2GZOA

Nmr structure of upf0301 protein so3346 from shewanella oneidensis: northeast structural genomics consortium target sor39
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
187
structure length
187
Chain Sequence
b'MESLQNHFLIAMPSLDDTFFERTVIYLCEHDEKGAMGLVINKPLGIEVNSLLEQMDLPTEQVSADLAMGSQVLMGGPVSQDRGFVLHTSQPYWANSTELGSGLMLTTSRDVLTAIGSKRSPDKFLVALGYAGWSKNQLEQELADNSWLTIPADHALLFDINHEDRWQQASRSLGFEAWQLSTQAGHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0301 protein SO3346
publication title NMR structure of UPF0301 PROTEIN SO3346 from Shewanella oneidensis: Northeast Structural Genomics Consortium target SOR39
rcsb
source organism Shewanella oneidensis
molecule tags Structural genomics, unknown function
total genus 35
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02622 DUF179 Uncharacterized ACR, COG1678
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1300 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits VC0467-like domains 2gzoA02
3.40.1740.10 Alpha Beta 3-Layer(aba) Sandwich VC0467-like VC0467-like 2gzoA01
2DO8A 2GS5A 2GZOA 2MUIA 2HAFA 2AJ2A 2HRXA 2EW0A
chains in the Genus database with same CATH superfamily
1JLBB 4RW8A 2NXUA 4WTOB 2M2BA 4ZCLA 4N76A 1R0AB 1HQEA 1VQ8S 1VRTB 1S1VB 2AYGA 4B3TF 2RS2A 1S57A 1VQNS 5C2CA 1ZM4A 2MY8A 2HFUA 1BWEA 5T41A 1HNZJ 2XZTB 1Z4UA 1S0VA 4HT7A 3KG1A 2P6TA 1VGYA 2FLOA 1WSVA 1FESA 2UVWA 2DTJA 2F4FA 4K0KF 4CYUB 4A8WA 3I0SB 5L1IA 5FIIA 4RW9A 2V4RA 3C15B 1LW0B 2GFFA 2R8HA 2V69A 2E1CA 2DNHA 3FQLA 2RDIA 1XMOF 3DKDA 4W98A 4B3RJ 4V1Ak 1JNZB 2L9DA 3R7NB 2GAGC 3D0HE 4K7QA 1HFEL 4DSLA 5HMYA 5K14B 4ZA1A 3DOMB 1SH2A 2CQ0A 2VFVA 2MLXA 4DV4F 1PSDA 5EWEA 1X4FA 2OLWA 1Q8LA 2Z2MA 5GAGI 3C6UA 3QAEA 4LREA 4Y2AA 4DV1F 1FJ7A 3W9HA 5J2PA 2J0QD 2UXCF 4HVZA 5A0YB 3C6TB 3OQ2A 3FCWA 4LRAA 5SUHA 1WG1A 3UO0A 4ED6A 4G1IA 4RO0A 1RTDB 2XSJA 3TA2A 1HA1A 4P74A 1X4BA 2BJ3A 3M8QA 1YSJA 3PKMA 2FGCA 1VBZA 3X3UA 4DUYJ 2IC3A 4JI1J 3DOLB 1LXJA 1AA1B 4IFYA 1WSRA 1RT4A 3E3XA 2MYFA 2N82B 3I5BA 3L95X 5A8WB 5KFBA 1N5VA 4ZJOA 2OTJS 5HO4A 2JL9A 2FD2A 1Y3KA 1IKVB 5EN1A 2YWFA 3NNHA 4CO2A 2P5VA 4XDCA 1RT1B 4ZIVA 1IKXB 4CO1A 1EAYC 4ZJQA 5DG7A 3LO3A 4F3OA 2IM3A 1Z2LA 3TZZA 5F8HA 4NYPA 3GZ7A 5LMNJ 1FCAA 2W7PA 2VASA 5KFNA 2XMMA 4J7CA 4K4WA 1T02A 1IVZA 3Q24A 3OJSA 3JB9k 4JOUA 1X7VA 5BR8J 4OL8A 3CCWA 2CZ4A 5GAHI 3GFHA 2L9WA 3MEEB 3IWXA 3BBBA 2CQGA 3H20A 1S1WA 3CVKA 4L3KA 2X3DA 5HK4A 4PWDA 4DL7A 2LQ5A 1KOHA 3DLKB 3RU0A 1NK6A 1VCTA 5E5NA 1C4AA 2ABYA 4A8XA 4URGA 2V34A 2GIRA 4L76A 2NZ4A 2YNHB 2DXEA 2R7VA 5ETKA 1YBAA 2KDOA 1CC8A 3T9NA 1ZM2A 5THWA 2UU9F 5BXIA 4LF4J 2M70A 5L38A 2XMJA 1S1TA 1NK5A 1BQNB 4DR4F 3ZZ0A 5GVQA 5E2QA 3WQPA 3I56S 3BKTA 4ES2A 4FKXA 4ELUA 2EBEA 3HHEA 4KTQA 2BKOA 4Y65A 2VDIA 1RAEB 5DQIA 3NRBA 2QSFA 3KWMA 1CJVB 3OTDA 1VQOS 1XWLA 1VC5A 2ZH1A 2D69A 3K57A 3AT1B 3W64A 4NA3A 2BM0A 3AOAA 3RBEA 4HTIA 4BBYA 4Q8EA 4Y34A 2D3O1 1FERA 2VKZG 1IJEB 5GAEU 1F1BB 1LV5A 4B02A 3MM6B 2KFYA 2LEAA 1OPIA 5IT4A 4WKRA 4DFPA 4X2BA 2JC1A 3HHLD 4K4VA 4BDPA 4NX9A 1EIYB 1LFWA 5HJXA 4ZPBA 3MOJB 3AOBA 2Z0GA 1RKIA 4QQBA 2J8SA 1S1XA 4BWMA 2JLFA 1FVQA 2H65B 4QWCA 1K47A 5B0BA 2ZM6F 2RMLA 2ZZNA 4LRDA 1RDRA 3EMTA 4X66J 3CJQA 3US5A 1ZYQA 4FS2A 1C1CB 1NSQA 1Y10A 2G2OA 4ERDA 1QJHA 1JNRB 2LKZA 4M5KA 2AW0A 4NRUA 1CULB 3MGJA 3HZEA 2E9ZA 3CD7A 2WHOA 3BKUA 1RADB 4EU0A 3AXMA 1Q53A 3UN3A 3UWTA 3QJLA 1C1BA 4V19J 4F4ZA 3KFWX 1T9UA 3BR8A 2OO4A 4ED1A 3CGIA 3D9BA 4EWTA 2KXHA 2M7SA 1N5SA 2CJBA 4Z7CA 3QGHA 2V4QA 2M9KA 4ZDNA 1VBYA 3H5UA 4DSKA 4O3QA 3T1YJ 1R89A 5JVGQ 5DDPC 3RYLA 2HFVA 1D8ZA 1YTYA 4CNYA 2C3MA 1U26A 4ICLA 3MCMA 2IRXA 1UVMA 2IBKA 2R7WA 2FZKB 4WPAA 2KXFA 1IBKF 2QTWA 4CM0A 3OVBA 1X9MA 4A8YA 1RT5A 3HSDA 2HVHA 3Q0AA 2RDDA 3R9LA 1OSDA 1RUSA 1OY9A 2R2UA 5ETVA 4PAAA 3GILA 2P9GA 5J2NB 3G86A 2CZ9A 1EQMA 3SCLE 2IM0A 2UUTA 2V4JB 3FZBA 3VAKA 2HG4A 4KRWA 3JSMB 3MEDB 3GIJA 4UF4A 1NEEA 3Q8RB 2YQ1A 4IH6A 3ITHB 2JZ5A 2QLWA 3CF5Q 3QPIA 1T0TV 4F4YA 3PRVA 2GJ2A 5H9FK 3UR3C 2J9CA 4D3GA 3E01A 2KT2A 1V3ZA 3HF5A 1QUPA 4WFXA 3TVYA 5IC6B 4TYBA 5LT5A 3FEXB 2U2FA 3KNAA 1JJ4A 3MFIA 2HBZB 2JEFA 1GT8A 2LQ9A 1JK9B 1JQGA 1EJ7L 3PIOQ 4Q44A 3HVAA 3UVJA 4ZVQB 5LM7E 3SCKE 2PC6A 4LR9A 4CDIA 4DZ6A 2YKNA 3IS9A 3QNWB 2B9XA 4K50A 1XNQF 2KFZA 3FRYA 3SDEA 5I42B 4J9PA 3W1YC 3BGOP 3VGTA 3QIPA 2FVCA 3C8YA 3FBFA 3OTOJ 4DR1J 1PGZA 3KLFB 4RU2A 2OMOA 5E3CA 3DRXA 4RWXA 2HRYA 3M2UA 3P45B 4KJIA 1HBMB 1V6HA 1R0AA 4W90B 1J2VA 2A18A 3TARA 3FQKA 4ECUA 1VRTA 1S1VA 5CQGA 4FYWB 4OI4A 3G6XA 2HHUA 1ROFA 2WBRA 4CYUA 1YJRA 3MMAB 3FNNA 3I0SA 3GLJA 3QO9B 4U7UK 1ITPA 3C15A 1LW0A 1VK8A 5DGAA 3K2YA 5DG8A 4KH1B 1PCAA 2HQ3A 2FC9A 4JV1A 4G65A 1RQ0A 2W01A 4FF1A 2CJKA 4KE5A 2E5LF 1KFSA 4LF6F 4PQAA 3CIMA 4P9SA 3KHRA 2XSFA 5BYSA 5K14A 1X4AA 2AX1A 2WVFA 3DOMA 1JKHB 5KG2A 4JI8J 2BDPA 2WVEA 2G9OA 4X64F 2W7AA 2DGVA 5HJYA 3C16B 3FK4A 2OP5A 4CI0B 4ZVRB 2XI3A 4PPZA 4JV5F 1R6YA 4JI2J 1VLYA 3NCRA 4QW9A 2C2MB 1UFWA 3X1LB 3R7BB 2GHWA 4NLRA 5A0YA 3C6TA 3UN5A 1IR0A 2CPZA 3I9V9 3C14B 1Q86T 1RTDA 4HH0A 5KTQA 3D0GE 2XS7A 2MKYA 4YR3A 4OHWA 4ZN1A 3R5DA 2WZ1A 3CNQP 1X5PA 2HQGA 5C25B 2GMJA 3DOLA 1N36J 2SXLA 3OJUA 4ER8A 3GV7B 2CNKB 1R8BA 1VDHA 4ECQA 2ROGA 2VJUA 3UNGC 2CQBA 3VQTA 5U47A 5A8WA 2ZHAA 3KYLA 1SPBP 1V9OA 4EO8A 1IKVA 3V4MA 1MMNA 4PEOA 1RT1A 4F50A 1IKXA 3SCJE 1R27B 3HM9A 2Z8QA 3NMAA 3K8VA 1YWXA 3A3OB 4XK8C 1FNMA 1HIYA 4AT1B 4QIWD 5JMNA 1TUWA 2PMZD 2AJ4A 2NLWA 2V2KA 4LF2A 4Y00A 1IBMJ 2B9YA 3MF5A 3ONQA 1QAJA 1JWWA 4C8YA 3D6HB 2V68A 4LSLB 3TAMB 1N4LA 3KKFA 3UPFA 3A8JA 2AZ3A 1VQ9S 5K8OA 3NWRA 4NLUA 1Q79A 4KH0B 3MEEA 2LEPA 7AT1B 3HHDA 1SQGA 4LFCF 3ZTQA 3V6HA 3NKYA 4OJHA 2ZJRQ 2YNFB 1VQ4S 3VAIA 1HNXF 3SQGB 1GX5A 2JEGA 4MMOA 5DQHA 4B9TA 4X4QA 4C8NA 1DZ5A 4LFBF 4QJVA 2YWKA 2Z57B 2UUAJ 1SC3B 4BLGA 3JYTB 1CLFA 4XIUA 4OI1A 3MCSA 2DT9A 2C3OA 2LA6A 2VH7A 4OLOA 2O66A 3Q8SB 4IFVB 2NXCA 4Z7YA 4AXJA 3G87A 1BQNA 1Y5IB 1APSA 4OMFG 1M5VC 5CXTA 1RHMB 4F4KA 2X1FA 2DK2A 