J;  1RT1 B;  2K8G A;  3I5C A;  3ZNJ 1;  2ALY B;  3MR3 A;  2DIU A;  5HLF B;  1S48 A;  1RWX B;  2HWH A;  1W25 A;  2Z2Y B;  2LU1 A;  3JTN A;  2AW0 A;  4DUY F;  3DOM B;  2AJ2 A;  2RU3 A;  1YX2 A;  3RB3 A;  5B0A A;  3UD5 A;  4PG7 A;  3NGS A;  4LSL B;  1XMO J;  5D0G A;  3QT5 A;  2Y1I A;  3QO9 A;  1VC6 A;  1UZD A;  2B6A A;  2OO4 A;  2YWF A;  1W26 A;  2YKN B;  1S9G A;  4OI2 A;  3DDI A;  1RBO B;  4F0H A;  3DYA A;  3TUZ C;  1J5O A;  2R7V A;  4ELU A;  1RP5 A;  5HO4 A;  4ITS A;  2KXH A;  1S72 S;  1MW7 A;  1IM4 A;  4USH A;  3K89 A;  4JI2 F;  3GJT B;  3RRK A;  3R8Y A;  2M8H A;  1F1B B;  5C25 B;  1QSY A;  1YLX A;  3NBP B;  4KYZ A;  3CCL S;  4ECT A;  4LRB A;  3IG1 A;  3R5D A;  4KHP J;  1GMU A;  2KXF A;  4KAI A;  3O8W A;  3R1L A;  3ELH A;  2B4U A;  2EFV A;  1FNX H;  3DOL A;  3D6T B;  3CJ4 A;  2CDQ A;  4ZLP A;  4ZVQ B;  3TUI C;  1B7Y B;  3OR1 B;  4NZ6 A;  1X4A A;  5EWG A;  4ED7 A;  2BJ3 A;  2BQR A;  5AXM A;  2J5A A;  4A47 A;  3K5P A;  4Q7A A;  2AEJ A;  3V6K A;  5ETN A;  3PKM A;  1BWV A;  1NU4 A;  2RKI A;  4P2X A;  2QA4 S;  1JLA A;  2QSF A;  2FVP A;  2KTQ A;  1WAC A;  1WHX A;  2ZUG A;  4AL6 A;  1VK3 A;  4TY9 A;  4QWB A;  3OSP A;  3FSX A;  4HTI A;  3Q24 A;  1FRI A;  2A2D A;  4V1A k;  3W8G A;  2YH1 A;  1KSP A;  3NL0 A;  1HBM B;  2Q6C A;  4ED8 A;  2Z57 B;  1N34 F;  1HPZ A;  2DNH A;  4X64 F;  2K7K A;  3P49 B;  3HT3 A;  2B4V A;  4ZK7 M;  3OPK A;  1S0N A;  3P3D A;  1FKA F;  1R27 B;  4OV1 A;  5DDR C;  1VIS A;  1WI6 A;  3A4T A;  4OX9 F;  3R7S B;  3MTJ A;  3O6Q A;  4DPY A;  2DHS A;  3RAM A;  2ZOG A;  5DG8 A;  1XNQ J;  2PGC A;  2VQF F;  1FJ7 A;  1KEK A;  2D74 B;  2V67 A;  2WVD A;  3TA2 A;  4Y0F A;  1NJW A;  1NJY A;  4WJB A;  2LXI A;  1H6K X;  2XNR A;  1TL7 A;  4NA1 A;  1SH2 A;  1RAD B;  3R5A A;  1M5K C;  3IRW P;  4CO4 A;  3DLK B;  1FHT A;  1FTC A;  5AE1 A;  5IZH A;  3A12 A;  3SZ2 A;  4RBV A;  3FCW A;  3ZZ0 A;  3C16 B;  3IWX A;  4RL1 A;  1D1U A;  3M2U A;  3QSI A;  2DGS A;  3M8P A;  4ECR A;  4YY3 J;  4F2S A;  3DGP B;  4ICL A;  3HHK A;  3DRP A;  2JZ5 A;  