2XS5A 1CJVA 4IG3B 3E51A 3QFHA 1SJRA 4OYXA 5M2RA 2JLGA 5KFPA 3CD5A 2E5JA 4RLEA 3QYYA 2GQQA 4W92B 3PW2A 3KTQA 1DBDA 3H42A 5GADI 4X4RA 3IRWP 1S97A 2XZWA 5GAHU 1HW8A 5M2PA 3DNCA 5ETMA 2FTRA 3MM6A 4JV2A 1EX8A 2KZZA 5CYMA 1DHMA 3L3CA 1OO0B 3S6EA 4ES1A 3TNVA 4YY3J 1FEEA 2CUYA 1RZMA 3ILJA 4O3RA 1L3KA 1CJKB 5K5MA 2BW2A 5D0RA 2G0IA 2KU7A 2EKNA 1RAJA 4ZLPA 1PJ5A 4FVMA 1LQ9A 2DGOA 2JX2A 2AZ1A 1NSPA 4I56A 2IDLA 1CULA 2BR0A 3CCVS 1U09A 4HACB 3HD1A 2H3EB 1F9FA 5CA5A 3QGGA 1U0SA 3KDNA 2AYEA 2DPJA 2C2RA 4NXMJ 2GVZB 2HGNA 5J1EB 1YX2A 2KO1A 2V67A 4FZVA 4P52A 4LRFA 4DFMA 4OJGA 2ADBA 2VF3A 2MMYA 3PIPQ 2MY7A 4YR2A 2B43A 3QWPA 2V8PA 1TK0A 3J7Z5 1IM4A 2ZOFA 4IOAQ 2DEIA 3JTOA 5KFKA 3T1HJ 1FWLA 1QDUB 2DR8A 1TL4A 3JAMU 5F9NA 4FYXB 1HBOB 3I4PA 2VPZB 4P10A 1ACMB 2OAUA 3PKYA 3D6FB 4G6VB 4DN0A 1QE1B 4HDHA 4IRKA 2M8DB 3BR9A 2J6UA 3K5OA 5I3QA 4J91A 1YRTA 4ZVUB 2B7BB 5F3TA 1S0MA 1LFPA 4ECTA 1RU1A 4Y2KA 1KS2A 1NNDA 4N77A 2DCLA 1XEZA 1SJFA 1WC0A 1HARA 1KFDA 5J2NA 2DGTA 3PO4A 4C2MA 1XC9A 2HRUA 1UJ5A 4DV2F 4B3SJ 2ZH4A 1RB0A 4NRTA 5D0GA 3W3SA 1GXUA 1Y00A 5M2UA 4H4KA 3BH6B 3UN2A 5HN0A 3GCWP 4DR5J 1KSPA 4RZRA 1RWNB 2AHOB 1G1XA 1Q0NA 3JSMA 4MKBA 3MEDA 2L41A 1IR1A 3CCSS 3ITHA 4K4ZA 2NREA 3QSYB 4RNFA 3U1NA 3PW4A 2AGOA 3J7YU 3FBBA 2H54B 1RLCL 5B0FA 2YKQA 4NMXA 4DR7J 1QVGR 2YQ0A 3CJ2A 1IUJA 4C8LA 1FRLA 5KG4A 4OJ3A 2V5HG 2QT7A 1NKBA 3CWJA 1KEKA 1D9AA 3GYGA 5ITHA 1QSLA 2B7CB 3SQOP 2O1PA 2Q1LA 2DISA 3M8YA 1A0OB 2HRXA 8AT1B 2V0NA 2PFDA 2LQ8A 4NMLA 5B0CA 2Y0BB 1NB2A 3ZZPA 5G4DA 4PWWA 1SIZA 4DV7F 2KL8A 1HQ2A 4QWAA 3QJJA 1REGX 5I42A 3AOCA 2YH1A 3EPIA 1DURA 2M3DA 4DX7A 3KLFA 1F5AA 2E7WA 2N7YA 2MHNA 1XMQJ 2AEFA 5K8MA 1HBMA 1O51A 1MROA 4NLXA 5AXNA 2V50A 2D3OR 2W2OP 4I64A 2FY8A 4ZVGA 1RT3B 3OXFA 3CJ5A 1OPZA 5B0GA 2QJ3A 1N0UA 3VGSA 3QT6A 2DXDA 4IOCQ 2J76E 4X4PA 6FDRA 1HL6A 3MMAA 3ZFVA 3G71S 2PEBA 2GJIA 2ASLA 3JSYA 2RQMA 2OSQA 3L7PA 3MECB 5LMUJ 2HBYB 1HKAA 4HKQA 3MPUB 2HZAA 1X4HA 3MAAB 4EO6A 4DV5F 2HKEA 4EI2A 2UXBJ 4FF2A 4O3OA 4KPCA 3PHEA 1T95A 1S9EB 4WTYA 3J81j 4I6AA 1JKHA 4HHUA 5IZHA 2P8IA 2PD1A 3CUNA 1JX4A 5B09A 4YB5A 3C16A 3QT8A 2DH9A 1BGXT 1V5VA 3P8BB 4Q43A 1S6UA 2OFHX 1AUDA 3TA1A 2NSBA 5AXLA 3H59A 2HVIA 4F02A 1RAGB 4NLSA 4JI4F 4ZITA 2NPFA 2GHPA 2YVSA 3AH6A 1KLMB 4HL9A 2DGQA 1Q4RA 1RXOB 4USWA 2C2DA 4JP8A 3GIMA 3C14A 3F44A 2HAFA 5HVHA 1YJUA 2QX0A 4ECSA 3ENWA 1T94A 4CQ1A 4QU7A 2J7WA 5C25A 4M94A 3SSRA 2DNRA 3B4DA 3VAJA 1NH7A 2CPYA 2MKCA 3VVUA 4L3NA 3LGHA 2E1PA 3G2XA 3KHLA 2DVIA 1LWEB 2AJ1A 4LF9J 1SCJB 3D28A 3P6YC 4PUOB 1DLOB 1GMVA 4Q5VA 2ZJPQ 3WC0A 3G6ES 4WJBA 4JYAF 3BSCA 3JTPA 2M52A 1WKKA 1VLOA 5HQMA 1KTQA 1RTIB 4OHXA 2H48B 3GFZA 4RR5A 3OL6A 4EUVA 3OD2A 1KQKA 2V9KA 2DO8A 1QSYA 3ENVA 2F3JA 3VR1A 2HVDA 5CCMA 1XJWB 3OT9A 5LOQA 3O6QA 2W8KA 2B0GA 2QEXS 1FFWB 4UW2A 2WSCC 1Z1ZA 2JVOA 2XYGB 3DU5A 5IT0A 3JXOA 3B6BA 1WACA 1C0TB 4FPIA 3L7UA 3T5JA 1M5KC 4U67Q 3TAMA 4LSLA 1FT8A 2RHQB 5AXMA 1S5ZA 1UJ6A 4EYHB 2QMWA 2BVZA 3QRRA 5B0EA 4DF4A 5MAOA 3HVWA 1WHWA 2IHR1 4I4BA 3HPOA 3U1MA 2KZMA 4DR6F 1IQTA 4E0DA 4PKDB 5BJRA 5CCLA 2YNFA 1CG2A 1X5TA 3CJ4A 2AYMA 3SQGA 3DM2B 2KRRA 4KKOB 2MGZA 2B5JB 4PXEA 1N34J 4KFBB 1QM9A 2ZNZA 2OPSB 1PBAA 3JYTA 3DLGB 3DFEA 1H6KX 3M8RA 4IFVA 1RT6B 5KG3A 3VZHA 2DRAA 3HD2A 1R7IA 1FKOB 3IG1B 1RWWB 5BYQA 1FHTA 1MWQA 3SSQA 2JWNA 5DETA 4DL5A 1S7IA 3MCOA 2MEWA 4B3TJ 4IG3A 4ZK7M 2MTLA 2Q43A 4IDKB 2FDNA 1R31A 1U0HB 3FFIB 4LRCA 4F0MA 2KXNB 2NCKL 2XI2A 4USKA 1VBKA 4K0KJ 3LP1B 2F9JA 4UUXA 1XQIA 3GIIA 1XMOJ 2BQRA 2OJ3A 5HSPA 1HPZB 2CRLA 3BN7A 4TU8A 2ZUGA 1NO8A 1HD1A 1RCOB 2CJXB 1OWXA 4RNNA 3GP9A 4DV4J 4F4WA 1JLQB 2K3KA 1RT7B 4XDDA 4GC7A 4DV1J 3UNYA 1L3UA 1TK5A 2WTFA 3R2CJ 4HACA 5MLCV 1FXLA 1U1KA 3GFXA 2RB7A 4J9UE 2UXCJ 3NCQA 2EEYA 2CQ1A 2ZH9A 2GVZA 4NEZA 4ZPWR 1SJQA 3V6JA 2GAHC 4CP5A 2EG2A 4OYZA 5J1EA 1IBLF 3EDQB 2X7IA 1NDKA 2EFQA 4OX9F 2GCFA 4ZCMA 3NL0A 3AJDA 4N47A 2C3UA 3HZGA 1KD1T 5IOLA 4C8KA 3UCZP 2LLZA 5ETOA 3K89A 2XGPA 4ZCKA 2RRBA 1F60B 3NAIA 3VZIA 2JEJA 4DL2A 1WF0A 1I6JA 1Y9OA 1X4EA 5KFRA 1QE1A 4U96A 2ZKUA 4OX6A 2H1YA 3LQVA 4A8KA 3NOCA 2OPPB 3PDNA 2K1RB 1ZZFA 2HQCA 4K4SA 4J9VA 2D3UA 2FJVA 2PMWA 3KK3B 3BDPA 1NK8A 3OLBA 1AYEA 2LXUA 4FYYB 2V9WA 4YEAA 2GW8A 2GO9A 2WVBA 3OVSA 3TZXA 2HHVA 1NCLA 2ZZMA 4IRDA 2LDIA 4I1TA 1UVJA 3HT0A 4MTPA 2XGQA 2FB0A 4DPWA 3F56A 1U1OA 3DXBA 3O8WA 3TANA 3K58A 2QA4S 2W2PP 1NJZA 2QA1A 3SFUA 3OXLA 1BWVA 4I2PB 2OMLA 4U6PA 1RTZA 1U6ZA 1FX2A 4CWBA 5B7WA 2ZKTA 2KVIA 1FDBA 3OXGA 4NZ7A 2OSRA 4DDFA 2HEKA 1T9XA 1W26A 4NPOA 1UP1A 1TZ0A 3E2EA 5ETQA 4FNHA 3EVOA 2HHQA 2UXDF 4X4SA 5HMWA 1KQGB 1RTJA 2UU9J 4DX5A 3N6LA 5KFDA 2AF6A 4L6V3 2ATCB 3NAHA 3ETOA 2FJXA 3MOZA 4DR4J 3CJKA 2EFPA 3O5TB 2MKHA 1ZBTA 4TVAB 4LF7F 2LYVA 1FXRA 2FZGB 5JXSA 4HR2A 3JQMA 6FD1A 5L8RC 3BQ1A 4KPYA 5EX3A 3IGVA 1TELA 1U6BA 2KYZA 2BJ8A 2W2MP 4LMZA 2B4PA 5F9LA 1ZA2B 4CT9A 2CXEA 3IAS9 4A8MP 1RT3A 3SBMA 3JTNA 3PFOA 1PILA 2ZITA 1Y4ZB 4RNMA 2CVIA 4QR1A 2WCXA 1F5BA 5DDQC 5KFWA 3H5SA 2Q66A 2MZSA 1SH0A 3FDSA 4USJC 1IXKA 4A8FA 1SV5B 3E8OA 2AD9A 2QLJB 3J7A1 3IWLA 2VFUA 1UZHA 2DD8S 4A48A 3MAAA 1YGYA 1LWCB 2IA0A 1U47A 1UEVA 2Y1LB 1RWVB 4ILRA 1S9EA 2OFGX 3C66A 1EHWA 5D4PA 1RKJA 4NA2A 5IWAF 1VQPS 3OFEA 2DH7A 4USVA 4U7CA 3VAGA 4DX6A 1H74A 1E6YB 1J5OB 1SC1B 2OUGA 5LJ3Y 1W2IA 1D3WA 1UEUA 4DUZF 4NLOA 3VGUA 2HGMA 2DH8A 2V2VA 1D09B 4LBHA 4ENOA 2WW4A 3QZ8A 1MN9A 1TU0B 2E7XA 2X1BA 2I8EA 1X4DA 4K8RA 3RB4A 1GTHA 1HWJA 4GRSA 2A10A 4O4RA 3R6LB 2GHVC 2YXLA 4GKJF 1H7WA 4JI5F 2JOQA 4AL5A 4OHVA 3K5NA 2B51A 3CJRA 1ZETA 4PYAA 3RW6A 1QLNA 1LWEA 1MMLA 2HIYA 5HL7Q 1IBKJ 4PUOA 1DLOA 2ZC3A 4ZS6A 2IRUA 2H5JB 4WYWA 1RBOB 4C8OA 4WXOA 3CO0P 4B08A 3EDRB 3NGDA 3D1HA 4IYQA 4DG1B 1WEZA 4LVOP 1RTIA 4DPOA 4PCQA 1QSSA 1H72C 2AKWB 4IO1A 2HPUA 2KRBA 2L48A 3ZZUA 3CEDA 2NS1B 3AD9C 3D0IE 3NY0A 4WU2A 3DLLQ 3TAPA 3ZXWA 2ZUAA 2LXFA 4PG5A 4QCLA 2BYCA 3MTKA 4BHQA 3EE3A 4ED0A 3PY8A 1G2EA 4C6AA 2EKYA 4HTJA 2V8DA 1PAEX 3KK2B 2JLEA 2C2OB 2FJBB 3T41A 2Y0SD 3TQEA 2W2NP 4UY8T 5J1NA 2QIFA 2G1DA 2QE5A 4B9LA 1H38A 1CBKA 4C3LA 3HFZB 4M5HA 4USUA 5HMXA 5KFAA 4RW4B 1YRUA 2O67A 3A4TA 1RU2A 5AE1A 1RJJA 2DR6A 4WF9Q 2PT0A 3LPYA 3RRKA 4FBUA 3PR5B 3DM2A 4NYOA 4KKOA 4IQXA 1S1UB 1RYRA 2XO7A 1S0NA 4KFBA 4JI3F 2W4PA 1KVIA 4PQUB 2OPSA 1XNQJ 1GNKA 2DNGA 1F2HA 1HI1A 4ILLA 4CLUA 3H0PA 3DLGA 3M2RB 4Q2LA 3W5YA 2V8GA 4C8ZA 1RT6A 1YG0A 2NSCA 3Q86A 1FFGB 4DU7A 4JI0F 3NWGA 1SBRA 2GQ2A 1FKOA 3IG1A 5FDLB 5I3PA 2F7VA 1RHQB 3KUGA 3DC2A 1SIWB 4IDKA 2C42A 4WZMA 1U0HA 2Y3YA 3FFIA 5F8GA 2MHEA 4WZQA 1G7CB 3ET6B 4TQRA 4MKVA 1YJ7A 5K20B 4X62F 4DPXA 1JJ2R 3LP1A 2OEKA 4K59A 4C7QA 1DJ0A 1DTQA 4UQTA 4NLDA 4P2SA 2YKOA 3MD1A 3IC1A 3M05A 4YN3B 3T3FA 1DARA 2YKMB 1EP4B 2NXEA 4ZPAA 2E5LJ 3HFKA 2XLIA 4FF4A 3H4BA 4ECWA 2KI2A 3MURP 2DCUB 2IAJB 1JLEA 4X64J 4F2SA 1XR7A 3GIRA 2Q6BA 2HHSA 3V6KA 3RBXA 1JLQA 2APOA 3MD3A 4JV5J 1N32F 1RT7A 2KYXA 1NZAA 1FJGF 5DLFA 2XB2D 5DQGA 4QYZJ 2QN6B 4QWEA 2F4VF 1RI7A 2HGLA 2HK3A 4WCEQ 3WDOA 5DO2A 5B0AA 4DR3F 1R8AA 2HBQB 1HNWF 3AQPA 4IR1A 2BQUA 3CCTA 1RA7A 2BM1A 1MN7A 3G4SS 1M5OC 1A6LA 5L46A 3G6YA 2HS4A 2CVEA 2AYBA 3VGVA 2D3ZA 2GC8A 3W8GA 3AHPA 1FTCA 3PG9A 4CO4A 1H73A 2FC8A 2W9BB 1BC6A 3MUVP 4X4TA 3OSPA 2ZBRA 4OZLA 1N33F 1ZM9A 3WIUA 1K1SA 4CLPA 1QTMA 3H2VE 2WW8A 1ZH5A 1YJVA 4HEA9 3QATA 4G3IA 4FPRA 2OPPA 3EPGA 2K1RA 3M6WA 1RAHB 1AZSB 4DS4A 2DRDA 3BREA 2RILA 3UFCX 4ETXA 4J9QA 3DDKA 4GKKF 4N5SA 1K73T 4RU9A 1ZAVA 1T05B 2PEHA 3MPDA 1OQ3A 3UCUP 2DKOB 2HHPA 3W62A 3W60A 2LU2A 5F8IA 4WFBQ 4H4OB 2R2SA 3IR5B 1UAWA 1P1TA 1RWMB 4DX8H 2WRMA 4WKYA 3N0VA 2YWWA 3PYEA 4I2PA 1RWXB 2NXJA 3IAM9 1PG5B 3G8TA 3J7AN 4LFCJ 2NXNA 4M5MA 4M5GA 1SQFA 3G6VA 1FDDA 4C4WA 1HNXJ 2Y1JA 3CJTA 1Q5VA 3VAMA 3PW7A 1M1GA 5DM7Q 4LFBJ 3DRRB 1IKWB 5CD4H 2UVVA 4URQU 4DN9A 4EZ9A 3GTYX 4EMDA 3R1LA 2KHCA 2JDJA 3CB4A 1U6FA 1HQUB 4DV6F 3AFGA 2XMTA 1KNZA 4GO7X 4M95A 1FJEB 1C0UB 3NS7B 3OHBA 1U02A 5F0WA 2EW0A 3DLJA 2MXYA 2D41A 5KT7A 2XNQA 2Z4PA 3M8SA 3VAHA 3TZYA 2ASJA 3PJXA 1IWGA 3QT5A 1NBEB 1S7HA 1XR5A 5C24B 3T6JA 5LSOA 2BJEA 2IMOA 3HI9A 2M0GB 2DNOA 4O4GB 2RU9A 5J2QB 3H2UB 4CLZA 4QU6A 3Q8YA 4Y28C 4HI2A 1T9TA 5DS7A 1EB0A 4MT1A 1WF2A 1SJ4P 2MQQA 1SV5A 2VBWA 1D0EA 2AEJA 4L74A 4DI6A 1RYSA 4LSNB 1SI9A 5F8MA 2VG6B 2KM8C 4AL6A 4X65F 1RWOB 3W5XA 1LWCA 2CYYA 3RJMB 2WSEC 3UR0A 4J9NA 2K7JA 3CCLS 1HW9A 3BSNA 4LQ3A 3VQSA 4TY8B 2XLJA 2C2NA 1Q7YT 1CJUB 4HYKA 4HH1A 3R7SB 2HNYB 4WYLA 3P5BP 3TJ8A 1RT2B 1E6YA 1J5OA 1U1NA 1VHFA 3H5XA 4DL4A 3PEHA 3S8SA 2PGCA 1HWKA 4LFAF 4NLTA 3T9ZA 2ZC4A 1RCXB 4TN2A 4IRCA 3ISND 2ZH6A 4MIWA 1F9EB 4FXDA 2IVYA 2OTLS 1LWXA 1FNOA 1SKSA 5I3UB 3D4JA 3K5PA 4QR0A 3MZIA 4TKTA 3FVYA 1RAFB 1E6VB 1UVIA 2KT5A 4DFJA 3I87A 1B7YB 4NLVA 4OI0A 3C46A 2CJYB 2EFVA 2PSZA 2YWHA 1GX6A 3DGPB 1QUVA 2Z30B 4ZPDA 4ZOSA 4DG1A 2CA9A 4ECZA 2DHXA 5HI7A 1FD2A 3ZZZA 1SL1A 1OY6A 2RNEA 4DV2J 4NLQA 2HWTA 2UZAA 5KT5A 2Y9HA 4DZDA 4Q2MA 5KFLA 4TU7A 2GJFA 2RDJA 1WC4A 2ZBIA 4OQJA 3BZQA 1Y11A 4AYBD 2K8GA 2FHJA 1MWYA 4OV1A 1XR6A 1NU4A 3J80Y 2RUGA 5CABA 3KK2A 1KOOA 5IC4B 5E7OB 2AGQA 1H3DA 1WDTA 3Q23A 1CJTB 1NHUA 1NUEA 3MR5A 4G1QB 1N52B 3TWZA 4WP8A 2I1RA 5LJ5Y 4RW4A 5EGYA 3ENQA 2LDYA 5KFIA 5ADZA 2QSWA 1KR4A 4KIAA 2BANB 2BUNA 2C22A 5KAKA 4DF8A 1HI8A 3VHQA 4FXVA 1XN9A 5KOXA 1RWUA 2EFGA 5IV4A 2FY1A 1S1UA 4DV7J 1RAAB 4MIAA 3SZ2A 5KFOA 1WD6A 2BBEA 1K44A 4PQUA 2XC9A 3VVTA 3M2RA 5F0UA 3DDNA 2FGOA 2VBZA 4YMEA 2AQ4A 1VISA 3M1VB 3CCZA 4LF1A 2IYIA 3B8HA 2V94A 5FDLA 2POKA 5D6GA 4Q8FA 3NMRA 5KFHA 3D6MB 5DRKA 4CLWA 2ASDA 3JQJA 4PG6A 2MQMA 3M9NB 2ZE2B 1VQ7S 5HMZA 3MMJA 4ZPCA 3MM9B 3ET6A 1QAIA 3MM5B 3FZ2A 1AW0A 3SIPB 1VBXA 4ECVA 3EGWB 4DMZA 2DR5A 4B9MA 3KJNB 3KDOA 1FX4A 1XERA 4LF5F 4Y2MA 4PG4A 2YKMA 1EP4A 4XO0A 1VJQA 3BN4A 4DV5J 4IQMA 4MK9A 2FJAB 2OH2A 3BKFA 4CLFA 4FXWA 1DQ9A 4DL3A 3D7SB 3SEOA 4O3SA 3IA0A 2IAJA 4RX6A 2Z58B 3OFHA 2OI2A 3TQ1A 2XWYA 4WFAQ 1VRUA 5D4LA 5CYMB 2HVEA 4KY3A 1F6TA 4JI4J 1F2GA 1X0PA 1CSJA 3OVAA 4CO3A 5KFCA 4Y0FA 3MPYA 3CCQS 4QYRA 2EWHA 1SJ3P 4KGZB 4PG8A 1HHSA 4KC5A 1WDDA 3OBIA 5L9XA 3CMAS 3VF0B 2UVRA 1EQ0A 1BLUA 2OELA 2I9SA 3DHXA 5IQQA 3SV4A 2V8HA 4OX7A 4TLQA 1NDCA 1N54B 1KVKA 3CC2S 1MG7A 3MEGB 2IMWP 3RRGA 4PRFA 4MKAA 3WHIA 3I96A 3HSZA 3M32B 3BQ0A 4CT8A 1RTHB 1FNXH 2BZ2A 2E1RA 1SXLA 4IOBA 2W9BA 4ZHRB 2BRLA 2C2ZB 3BSOA 3G8QA 3Q8UA 2EC2A 3T5LA 4R5PB 1IKYB 3EWGA 2DR7A 1U1LA 3EGZA 3HHKA 4J90A 4JYAJ 1AFIA 1NXIA 1TFYA 3CCJS 1P8GA 2NUUG 4ZVOB 4B3MF 2N4CA 5KT6A 1VIXA 4YY3F 4U8VA 3ILIA 1SKRA 1TTHB 3RG6A 1AZSA 2RQKA 3NEKA 3VTIA 3M30B 3PRBA 3CJ0A 5IFMA 3DLEB 3N28A 3N01A 2XLKA 1FWPA 2B8PA 3UD4P 1JLGB 5H9EJ 2JFKA 5FD1A 5FLXY 2ZH5A 1T05A 5K8PA 2R3VA 2EW9A 2MZ1A 3QZ7A 3NLCA 3DRYA 1O8BA 3CCUS 3P3DA 1R8PA 3BQ2A 3CXCR 4H4OA 3JAMY 3K59A 4LT6A 3FMBA 2W9CB 4ETZA 1WKJA 3K5MA 4QIGA 1LWFB 3LH2S 2OEMA 2E1MC 2J5AA 1X9SA 3DCAA 1MMDA 1RA6A 3PW0A 3AJ1A 1C4CA 4DR6J 2XZDB 2YPZA 4N56A 1S48A 5AJ3F 2OGUA 4F4XA 4N8NA 3B54A 2DO4A 3MUTP 2F5GA 2ZH7A 4KGMA 4NZ6A 3DRRA 2Q3PA 1IKWA 3TVZA 3VWSA 3ZC4A 1NDPA 2XS2A 2E66A 2QGFB 3QJPA 2L3MA 3AJ2A 2BKPA 3M6XA 3GCXP 3B82A 2ILYA 2KG1A 2BQ3A 1HQUA 4Q0BB 5KFQA 4OHYA 2XMVA 3PZPA 1JB0C 1S12A 4J9MA 4DWIA 4KQZA 4ECRA 1C0UA 2B3TB 4PXCA 3VCDA 5EDWA 4IG0B 4EEYA 1UW4A 1KTVA 4DCOB 4IUFA 2AJ0A 5C24A 2AU0A 1I94F 3GV8B 3LA0A 2AGPA 2VG5B 5KFEA 1ZTWA 1R8HA 4LIWA 1PYSB 1WOSA 1WI6A 4EK2A 3RB6A 4BS2A 3D3BJ 4O4GA 2AV5A 4F36A 5J2QA 1R3NA 3CULA 2VDHA 4DR2F 2Q6CA 2J7KA 1DRZA 2XMKA 3K0JA 3TRGA 4P2FA 4NASA 2BJ9A 1O6XA 2VU5A 2HFNA 3DI6B 2UV8G 1FO1A 2J7UA 1MROB 4LSNA 3RBDA 2VG6A 3MR2A 1X60A 2VHGA 3PEJA 5IS2A 2OHDA 3F41A 1WC3A 3IR7B 4NLPA 3POTB 2VQEF 3AXKA 4TY8A 3L09A 4KBIA 2HWIA 1WJ9A 4PXBA 1SC6A 1CJUA 3ETMA 2HNYA 1HWUA 2KJVA 3QGIA 1RT2A 2OIHA 4DV3F 3ENAA 1IBLJ 3T5HA 1Y7PA 4ELVA 2BMBA 2EFOA 4OX9J 4JI7F 4P7VA 3DRSB 2R42A 3FCVA 4CLSA 2VC1A 5RUBA 1PIEA 2HQIA 3HHLB 2MKKA 1REVB 4FNIA 4S0MA 2CDRB 1VQ5S 1XMBA 2ROEA 2RD5C 2MQLA 2KT3A 3T5KA 2CADA 4RKUC 5I3UA 2XCAA 3W7BA 4LIRA 1E6VA 1FRKA 1EKRA 2RH3A 2E5IA 4RWWA 4PG7A 3EVWA 1MW7A 2XBPA 