3R3T A;  4USW A;  1XNR J;  4CIO A;  3CIZ A;  2IJN A;  3G86 A;  4C0B A;  1UA1 A;  3T1H J;  4P2S A;  1U4B A;  1U1L A;  2CFX A;  5SUH A;  3GIM A;  2Q3P A;  3DXS X;  2XB2 D;  3CJ5 A;  4RJV A;  4CLT A;  1PCA A;  4OZ1 A;  3QAU A;  4OJ3 A;  5KFK A;  1PGZ A;  2BVZ A;  1RCX B;  3ETO A;  1I94 J;  4DSI A;  2P9G A;  3H59 A;  2R9L A;  2HVI A;  3QWP A;  5CYQ A;  2SXL A;  4HHH A;  5IM0 A;  2OPP B;  3EVO A;  3LW5 C;  3PKY A;  3OL8 A;  2AU0 A;  1YIT S;  2VOD A;  2YWG A;  4OI1 A;  2CJ9 A;  4P71 A;  2F65 A;  4AQY F;  2J0X A;  1LW2 B;  3VZI A;  2AIR B;  2KJW A;  1B7F A;  2EBE A;  1K47 A;  2RB7 A;  1SL1 A;  1D9F A;  3OTC A;  2R7U A;  4LR7 A;  1BY9 A;  2MJN A;  4RR5 A;  2GHW A;  2QG9 B;  2QRR A;  4EYH B;  1UL3 A;  2YQ3 A;  4UW2 A;  2FVC A;  1U8W A;  4MIB A;  1NEE A;  4D3G A;  2I8E A;  2YNF A;  1LWX A;  3SEO A;  3G6E S;  2DR5 A;  5HAN A;  2XGP A;  3LQV A;  4IG3 B;  4NCG A;  1CJK B;  2CJB A;  1VQ4 S;  3DLJ A;  3HT0 A;  4B3O B;  1FDA A;  2IJF A;  3QGP A;  4ZPC A;  1AXQ A;  2DGO A;  2NCK L;  4USI A;  1L5U A;  1EZZ B;  2A18 A;  4DG1 B;  1DJ0 A;  1S6P B;  2GVD A;  2HBR B;  3VAJ A;  3P5T L;  1DRZ A;  1HBN A;  2CUY A;  3PW7 A;  3LAM A;  2AT1 B;  2YWE A;  1CSJ A;  2XQC A;  3D0H E;  1XNR F;  3C6U B;  1T02 A;  3R27 A;  2DIT A;  3HJF A;  1GXU A;  2JX2 A;  3D66 A;  1N5V A;  4K4V A;  1OPI A;  3BGR B;  2YX1 A;  3L4B C;  1SC6 A;  4LF9 F;  3FRZ A;  1BQN A;  4FF2 A;  3OR2 B;  3RW6 A;  2EPI A;  4N56 A;  3SCJ E;  3ET6 B;  1V3Z A;  5K8N A;  2L41 A;  4I2P B;  3CJK A;  4L3N A;  3OUY A;  1B4S A;  4CT8 A;  1TFY A;  5DGB A;  4ECX A;  5GAE I;  1SB6 A;  1XEZ A;  2G0J A;  1X4C A;  2VG6 B;  2VA3 A;  1FKP B;  1CC7 A;  4MK7 A;  2CAJ A;  3W65 A;  1HD0 A;  4DFK A;  4U7U D;  2AHO B;  1P9Q C;  2M7S A;  2ZD1 B;  1X4B A;  4ED6 A;  1KRP A;  3FBE A;  2BRL A;  1O0P A;  1A6L A;  2XMW A;  4H4M A;  1HW9 A;  3CCQ S; 
#chains in the Genus database with same CATH homology
 2HAF A;  2AJ2 A;  2GS5 A;  2GZO A;  2DO8 A;  2HRX A;  2EW0 A;  2MUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...