2FLNA 3KG0A 3V6DB 3A8IA 3DGPA 1VK3A 3QGPA 1NPRA 5GMEA 3PO5A 4GVLA 4B9SA 2B56A 1HMVB 5ETPA 2BE2B 1GMWD 4MK7A 3SMZA 2F8EX 3J80U 2HHHJ 3W66A 4ZLLA 4DQPA 3DN9A 1ZA1B 1L3SA 3G82B 1VOMA 1VHIA 1YVFA 1PJ7A 2GVDB 1PC5A 4P72A 2UUBF 2DJWA 2DNMA 2FJEB 3OFGA 3CCES 3AD8C 3TP2A 3AODA 4QW8A 3GFYA 2FUG9 4LR7A 3QFWA 4MK8A 5L1LA 1NJIT 3R8YA 4YP3A 5CAAA 2GNKA 2G1HA 2NYHA 2W8LA 1S9GB 1CJTA 3K17A 4G1QA 4ID8A 4O3NA 2B4UA 3LUYA 2XO6A 4YQWA 3EYZA 3RR8A 5LSRA 3TYTA 2DHSA 4RUAA 1S59A 5GAGU 2PIIA 2WB1D 3MM8B 3A8EA 2RJZA 1TKDA 2BANA 2UXDJ 1BMQB 1WKLA 3N6MA 2R9LA 3K7RA 4C0BA 2ZZTA 3UW1A 4KHPF 2Y1IA 4DHVA 3FEZA 3JS9A 1DY3A 2VV5A 3GE9A 3O2IA 3V5RA 3G8SA 1HLWA 1FWKA 3CO9A 4K2JA 4NXNF 2JEIA 2EK6A 1UVLA 4LF7J 4RW6B 3KHGA 5E3PA 3M1VA 3CJ3A 1MSWD 3GR1A 4FKYA 3CE8A 4KV8B 1S6OA 2MQPA 2R7RA 3PX4A 2B6AB 4AFFA 1CC7A 4RJVA 3TVKA 2BABA 4DV0F 5A8RB 1WNEA 4BCAA 1Y5LB 2X51A 3UDEA 2ERRA 4OJ1A 2RIJA 3OHAA 3UDLA 2MGZB 3BDEA 2ZHOA 3J81U 1RISA 3ZTSA 1IBCB 3MR6A 2UV8A 4HT5A 2ZE2A 4GVBB 1XBWA 3ZTRA 1QY7A 3MM9A 3CPWR 3MM5A 5E3QA 1NMEB 1PAUB 4GC6A 1N48A 4U95A 3RTVA 1GQEA 2R8JA 2V2QA 3KMQA 4OHZA 3EGVA 3W8PA 2DITA 4K4UA 1RP5A 2ZH2A 3NGSA 3KJQB 4TNOA 3V4IB 3KJVB 1LKZA 3M9MB 2KB2A 4H4KC 4YFUA 2GV1A 2NR0A 1KKHA 2CJ9A 3RAQA 3CJSA 1UA0A 2WK4A 1UETA 2PDAA 5IWAJ 1A9NB 1KN6A 2LVWA 2I0XA 4HHHA 2W2QP 1DFDA 2D1CA 1TMMA 2MKSA 3A12A 2F40A 4PYDA 4DUZJ 2QA4G 3I32A 2ZBCA 1HNVA 3Q22A 1X5SA 4K2XA 2FZCB 1H7XA 1OS5A 1NPPA 2YPYA 4KGVB 2J0XA 2I2YA 4GKJJ 3MEGA 2M5YA 4JI5J 3AA8A 3H98A 2FLLA 2VICA 3OLAA 3ZZOA 2PO4A 3M32A 1ELOA 2VFSA 5E3RA 1RTHA 3KG4A 2HK2A 3HFVA 4C0HA 2BV3A 4Q7AA 3BPDA 4ZHRA 2DNZA 3W63A 1F9HA 3IN5A 2CPFA 4R5PA 1IKYA 3LOUA 2XYHB 2Y1RI 2C2EA 5KFVA 4ZP9A 3TA0A 3FEYB 5FLXU 4HLBA 2W1BA 3CDAA 4C97A 5HATA 3GPAA 3M30A 2L08A 1WG4A 2U1AA 4WP9A 3DLEA 1ZPVA 3RZAA 3RB3A 1JLGA 1T11A 2XQCA 2HIQA 2WSFC 5J2MB 2QL9B 4QIEA 4UOHA 1KDNA 3ILOA 4JI6F 1U1MA 3HKZD 1MNEA 1TL5A 2DNPA 1S6QB 1F3VA 4OLPA 1C2PA 2GO8A 2XULA 4AD6A 4FS1A 2W9CA 1LWFA 1TVRA 3HHLC 4WK1A 5A76A 3B4MA 4EZ6A 1HBUB 3FUYA 4CZCA 4MYUA 2JRSA 4OYWA 2YTCA 1WHVA 2W4DA 2F1FA 4N8OA 3IO1A 4J9LA 2YY3A 2MPUA 1BQMB 2DIUA 3D2WA 4U8YA 4JI3J 1BUXA 3GONA 3OR2B 3BV8A 4FN5A 4RUCA 1H2TZ 2QYGA 3M2VB 2LA4A 4R8UB 1UJ4A 1G3OA 4PABA 1OYEA 3PHTA 3CCRS 4RBTA 4Q0BA 1YBTA 5DM6Q 1JJCB 4JI0J 4J9OA 1HNIB 3HO1A 4QBUA 1U7LA 2CPIA 2R2RA 1G6BA 3LP0B 4IG0A 3EM1A 3GYXB 1R43A 5G0RB 2QLBB 2X3GA 3HK2A 2HFSA 4ED3A 1Q78A 4P75A 1RTJB 5D3GB 4D3HA 1YJTA 2NZCA 1UFKA 2VG5A 2IVMA 4X62J 2ROPA 2J9DE 2RT3A 1IN0A 3CJKB 1NJXA 1DTTB 4FP9A 4QWDA 4YB1P 5DZ7A 3UE2A 2I5JB 3LPEA 3EXCX 2Q79A 1U25A 1V3RA 5ETNA 1D9FA 1N8RT 2N4DA 2PA3A 3DI6A 1I5OB 4L73A 3H7HB 4OZJA 3W2VB 2GX8A 2BX6A 1YZ7A 2B8QA 4WIQA 1YLXA 1W2BR 2HMIB 1Q95G 2B9EA 2Y8WA 1N32J 3POTA 4KB7A 3TJ9A 4TY9A 2H5IB 1FJGJ 2CWKA 1PC4A 4K5SA 4DCPB 1XNRF 2GIQA 3D67A 1AT1B 3MMBA 2F4VJ 1FKPB 1X9WA 2VD3A 2O3DA 4PZVA 1QAXA 2ILZA 3I55S 4C9DA 4DR3J 1YRXA 4ED2A 4CLKA 2N3LA 1Q16B 3DMJB 1HNWJ 5H9FJ 3N4WA 3I4HX 3DRSA 5E33A 2HYIB 2FIUA 5LL6d 3Q83A 3ULHA 4LSZB 5KT4A 2V2ZA 3HHLA 2QA2A 1REVA 4V19X 5L9NA 3QWUA 3UDVA 1K8AT 3M8PB 3ZNJ1 2QV6A 4WFZA 2G4BA 2BE9B 2VOPA 2R8KA 1S76D 1N33J 3TEGA 2PI4A 3KLGA 1U4BA 3CC7S 3LP2B 2NYIA 5GMKa 1ZAWA 1J5EF 5E41A 1N5YB 1FFSB 3V6DA 3W65A 4C98A 4JB8B 4KHRA 4X84A 4OV6A 5KFZA 1WELA 4QR2A 2QRRA 3THPA 4NCGB 4GKKJ 1HMVA 3KLVA 2BE2A 5IM0B 1GMUA 3QMQA 3C2PA 2YX4A 1AROP 2HFZA 3OL7A 4QPXA 2Z2LA 1WOOA 1Q8KA 3NGTA 5CHCB 3G82A 3PFEA 2RF2A 3I0RB 2GVDA 3PACA 2FJDB 1N0VC 4YHHF 1ZPWX 5IV3A 1MLAA 4BC7A 3JQKA 3D68A 2XHWA 5CYQB 4ZP6A 2EI5A 2JC0A 1S9GA 2XCPA 4B9UA 3J7YI 2IM2A 7FD1A 2JSXA 3RW7A 2IA6A 4DFKA 3ZZTA 1N56A 4FBTA 2R7OA 2XTJP 2RKIB 3MM8A 4M5IA 4C0OC 3TUZC 3HMJG 2MLZA 4NOHA 1S6PB 2CDQA 4LF8F 5J1PA 4QIFA 3MEKA 3BGUA 2IBOA 4CH7A 2VQFF 4DV6J 4OFZA 4OZ3A 1K0VA 3DOKB 5HANA 2ALYB 1NDLA 3LANA 1KVJA 4RW6A 4P71A 4OYMA 4KV8A 1OQ6A 1HD0A 2B6AA 1S49A 5A8RA 1EARA 1M5PC 3D6TB 5IQ6A 3N5FA 4KO0B 3LW5C 2ZH3A 5F8LA 2YNIB 1NHVA 2J0SD 1PYOB 2VIHA 4AE5A 1RAOA 3NBPB 4GVBA 4RL1A 1QTNB 2J6TA 3AB2B 4YDXA 3EGNA 2Y8YA 1FTRA 4DLGA 1VQSA 2ZWOA 2HBRB 3CC4S 4LRBA 4CCHA 1TL1B 1Q82T 2E9TA 2VOOA 4ZP7A 2ZBQA 2YQ3A 2W24A 3V4IA 3KJVA 4OI6A 1UVNA 1RHUB 2GMLA 4CM2A 1S99A 1U8SA 1U2FA 5CYJA 4ED7A 4HI1A 4X65J 1KP6A 2K06A 1Q5YA 1WC5A 3CIZA 3DLHA 1SUQB 3LF0A 1DTQB 3SXLA 2F9DA 5CZVA 4AQYF 3D5MA 4U9RA 2NQPA 1AB8A 4CLLA 4DU8A 1Q8BA 5CH7B 3LWMA 3H4DA 4LFAJ 2HZCA 5IXUA 3CDWA 5SZTA 1TQLA 4NZ0A 4UUWA 1N5TA 1JLBA 4ECYA 1S72S 1JLAB 4OYPA 1MU2B 1JLEB 2G0CA 5KFJA 4I2QB 4F25A 1BY9A 1KQFB 3I5CA 4UTGA 1QAYA 2NUHA 1KQSR 2AEMA 2EG1A 2B9WA 2MJNA 3BF4A 2AIRB 5JJBA 4OI3A 3MI7X 3Q8QB 1IWAA 2MKIA 3HCXA 3IBWA 4KGKA 2RE1A 2EVZA 1JXEA 4Y3CA 3MUMP 1I1GA 5JVHQ 3PXGa 1WWHA 1VYAA 4IR9A 2IRYA 2ZD1B 1RACB 2HHWA 1FKAF 4X4VA 3W9JA 4UY85 4XAKA 3FSIA 3QAUA 2C3PA 2MZRA 1Q8IA 3RGIA 3BO2A 2A6OA 4I0WA 3QSIA 5GADU 3CW2C 2UUCF 1VRQC 2E5GA 3HVRA 3OL8A 5E0OA 4ZP8A 2IFXA 1FXDA 2DNLA 2K7KA 2XG8A 3KHHA 2LCWA 3IMQJ 4Z2XA 2CPJA 5J2MA 1B99A 3SSSA 5DJBA 4WWSA 4ZN3A 1R8CA 3EZ5A 2VUGA 5AE2A 3OUYB 4EBCA 2CNOB 3FKBA 1S6QA 4IH5A 1GMWA 3WBZA 4F3QA 3M4XA 3H8YA 5C5JA 1U49A 4F2RA 4DQRA 2EC0A 4UOFA 2YX7A 3H40A 1VQ6S 1TK8A 2YWEA 1HBUA 2P6SA 2DGWA 4ZVEA 1K9MT 5GMDA 1WI8A 2WB4A 5D0EA 1BD6A 2E44A 2AWZA 3UI3A 1HR0F 4M63A 5KFXA 3B78A 4ANCA 2HWHA 4OIXA 2P9EA 3ZZYA 4DJBA 2QZ8A 2VODA 2G13A 1GAOA 4TU9A 3SV3A 1JLFB 2LU1A 5C42B 2YH0A 1FDAA 3LAMA 1BQMA 3OR1B 3NGRA 2VA2A 3OR2A 4U7UD 2PE8A 3MFHA 3U02A 2OPRB 3A13A 3TUPA 3M2VA 4ZCIA 4R8UA 4J5OA 2H5EA 2ZFHA 2CQIA 3I82A 3NXZA 1NKEA 5F8NA 3IFEA 1NPKA 5DDOC 2FVPA 3BJYA 5KT2A 1HNIA 3TEHB 4ATNA 3R2DJ 3LP0A 1RBLA 2ZDPA 2ZBPA 4DEZA 3CT9A 5L39A 1BXNA 5G0RA 3V81B 3MM7B 1UTAA 4K4YA 4KAIA 4WFNQ 1Q1KA 1R0BG 2D9OA 5D3GA 2ZEJA 2WOMB 3FGVA 2IVFB 3LGMA 3THTA 4WBFA 3EXYA 1L5UA 2FLPA 2QO3A 2MUIA 2DO0A 3Q8VA 4K5RA 1DTTA 2XWXA 5C2GA 3K8WA 1YITS 3A1YG 1NK4A 3FBEA 2CQDA 2ADCA 2I5JA 1CQMA 3NNAA 2IPOB 4LF5J 1NM2A 1IM6A 1NAQA 4FYVB 2HS0A 5KFUA 1JIHA 2CQ2A 1B0TA 1Q7LB 4LBPA 3D3CJ 3GJSB 3CSKA 3D1OA 3ADAC 3CD0A 3QIDA 3W2VA 3FCHA 1Q81T 3SYZA 1WOPA 3IWNC 3DLKA 1P6TA 1Y5NB 4RBUA 2LEBA 2HMIA 2YNHA 1AUSL 4UOCA 1OSCA 4ED5A 2VG7B 5KG6A 1T9WA 4NCAA 2CFXA 3PYFA 5BYRA 3I31A 2COLA 2LMIA 1U45A 1TKTB 2F8MA 1FKPA 1PYTA 3IR6B 1Z2ZA 2XM3A 4MH8A 5HROB 5L1KA 5KFFA 1R6VA 2ZM6J 2BOPA 4OZ5A 3DMJA 1AXQA 3T6BA 3ZNUA 3MPVA 3DYAB 2F65A 2I38A 3TOQA 1XIQA 1YBUA 2MJUA 1U24A 1XK8A 2ACMA 3M8PA 3GIKA 2H9ZA 1NJYA 5HP1B 1KHWA 3QQCD 4LR8A 2RU3A 3BB5A 1NK7A 2J8AA 3Q2TC 5ETSA 2R7UA 1ZTTA 3AY0A 4WE1B 4ILMA 8RUCA 1FK9B 4KR0B 3T1AA 2FHOB 3M7VA 3KNGA 2VJVA 1V3SA 3THVA 2VZ9A 3NG8A 4ZLNA 3LP2A 4B3MJ 1RLDA 2E1AA 1N5YA 2MZTA 4N41A 1RGVA 5IT9Y 1FRIA 3I6PA 1F5CA 1RBAA 4DPUA 2R7XA 2CAJA 2CZVC 4NCGA 5IM0A 4HHJA 1C1CA 4TLRA 1HNZF 2DGSA 3LGNA 4DLEA 4CIOA 4AXIA 2EBGA 1GEHA 4RNHA 5KFGA 1YHQS 3A3PB 3I0RA 3IM9A 2W4CA 1ZOTA 4M5JA 3BYPA 2R4FA 2MQ8A 2DB1A 2F8HA 1VC6A 1SQEA 2CKWA 1P9YA 2IJFA 1UPPA 2XNRA 5CYQA 1FDNA 3A8KA 2P2CB 4JV0A 3TR5A 2G0JA 3KMSA 3BO3A 4B3RF 2CQCA 4MAKA 5I4MA 2NPIA 1X0FA 1LW2B 2CNNB 1FRHA 5AJ3J 2A6MA 4WXWA 1UZDA 4P73A 4TQSA 3GV5B 2RKIA 2WVCA 2DXFA 1VQYA 2HRTA 1UEKA 3GU0A 4DBQA 4B17A 1S6PA 3I9ZA 3IRXB 3Q89A 1HHQA 1M90T 3W5ZA 1SC4B 4NWBA 3MAHA 2E7VA 3DOKA 5HBMB 1FA0A 2ZOGA 3MCNA 4WIIA 2CPHA 3BGRB 4KSEB 4L75A 1HWLA 4C48A 3SCIE 1N6QB 2FVQA 4R0JA 1TMJA 1ZZNA 1FRXA 1W25A 4DUYF 5C7PA 4JI1F 1AFJA 2J0WA 1I94J 2ZNYA 4KO0A 2V4JA 3ICLA 2YNIA 1KWMA 2LP4A 1U1RA 3O3LA 2FJWA 4ID5B 2VL1A 3NBPA 5HQLA 3OFFA 4DS5A 1GH8A 2YKPA 1BE4A 2ZVIA 5KFSA 3MAQA 2DHAA 4DR2J 1HBNB 3MXHP 4HDGA 1ZAXA 1TL1A 1YDLA 5HQ8A 4J9SA 1B7FA 2ZWPA 1WORA 3BPSP 1JXVA 4NE9C 3KLIB 3PJWA 5LSLA 3DU6A 2WVDA 3HSGA 4DOZA 4RNOA 1SL0A 2BEFA 2VFRA 1O5JA 3TX8A 4FYDA 3FBCA 3DRPB 3KOAA 3OTCA 5LMNF 4I68A 2VQEJ 3HT3A 4RBVA 2MKJA 1SUQA 1KONA 4L72B 1D9DA 4NLWA 3AA9A 4GO5X 3BM7A 3PNIA 3GWCA 1KRPA 2DHGA 2KN4A 4PPDA 5BR8F 1EKSA 4DV3J 2R8GA 1U1QA 1YIJS 4LF6J 1CS4B 1FJCA 4JI7J 3QLHB 4MFBB 2D74B 1VFJA 2HQFA 4P2MA 3UD5A 1WF1A 3N9UC 1JXLA 1JLAA 2XEXA 2AX0A 1MU2A 2ZDOA 2A2CA 1UPMB 2RUSA 4BWJA 4B3OB 4I2QA 3JSRA 3HULA 1VRUB 1B3TA 5KFYA 2CPDA 1CVJA 1OY8A 2YWGA 9ATCB 2GS5A 3PW5A 3T19A 4LF4F 1TP7A 2BW7A 2ZHBA 1OMSA 3QO9A 1UWBB 3PJ9A 3EZOA 3Q2SC 2ZD1A 4QPTA 3OW2R 4A47A 2GZOA 1NSAA 2B4OA 2OPQB 1DAXA 3OL9A 4RUHA 2BE7D 4YB7A 1IQZA 1T8EA 1YKWA 2IIHA 3GQCA 4K4XA 2RAQA 3TUIC 5LXRA 1KC8T 3H25A 4ED4A 5EUHA 2IDEA 3K5LA 2FPHX 2UUBJ 4QIVA 1LK5A 4EGLA 1NB7A 2X1GA 1PJ6A 1FD8A 1UA1A 4C8MA 2QMUB 3TX0A 1HWIA 1SKUB 3OUYA 5D4NA 4EYIB 2EFNA 1FE0A 5ETRA 2CG8A 2I6WA 4Y2IA 3RR7A 2KVQE 4WU3A 4TXSA 3PRDA 1Y0HA 2DGXA 4M1KA 2CPEA 2YKAA 2QFJA 4X66F 3HDSA 2XY6A 2H4YB 3M9OB 4NI2B 1O0PA 1SVDA 2D9PA 4KHPJ 4UQGA 5D78A 2Z2YB 1JLFA 1WHYA 5C42A 1WTBA 3WC2A 2HS3A 3MMCB 3OR1A 1XTZA 4MJKA 1RE1B 4ZVSB 2BKNA 1F0XA 4LQ9A 4NLGA 2OPRA 4EFAC 4NXNJ 3P96A 4OYIA 4E98A 4EBEA 5K8NA 1D8YA 3RBZA 3A3NB 3R5AA 5EWFA 5AXKA 2RRAA 2CNLB 1FVSA 4F3MA 4DV0J 2DY9A 5DG9A 3VV2B 3BYRA 1BHNA 1TKXB 2DY1A 2HHTA 4O0NA 2IJNA 3T1YF 3V81A 2HURA 3MM7A 2FHMA 3EZUA 2IY5B 2GMHA 1HHTP 2IYGA 2WOMA 3WZ0A 1B4SA 3P5TL 4C3MA 1NKCA 1TAUA 3PV8A 3HSJA 4A4JA 2EXUA 4ZPVR 1IR2A 2XMUA 1OIAA 2WONB 3M6VA 1NH8A 2GGPB 2VPXB 4R25A 3RRHA 4ZVPB 2XY7A 1TR0A 1WUUA 3J7ZT 3OTEA 3KXDA 4KYZA 1DQ8A 2XMWA 4MIBA 1VS3A 2A3JA 2XY5A 1UCNA 3R6GB 4RW7B 2C3YA 3KLHB 3R3TA 3CTRA 1NJWA 1NZ8A 3GG0A 3KLEB 4QYZK 2VG7A 2DNYA 3MDFA 1QVFR 2V6AA 2HNZB 1NLKL 1YJNS 3BSAA 5D4OA 2QMXA 1TKTA 4ZPTR 4ANDA 3RB0A 5ETLA 4F0HA 4YDDB 2JNJA 5HROA 3O1LA 2CQHA 1X31C 4ZJLA 5B08A 2RHSB 1L3VA 4OZ1A 1KBRA 5KG0A 1VQKS 2M88A 3KK1B 3DYAA 3TUJC 1RWPB 3OTBA 4CO0A 1BQXA 1VIOA 3MTJA 2BA9A 4JUZA 3SFGA 1J27A 4M5LA 2R7QA 1DQAA 5HP1A 3H90A 1X5OA 1FRMA 2A2DA 2E29A 1R0CB 3WX4A 1S10A 4WE1A 3F73A 4I7FB 3HLUA 1FK9A 5IT9U 3M6UA 1ZM3A 4M8LA 2K3IA 2JH3A 2YNGB 1ULRA 3OTOF 4DR1F 4H54A 3BGFA 2FHKA 4GMKA 3EVMA 1NRKA 1TL3B 4DL6A 2R2TA 1X4GA 3MWBA 4WP3A 1NSKL 1CJKA 4NEYA 3I5AA 2X1AA 3UDCA 1GFWB 2CQ4A 3BEGB 3L4BC 1P1LA 4LVNP 4O0IA 4A8QA 3TAQA 1TL7B 2UUWA 4P6QA 4J37A 1X8DA 4NL5A 2OEJA 2RQ4A 4JI6J 3U1LA 1T7PA 1KHVA 1M0SA 1EETB 2M4MA 4OZNA 2DIVA 2HNDB 8ATCB 3G9CA 4F0KA 2W25A 4CH1A 2LFVA 3HVTB 4ZVHA 4UOGA 3GB0A 2DRBA 3R1HA 4ED8A 2ALZA 1LW2A 1VC0A 3HJVA 3ZZRA 2GS8A 5EWGA 1JLCB 3UCGA 2AMCB 1LOUA 1K1QA 4JI8F 1RHRB 1UL3A 1PKUA 1VI7A 3W61A 6AT1B 1HBOA 5KG5A 4DCJB 4JI2F 3IBCB 5F3ZA 3IRXA 4YOEA 2QYCA 3HXMA 3W2WB 4G1PA 4CO5A 1U2RA 3EJMA 5T7LB 1W7WA 1P9QC 3U7JA 2EK1A 2MZJA 2CPXA 5HBMA 1JMTA 1SB6A 5HAOA 3TO8A 3BGRA 4AL7A 2FHJD 1N6QA 4F04B 3DLBA 2YX1A 1N36F 2GQCA 4M5DB 4ZIWA 3V2UC 5A2QY 2HHHF 4FDFA 2VPWB 4ES3A 1CPZA 4ID5A 4EBDA 4ALZA 3R5CA 3AB4B 2BACA 2WAQD 3C19A 3HHNB 4I69A 4J9RA 2FVRA 2BJ1A 1HBNA 3PYDA 5CZXA 5D8HB 1MWZA 3R5BA 4JBCA 1TV6B 2JFDA 4NCBA 2XMAA 1UMJA 2HSEB 2D7SA 4ZMMA 2QLFB 3CDEA 4B9VA 2ZH8A 3L9ZA 3KLIA 1YZ6A 5DGBA 3G96A 4DXLA 2KFNA 3PTWA 4DPYA 1WC1A 2OKQA 3CDUA 3DRPA 3M8WA 4Y2CA 2RQCA 3QBCA 2MQOA 4USTA 3OPKA 1T3OA 4IO9Q 1XNRJ 3H5YA 2BXJA 2JVRA 5A8KB 1IBMF 3IXQA 4O44B 3J81Y 4YR0A 4I6WA 5AE3A 3N6NA 4LUBA 5HLFB 3SI8A 2AT1B 2F63A 2DBBA 3W9IA 3PR4A 2BJDA 2H4WB 1CS4A 4YUDA 3ELHA 4NYZA 3QLHA 4MFBA 1PO6A 2HHXA 1FEHA 3TJAA 1G4CA 4QZVB 2DR9A 4Y6IA 1WHXA 3MHYA 4C11B 4OI2A 1RHJB 4B3OA 3WX8A 2AP6A 2XHCA 2UUAF 3CMQA 2JHEA 3ZTPA 2VC0A 4H4MB 1U48A 2HLTA 1HNVB 1T03B 4CTAB 1HYSB 1J5EJ 1S0OA 2G2ZA 1TKZB 2L9NA 3NS6A 3R27A 2VFTA 2KKHA 4RW8B 2HZVA 1UWBA 2PI5A 1B0VA 5KG7A 1UW9A 4OYOA 4PR6A 3MECA 1HQEB 2QLXA 4IKAA 2DNQA 4X4OA 2OPQA 5T14A 2MB0B 3NP5A 2QG9B 2ACYA 2V63A 4ZLJA 3AAWB 3FRZA 3ZTOA 2LXIA 3GSDA 1WC6A 3MPWA 1YK9A 4LJMA 1LEOA 1LNQA 3CMES 4URSA 4TYAA 1YJWS 3NCPA 4YHHJ 2QL5B 4RW9B 2XYPB 1VQMS 1UVKA 2ZVSA 1U2CA 2YBVA 2AJ2A 3HP6A 2WBMA 1OJ4A 4KGXB 3DDIA 2VBYA 2O01C 4DQQA 2BRKA 3HKWA 1KLMA 4ELTA 2PMHA 3H2LA 1NHKL 1H98A 1X4CA 4DSEA 4RPFA 3ZO7A 1K0TA 5CD4A 1NK9A 3NGKA 3GYNA 4E8UA 4OZ2A 5D15A 4CH0S 1RSCA 1URRA 5LXYA 3UD3P 4KHMA 4NI2A 4ECXA 2VBXA 4XPCA 3C6UB 3CCMS 4CLYA 3D1QA 4LF8J 3NNCA 4X4UA 4R0EA 4YS2A 2VQFJ 1RAIB 1P27B 5J2PB 3MMCA 2VA3A 3RAMA 4ZVFA 1TVRB 3C3LA 3GMGA 2J9EA 2LQBA 4NXMF 2G2YA 2N7CA 2RVJA 3F0NA 2XSJB 1HI0P 1TAQA 3CDBA 1FF2A 3M8QB 5DDRC 4USHA 3KUEA 4F4AA 1CQNA 3N79A 3HX9A 2IC3B 4CNZA 1TKXA 1N5QA 3EICA 1S77D 1FRJA 3GR0A 3T1HF 1SH3A 2J9DA 4IFYB 1RT4B 4Q45A 5A6WA 3BH7B 1ICEB 1WEXA 1RK8A 1EZZB 5JUMA 1PBUA 2IJRA 4CRJA 1GXLA 1S4EA 3MR7A 2E9RX 4DSIA 2EPIA 2RS8A 3LALA 4P2XA 2DEJA 1C0TA 4FVCA 1TFWA 4F8RA 2VKRA 1F3FA 3GJQB 2HVZA 2WONA 4E2FB 1S4FA 1UFLA 4M5NA 2GGPA 3BS9A 2R8IA 2ZJQQ 2C2KB 4ZKAA 2ASYA 2UP1A 4MKYA 4PXDA 1VMBA 3S7RA 2Z2ZA 5AT1B 2A0FB 4B3SF 4KT0C 3EX7B 1YQHA 3FSYA 4RW7A 2DYAA 3KLHA 3ISZA 1B0PA 2DNKA 2KM8B 4DR5F 2B4VA 4YB6A 3KLEA 2B5JA 2VB6A 5B0DA 5KT3A 3QT7A 2W9AA 3PCOB 3S01A 4N7TA 2ZOMA 1B70B 2HAIA 4AQYJ 4USMA 2QL7B 3GJTB 2HLUA 2R7SA 2HNZA 3U27A 5GAEI 4OZ0A 4W4MA 4A8OA 2N3OA 4UZBA 4MYTA 4J9KA 4DQSA 1V5IB 4DR7F 5A6PA 1M1KT 4WK3A 5KG1A 1LXNA 5D77A 2P9CA 1LK7A 3L7OA 1S1WB 1VR6A 2K2PA 3FMWA 2MLYA 3QRPA 4PWDB 2CG4A 2JJ4D 4OYAA 3P4UB 3GJRB 1CEZA 3KK1A 2AJFE 3MR3A 3BBCA 1YJ9S 1YI2S 2CQPA 3D66A 2VONA 1RWKB 4A46A 5K9FA 3PVXA 3RUBL 3P49B 2MZQA 4F67A 4BC9A 2BOAA 2HFOA 3BBFA 3MMBB 5L1JA 1UWAA 1NK0A 1QD1A 1S1TB 3FC9A 5EHHA 3N5BA 4F26A 3BO4A 4I7FA 1L3TA 2LQJA 4I6YA 4DSFA 1SL2A 2YNGA 2OD4A 2GA7A 4ITSA 2QFIA 1XMQF 2CQ3A 1HPZA 4NLYA 4XPEA 4C3KA 2PA8D 1TL3A 5E3AA 5H1SV 5H9EK 1VJWA 3GSIA 3QRQA 2UUCJ 4DSJA 1OYDA 4DUTA 2DPIA 4ANEA 2HW3A 5EX0A 3IM8A 5KFTA 3HJFA 4X4NA 3IGNA 1WG5A 3EUNA 1TL7A 1Y3JA 3CJ8A 3KLGB 2QC3A 4UT4A 3TI0A 2C28A 4DQIA 1EETA 4QOTA 5FJ4A 3DXSX 3FSXA 3TZWA 5F41A 4PWUA 3NS5A 1S1XB 2HNDA 4K4TA 2W7OA 3R97A 5LMUF 4RUBA 4ZVTB 3HVTA 1H0HB 1M5HA 2CIMA 3GG1A 1U8WA 4Z37A 2UXBF 1HR0J 2E5HA 1H2UX 4OYBA 3IP0A 1JLCA 2RF2B 3OSNA 1SJ1A 1UKUA 2MDAA 1H2VZ 2R7TA 4B9NA 2DHHA 1VQLS 3R5JB 2UVUA 1TUGB 5D0HA 4I67A 3IBFB 1I51B 3CD6S 3KUHA 1C1BB 3O44A 4DL0C 3S1TA 2KTQA 3W2WA 4CLTA 2AJQA 5T7LA 2O5DA 3LWLA 1U1PA 3UQSA 2BJ7A 3PX0A 5A2QU 2MSTA 1S79A 3PM9A 2CJAA 1D1UA 1T9VA 2ATLA 2KH9A 3RAXA 5F8JA 3KK3A 3PX6A 1FI4A 2A1BA 3TW0A 2PN6A 3D54A 3Q8PB 1JJHA 4ICLB 3ISNC 2FQQB 4IH7A 4M5DA 1M1HA 1N88A 2RSQA 3DHWC 1IJFB 4NA1A 4AUKA 2KG0A 3KJFB 4LF9F 1WTFA 2DNNA 1TUVA 1RT5B 3AQOA 3VAFA 7FDRA 1T3NA 4XTTA 1SKWA 1TV6A 2RRNA 4LBIA 1B64A 3FJ2A 2VPYB 4UZCA 4O3PA 1URNA 1FE4A 4FF3A 2MQNA 2KHDA 3OV7A 3M8ZA 4QWBA 2C1EB 2FVSA 1ZS6A 3PYGA 2Z56B 3JSBA 5KFMA 4DPTA 3BGLA 2DGUA 2LECA 9RUBA 4P7TA 3NGUA 5A8KA 2CJQA 3LAKA 4O44A 1KLNA 3NOGA 4WFYA 2J6SA 3E01B 5HLFA 3LTOA 1GK8A 1GXTA 4USIA 4OX8A 1RHKB 2GIFA 1GTEA 2H51B 3VALA 1I3OB 2IM1A 5DLGA 3UVJB 5KOWA 5DZ6A 4F7VA 5HVGA 4C11A 1RABB 5ETTA 4A8SA 2MSSA 2YKNB 3IS9B 3R5GA 1N34F 1A7GE 2M8HA 2KJWA 2PFFB 3SDEB 2V8VA 2FYXA 1M5SA 3QIPB 3WIVA 3ILLA 3AD7C 4O23A 1T9YA 2HQDA 4H4MA 3DGVA 1S9FA 1T03A 2CWXA 4CTAA 2OD6A 1WEYA 1HYSA 3M2UB 1TKZA 5HVFA
chains in the Genus database with same CATH topology
2DO8A 2GS5A 2GZOA 2MUIA 2HAFA 2AJ2A 2HRXA 2EW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DO8 A;  2GS5 A;  2GZO A;  2MUI A;  2HAF A;  2AJ2 A;  2HRX A;  2EW0 A; 
#chains in the Genus database with same CATH topology
 1JLB B;  4RW8 A;  2NXU A;  4WTO B;  2M2B A;  4ZCL A;  4N76 A;  1R0A B;  1HQE A;  1VQ8 S;  1VRT B;  1S1V B;  2AYG A;  4B3T F;  2RS2 A;  1S57 A;  1VQN S;  5C2C A;  1ZM4 A;  2MY8 A;  2HFU A;  1BWE A;  5T41 A;  1HNZ J;  2XZT B;  1Z4U A;  1S0V A;  4HT7 A;  3KG1 A;  2P6T A;  1VGY A;  2FLO A;  1WSV A;  1FES A;  2UVW A;  2DTJ A;  2F4F A;  4K0K F;  4CYU B;  4A8W A;  3I0S B;  5L1I A;  5FII A;  4RW9 A;  2V4R A;  3C15 B;  1LW0 B;  2GFF A;  2R8H A;  2V69 A;  2E1C A;  2DNH A;  3FQL A;  2RDI A;  1XMO F;  3DKD A;  4W98 A;  4B3R J;  4V1A k;  1JNZ B;  2L9D A;  3R7N B;  2GAG C;  3D0H E;  4K7Q A;  1HFE L;  4DSL A;  5HMY A;  5K14 B;  4ZA1 A;  3DOM B;  1SH2 A;  2CQ0 A;  2VFV A;  2MLX A;  4DV4 F;  1PSD A;  5EWE A;  1X4F A;  2OLW A;  1Q8L A;  2Z2M A;  5GAG I;  3C6U A;  3QAE A;  4LRE A;  4Y2A A;  4DV1 F;  1FJ7 A;  3W9H A;  5J2P A;  2J0Q D;  2UXC F;  4HVZ A;  5A0Y B;  3C6T B;  3OQ2 A;  3FCW A;  4LRA A;  5SUH A;  1WG1 A;  3UO0 A;  4ED6 A;  4G1I A;  4RO0 A;  1RTD B;  2XSJ A;  3TA2 A;  1HA1 A;  4P74 A;  1X4B A;  2BJ3 A;  3M8Q A;  1YSJ A;  3PKM A;  2FGC A;  1VBZ A;  3X3U A;  4DUY J;  2IC3 A;  4JI1 J;  3DOL B;  1LXJ A;  1AA1 B;  4IFY A;  1WSR A;  1RT4 A;  3E3X A;  2MYF A;  2N82 B;  3I5B A;  3L95 X;  5A8W B;  5KFB A;  1N5V A;  4ZJO A;  2OTJ S;  5HO4 A;  2JL9 A;  2FD2 A;  1Y3K A;  1IKV B;  5EN1 A;  2YWF A;  3NNH A;  4CO2 A;  2P5V A;  4XDC A;  1RT1 B;  4ZIV A;  1IKX B;  4CO1 A;  1EAY C;  4ZJQ A;  5DG7 A;  3LO3 A;  4F3O A;  2IM3 A;  1Z2L A;  3TZZ A;  5F8H A;  4NYP A;  3GZ7 A;  5LMN J;  1FCA A;  2W7P A;  2VAS A;  5KFN A;  2XMM A;  4J7C A;  4K4W A;  1T02 A;  1IVZ A;  3Q24 A;  3OJS A;  3JB9 k;  4JOU A;  1X7V A;  5BR8 J;  4OL8 A;  3CCW A;  2CZ4 A;  5GAH I;  3GFH A;  2L9W A;  3MEE B;  3IWX A;  3BBB A;  2CQG A;  3H20 A;  1S1W A;  3CVK A;  4L3K A;  2X3D A;  5HK4 A;  4PWD A;  4DL7 A;  2LQ5 A;  1KOH A;  3DLK B;  3RU0 A;  1NK6 A;  1VCT A;  5E5N A;  1C4A A;  2ABY A;  4A8X A;  4URG A;  2V34 A;  2GIR A;  4L76 A;  2NZ4 A;  2YNH B;  2DXE A;  2R7V A;  5ETK A;  1YBA A;  2KDO A;  1CC8 A;  3T9N A;  1ZM2 A;  5THW A;  2UU9 F;  5BXI A;  4LF4 J;  2M70 A;  5L38 A;  2XMJ A;  1S1T A;  1NK5 A;  1BQN B;  4DR4 F;  3ZZ0 A;  5GVQ A;  5E2Q A;  3WQP A;  3I56 S;  3BKT A;  4ES2 A;  4FKX A;  4ELU A;  2EBE A;  3HHE A;  4KTQ A;  2BKO A;  4Y65 A;  2VDI A;  1RAE B;  5DQI A;  3NRB A;  2QSF A;  3KWM A;  1CJV B;  3OTD A;  1VQO S;  1XWL A;  1VC5 A;  2ZH1 A;  2D69 A;  3K57 A;  3AT1 B;  3W64 A;  4NA3 A;  2BM0 A;  3AOA A;  3RBE A;  4HTI A;  4BBY A;  4Q8E A;  4Y34 A;  2D3O 1;  1FER A;  2VKZ G;  1IJE B;  5GAE U;  1F1B B;  1LV5 A;  4B02 A;  3MM6 B;  2KFY A;  2LEA A;  1OPI A;  5IT4 A;  4WKR A;  4DFP A;  4X2B A;  2JC1 A;  3HHL D;  4K4V A;  4BDP A;  4NX9 A;  1EIY B;  1LFW A;  5HJX A;  4ZPB A;  3MOJ B;  3AOB A;  2Z0G A;  1RKI A;  4QQB A;  2J8S A;  1S1X A;  4BWM A;  2JLF A;  1FVQ A;  2H65 B;  4QWC A;  1K47 A;  5B0B A;  2ZM6 F;  2RML A;  2ZZN A;  4LRD A;  1RDR A;  3EMT A;  4X66 J;  3CJQ A;  3US5 A;  1ZYQ A;  4FS2 A;  1C1C B;  1NSQ A;  1Y10 A;  2G2O A;  4ERD A;  1QJH A;  1JNR B;  2LKZ A;  4M5K A;  2AW0 A;  4NRU A;  1CUL B;  3MGJ A;  3HZE A;  2E9Z A;  3CD7 A;  2WHO A;  3BKU A;  1RAD B;  4EU0 A;  3AXM A;  1Q53 A;  3UN3 A;  3UWT A;  3QJL A;  1C1B A;  4V19 J;  4F4Z A;  3KFW X;  1T9U A;  3BR8 A;  2OO4 A;  4ED1 A;  3CGI A;  3D9B A;  4EWT A;  2KXH A;  2M7S A;  1N5S A;  2CJB A;  4Z7C A;  3QGH A;  2V4Q A;  2M9K A;  4ZDN A;  1VBY A;  3H5U A;  4DSK A;  4O3Q A;  3T1Y J;  1R89 A;  5JVG Q;  5DDP C;  3RYL A;  2HFV A;  1D8Z A;  1YTY A;  4CNY A;  2C3M A;  1U26 A;  4ICL A;  3MCM A;  2IRX A;  1UVM A;  2IBK A;  2R7W A;  2FZK B;  4WPA A;  2KXF A;  1IBK F;  2QTW A;  4CM0 A;  3OVB A;  1X9M A;  4A8Y A;  1RT5 A;  3HSD A;  2HVH A;  3Q0A A;  2RDD A;  3R9L A;  1OSD A;  1RUS A;  1OY9 A;  2R2U A;  5ETV A;  4PAA A;  3GIL A;  2P9G A;  5J2N B;  3G86 A;  2CZ9 A;  1EQM A;  3SCL E;  2IM0 A;  2UUT A;  2V4J B;  3FZB A;  3VAK A;  2HG4 A;  4KRW A;  3JSM B;  3MED B;  3GIJ A;  4UF4 A;  1NEE A;  3Q8R B;  2YQ1 A;  4IH6 A;  3ITH B;  2JZ5 A;  2QLW A;  3CF5 Q;  3QPI A;  1T0T V;  4F4Y A;  3PRV A;  2GJ2 A;  5H9F K;  3UR3 C;  2J9C A;  4D3G A;  3E01 A;  2KT2 A;  1V3Z A;  3HF5 A;  1QUP A;  4WFX A;  3TVY A;  5IC6 B;  4TYB A;  5LT5 A;  3FEX B;  2U2F A;  3KNA A;  1JJ4 A;  3MFI A;  2HBZ B;  2JEF A;  1GT8 A;  2LQ9 A;  1JK9 B;  1JQG A;  1EJ7 L;  3PIO Q;  4Q44 A;  3HVA A;  3UVJ A;  4ZVQ B;  5LM7 E;  3SCK E;  2PC6 A;  4LR9 A;  4CDI A;  4DZ6 A;  2YKN A;  3IS9 A;  3QNW B;  2B9X A;  4K50 A;  1XNQ F;  2KFZ A;  3FRY A;  3SDE A;  5I42 B;  4J9P A;  3W1Y C;  3BGO P;  3VGT A;  3QIP A;  2FVC A;  3C8Y A;  3FBF A;  3OTO J;  4DR1 J;  1PGZ A;  3KLF B;  4RU2 A;  2OMO A;  5E3C A;  3DRX A;  4RWX A;  2HRY A;  3M2U A;  3P45 B;  4KJI A;  1HBM B;  1V6H A;  1R0A A;  4W90 B;  1J2V A;  2A18 A;  3TAR A;  3FQK A;  4ECU A;  1VRT A;  1S1V A;  5CQG A;  4FYW B;  4OI4 A;  3G6X A;  2HHU A;  1ROF A;  2WBR A;  4CYU A;  1YJR A;  3MMA B;  3FNN A;  3I0S A;  3GLJ A;  3QO9 B;  4U7U K;  1ITP A;  3C15 A;  1LW0 A;  1VK8 A;  5DGA A;  3K2Y A;  5DG8 A;  4KH1 B;  1PCA A;  2HQ3 A;  2FC9 A;  4JV1 A;  4G65 A;  1RQ0 A;  2W01 A;  4FF1 A;  2CJK A;  4KE5 A;  2E5L F;  1KFS A;  4LF6 F;  4PQA A;  3CIM A;  4P9S A;  3KHR A;  2XSF A;  5BYS A;  5K14 A;  1X4A A;  2AX1 A;  2WVF A;  3DOM A;  1JKH B;  5KG2 A;  4JI8 J;  2BDP A;  2WVE A;  2G9O A;  4X64 F;  2W7A A;  2DGV A;  5HJY A;  3C16 B;  3FK4 A;  2OP5 A;  4CI0 B;  4ZVR B;  2XI3 A;  4PPZ A;  4JV5 F;  1R6Y A;  4JI2 J;  1VLY A;  3NCR A;  4QW9 A;  2C2M B;  1UFW A;  3X1L B;  3R7B B;  2GHW A;  4NLR A;  5A0Y A;  3C6T A;  3UN5 A;  1IR0 A;  2CPZ A;  3I9V 9;  3C14 B;  1Q86 T;  1RTD A;  4HH0 A;  5KTQ A;  3D0G E;  2XS7 A;  2MKY A;  4YR3 A;  4OHW A;  4ZN1 A;  3R5D A;  2WZ1 A;  3CNQ P;  1X5P A;  2HQG A;  5C25 B;  2GMJ A;  3DOL A;  1N36 J;  2SXL A;  3OJU A;  4ER8 A;  3GV7 B;  2CNK B;  1R8B A;  1VDH A;  4ECQ A;  2ROG A;  2VJU A;  3UNG C;  2CQB A;  3VQT A;  5U47 A;  5A8W A;  2ZHA A;  3KYL A;  1SPB P;  1V9O A;  4EO8 A;  1IKV A;  3V4M A;  1MMN A;  4PEO A;  1RT1 A;  4F50 A;  1IKX A;  3SCJ E;  1R27 B;  3HM9 A;  2Z8Q A;  3NMA A;  3K8V A;  1YWX A;  3A3O B;  4XK8 C;  1FNM A;  1HIY A;  4AT1 B;  4QIW D;  5JMN A;  1TUW A;  2PMZ D;  2AJ4 A;  2NLW A;  2V2K A;  4LF2 A;  4Y00 A;  1IBM J;  2B9Y A;  3MF5 A;  3ONQ A;  1QAJ A;  1JWW A;  4C8Y A;  3D6H B;  2V68 A;  4LSL B;  3TAM B;  1N4L A;  3KKF A;  3UPF A;  3A8J A;  2AZ3 A;  1VQ9 S;  5K8O A;  3NWR A;  4NLU A;  1Q79 A;  4KH0 B;  3MEE A;  2LEP A;  7AT1 B;  3HHD A;  1SQG A;  4LFC F;  3ZTQ A;  3V6H A;  3NKY A;  4OJH A;  2ZJR Q;  2YNF B;  1VQ4 S;  3VAI A;  1HNX F;  3SQG B;  1GX5 A;  2JEG A;  4MMO A;  5DQH A;  4B9T A;  4X4Q A;  4C8N A;  1DZ5 A;  4LFB F;  4QJV A;  2YWK A;  2Z57 B;  2UUA J;  1SC3 B;  4BLG A;  3JYT B;  1CLF A;  4XIU A;  4OI1 A;  3MCS A;  2DT9 A;  2C3O A;  2LA6 A;  2VH7 A;  4OLO A;  2O66 A;  3Q8S B;  4IFV B;  2NXC A;  4Z7Y A;  4AXJ A;  3G87 A;  1BQN A;  1Y5I B;  1APS A;  4OMF G;  1M5V C;  5CXT A;  1RHM B;  4F4K A;  2X1F A;  2DK2 A;  2XS5 A;  1CJV A;  4IG3 B;  3E51 A;  3QFH A;  1SJR A;  4OYX A;  5M2R A;  2JLG A;  5KFP A;  3CD5 A;  2E5J A;  4RLE A;  3QYY A;  2GQQ A;  4W92 B;  3PW2 A;  3KTQ A;  1DBD A;  3H42 A;  5GAD I;  4X4R A;  3IRW P;  1S97 A;  2XZW A;  5GAH U;  1HW8 A;  5M2P A;  3DNC A;  5ETM A;  2FTR A;  3MM6 A;  4JV2 A;  1EX8 A;  2KZZ A;  5CYM A;  1DHM A;  3L3C A;  1OO0 B;  3S6E A;  4ES1 A;  3TNV A;  4YY3 J;  1FEE A;  2CUY A;  1RZM A;  3ILJ A;  4O3R A;  1L3K A;  1CJK B;  5K5M A;  2BW2 A;  5D0R A;  2G0I A;  2KU7 A;  2EKN A;  1RAJ A;  4ZLP A;  1PJ5 A;  4FVM A;  1LQ9 A;  2DGO A;  2JX2 A;  2AZ1 A;  1NSP A;  4I56 A;  2IDL A;  1CUL A;  2BR0 A;  3CCV S;  1U09 A;  4HAC B;  3HD1 A;  2H3E B;  1F9F A;  5CA5 A;  3QGG A;  1U0S A;  3KDN A;  2AYE A;  2DPJ A;  2C2R A;  4NXM J;  2GVZ B;  2HGN A;  5J1E B;  1YX2 A;  2KO1 A;  2V67 A;  4FZV A;  4P52 A;  4LRF A;  4DFM A;  4OJG A;  2ADB A;  2VF3 A;  2MMY A;  3PIP Q;  2MY7 A;  4YR2 A;  2B43 A;  3QWP A;  2V8P A;  1TK0 A;  3J7Z 5;  1IM4 A;  2ZOF A;  4IOA Q;  2DEI A;  3JTO A;  5KFK A;  3T1H J;  1FWL A;  1QDU B;  2DR8 A;  1TL4 A;  3JAM U;  5F9N A;  4FYX B;  1HBO B;  3I4P A;  2VPZ B;  4P10 A;  1ACM B;  2OAU A;  3PKY A;  3D6F B;  4G6V B;  4DN0 A;  1QE1 B;  4HDH A;  4IRK A;  2M8D B;  3BR9 A;  2J6U A;  3K5O A;  5I3Q A;  4J91 A;  1YRT A;  4ZVU B;  2B7B B;  5F3T A;  1S0M A;  1LFP A;  4ECT A;  1RU1 A;  4Y2K A;  1KS2 A;  1NND A;  4N77 A;  2DCL A;  1XEZ A;  1SJF A;  1WC0 A;  1HAR A;  1KFD A;  5J2N A;  2DGT A;  3PO4 A;  4C2M A;  1XC9 A;  2HRU A;  1UJ5 A;  4DV2 F;  4B3S J;  2ZH4 A;  1RB0 A;  4NRT A;  5D0G A;  3W3S A;  1GXU A;  1Y00 A;  5M2U A;  4H4K A;  3BH6 B;  3UN2 A;  5HN0 A;  3GCW P;  4DR5 J;  1KSP A;  4RZR A;  1RWN B;  2AHO B;  1G1X A;  1Q0N A;  3JSM A;  4MKB A;  3MED A;  2L41 A;  1IR1 A;  3CCS S;  3ITH A;  4K4Z A;  2NRE A;  3QSY B;  4RNF A;  3U1N A;  3PW4 A;  2AGO A;  3J7Y U;  3FBB A;  2H54 B;  1RLC L;  5B0F A;  2YKQ A;  4NMX A;  4DR7 J;  1QVG R;  2YQ0 A;  3CJ2 A;  1IUJ A;  4C8L A;  1FRL A;  5KG4 A;  4OJ3 A;  2V5H G;  2QT7 A;  1NKB A;  3CWJ A;  1KEK A;  1D9A A;  3GYG A;  5ITH A;  1QSL A;  2B7C B;  3SQO P;  2O1P A;  2Q1L A;  2DIS A;  3M8Y A;  1A0O B;  2HRX A;  8AT1 B;  2V0N A;  2PFD A;  2LQ8 A;  4NML A;  5B0C A;  2Y0B B;  1NB2 A;  3ZZP A;  5G4D A;  4PWW A;  1SIZ A;  4DV7 F;  2KL8 A;  1HQ2 A;  4QWA A;  3QJJ A;  1REG X;  5I42 A;  3AOC A;  2YH1 A;  3EPI A;  1DUR A;  2M3D A;  4DX7 A;  3KLF A;  1F5A A;  2E7W A;  2N7Y A;  2MHN A;  1XMQ J;  2AEF A;  5K8M A;  1HBM A;  1O51 A;  1MRO A;  4NLX A;  5AXN A;  2V50 A;  2D3O R;  2W2O P;  4I64 A;  2FY8 A;  4ZVG A;  1RT3 B;  3OXF A;  3CJ5 A;  1OPZ A;  5B0G A;  2QJ3 A;  1N0U A;  3VGS A;  3QT6 A;  2DXD A;  4IOC Q;  2J76 E;  4X4P A;  6FDR A;  1HL6 A;  3MMA A;  3ZFV A;  3G71 S;  2PEB A;  2GJI A;  2ASL A;  3JSY A;  2RQM A;  2OSQ A;  3L7P A;  3MEC B;  5LMU J;  2HBY B;  1HKA A;  4HKQ A;  3MPU B;  2HZA A;  1X4H A;  3MAA B;  4EO6 A;  4DV5 F;  2HKE A;  4EI2 A;  2UXB J;  4FF2 A;  4O3O A;  4KPC A;  3PHE A;  1T95 A;  1S9E B;  4WTY A;  3J81 j;  4I6A A;  1JKH A;  4HHU A;  5IZH A;  2P8I A;  2PD1 A;  3CUN A;  1JX4 A;  5B09 A;  4YB5 A;  3C16 A;  3QT8 A;  2DH9 A;  1BGX T;  1V5V A;  3P8B B;  4Q43 A;  1S6U A;  2OFH X;  1AUD A;  3TA1 A;  2NSB A;  5AXL A;  3H59 A;  2HVI A;  4F02 A;  1RAG B;  4NLS A;  4JI4 F;  4ZIT A;  2NPF A;  2GHP A;  2YVS A;  3AH6 A;  1KLM B;  4HL9 A;  2DGQ A;  1Q4R A;  1RXO B;  4USW A;  2C2D A;  4JP8 A;  3GIM A;  3C14 A;  3F44 A;  2HAF A;  5HVH A;  1YJU A;  2QX0 A;  4ECS A;  3ENW A;  1T94 A;  4CQ1 A;  4QU7 A;  2J7W A;  5C25 A;  4M94 A;  3SSR A;  2DNR A;  3B4D A;  3VAJ A;  1NH7 A;  2CPY A;  2MKC A;  3VVU A;  4L3N A;  3LGH A;  2E1P A;  3G2X A;  3KHL A;  2DVI A;  1LWE B;  2AJ1 A;  4LF9 J;  1SCJ B;  3D28 A;  3P6Y C;  4PUO B;  1DLO B;  1GMV A;  4Q5V A;  2ZJP Q;  3WC0 A;  3G6E S;  4WJB A;  4JYA F;  3BSC A;  3JTP A;  2M52 A;  1WKK A;  1VLO A;  5HQM A;  1KTQ A;  1RTI B;  4OHX A;  2H48 B;  3GFZ A;  4RR5 A;  3OL6 A;  4EUV A;  3OD2 A;  1KQK A;  2V9K A;  2DO8 A;  1QSY A;  3ENV A;  2F3J A;  3VR1 A;  2HVD A;  5CCM A;  1XJW B;  3OT9 A;  5LOQ A;  3O6Q A;  2W8K A;  2B0G A;  2QEX S;  1FFW B;  4UW2 A;  2WSC C;  1Z1Z A;  2JVO A;  2XYG B;  3DU5 A;  5IT0 A;  3JXO A;  3B6B A;  1WAC A;  1C0T B;  4FPI A;  3L7U A;  3T5J A;  1M5K C;  4U67 Q;  3TAM A;  4LSL A;  1FT8 A;  2RHQ B;  5AXM A;  1S5Z A;  1UJ6 A;  4EYH B;  2QMW A;  2BVZ A;  3QRR A;  5B0E A;  4DF4 A;  5MAO A;  3HVW A;  1WHW A;  2IHR 1;  4I4B A;  3HPO A;  3U1M A;  2KZM A;  4DR6 F;  1IQT A;  4E0D A;  4PKD B;  5BJR A;  5CCL A;  2YNF A;  1CG2 A;  1X5T A;  3CJ4 A;  2AYM A;  3SQG A;  3DM2 B;  2KRR A;  4KKO B;  2MGZ A;  2B5J B;  4PXE A;  1N34 J;  4KFB B;  1QM9 A;  2ZNZ A;  2OPS B;  1PBA A;  3JYT A;  3DLG B;  3DFE A;  1H6K X;  3M8R A;  4IFV A;  1RT6 B;  5KG3 A;  3VZH A;  2DRA A;  3HD2 A;  1R7I A;  1FKO B;  3IG1 B;  1RWW B;  5BYQ A;  1FHT A;  1MWQ A;  3SSQ A;  2JWN A;  5DET A;  4DL5 A;  1S7I A;  3MCO A;  2MEW A;  4B3T J;  4IG3 A;  4ZK7 M;  2MTL A;  2Q43 A;  4IDK B;  2FDN A;  1R31 A;  1U0H B;  3FFI B;  4LRC A;  4F0M A;  2KXN B;  2NCK L;  2XI2 A;  4USK A;  1VBK A;  4K0K J;  3LP1 B;  2F9J A;  4UUX A;  1XQI A;  3GII A;  1XMO J;  2BQR A;  2OJ3 A;  5HSP A;  1HPZ B;  2CRL A;  3BN7 A;  4TU8 A;  2ZUG A;  1NO8 A;  1HD1 A;  1RCO B;  2CJX B;  1OWX A;  4RNN A;  3GP9 A;  4DV4 J;  4F4W A;  1JLQ B;  2K3K A;  1RT7 B;  4XDD A;  4GC7 A;  4DV1 J;  3UNY A;  1L3U A;  1TK5 A;  2WTF A;  3R2C J;  4HAC A;  5MLC V;  1FXL A;  1U1K A;  3GFX A;  2RB7 A;  4J9U E;  2UXC J;  3NCQ A;  2EEY A;  2CQ1 A;  2ZH9 A;  2GVZ A;  4NEZ A;  4ZPW R;  1SJQ A;  3V6J A;  2GAH C;  4CP5 A;  2EG2 A;  4OYZ A;  5J1E A;  1IBL F;  3EDQ B;  2X7I A;  1NDK A;  2EFQ A;  4OX9 F;  2GCF A;  4ZCM A;  3NL0 A;  3AJD A;  4N47 A;  2C3U A;  3HZG A;  1KD1 T;  5IOL A;  4C8K A;  3UCZ P;  2LLZ A;  5ETO A;  3K89 A;  2XGP A;  4ZCK A;  2RRB A;  1F60 B;  3NAI A;  3VZI A;  2JEJ A;  4DL2 A;  1WF0 A;  1I6J A;  1Y9O A;  1X4E A;  5KFR A;  1QE1 A;  4U96 A;  2ZKU A;  4OX6 A;  2H1Y A;  3LQV A;  4A8K A;  3NOC A;  2OPP B;  3PDN A;  2K1R B;  1ZZF A;  2HQC A;  4K4S A;  4J9V A;  2D3U A;  2FJV A;  2PMW A;  3KK3 B;  3BDP A;  1NK8 A;  3OLB A;  1AYE A;  2LXU A;  4FYY B;  2V9W A;  4YEA A;  2GW8 A;  2GO9 A;  2WVB A;  3OVS A;  3TZX A;  2HHV A;  1NCL A;  2ZZM A;  4IRD A;  2LDI A;  4I1T A;  1UVJ A;  3HT0 A;  4MTP A;  2XGQ A;  2FB0 A;  4DPW A;  3F56 A;  1U1O A;  3DXB A;  3O8W A;  3TAN A;  3K58 A;  2QA4 S;  2W2P P;  1NJZ A;  2QA1 A;  3SFU A;  3OXL A;  1BWV A;  4I2P B;  2OML A;  4U6P A;  1RTZ A;  1U6Z A;  1FX2 A;  4CWB A;  5B7W A;  2ZKT A;  2KVI A;  1FDB A;  3OXG A;  4NZ7 A;  2OSR A;  4DDF A;  2HEK A;  1T9X A;  1W26 A;  4NPO A;  1UP1 A;  1TZ0 A;  3E2E A;  5ETQ A;  4FNH A;  3EVO A;  2HHQ A;  2UXD F;  4X4S A;  5HMW A;  1KQG B;  1RTJ A;  2UU9 J;  4DX5 A;  3N6L A;  5KFD A;  2AF6 A;  4L6V 3;  2ATC B;  3NAH A;  3ETO A;  2FJX A;  3MOZ A;  4DR4 J;  3CJK A;  2EFP A;  3O5T B;  2MKH A;  1ZBT A;  4TVA B;  4LF7 F;  2LYV A;  1FXR A;  2FZG B;  5JXS A;  4HR2 A;  3JQM A;  6FD1 A;  5L8R C;  3BQ1 A;  4KPY A;  5EX3 A;  3IGV A;  1TEL A;  1U6B A;  2KYZ A;  2BJ8 A;  2W2M P;  4LMZ A;  2B4P A;  5F9L A;  1ZA2 B;  4CT9 A;  2CXE A;  3IAS 9;  4A8M P;  1RT3 A;  3SBM A;  3JTN A;  3PFO A;  1PIL A;  2ZIT A;  1Y4Z B;  4RNM A;  2CVI A;  4QR1 A;  2WCX A;  1F5B A;  5DDQ C;  5KFW A;  3H5S A;  2Q66 A;  2MZS A;  1SH0 A;  3FDS A;  4USJ C;  1IXK A;  4A8F A;  1SV5 B;  3E8O A;  2AD9 A;  2QLJ B;  3J7A 1;  3IWL A;  2VFU A;  1UZH A;  2DD8 S;  4A48 A;  3MAA A;  1YGY A;  1LWC B;  2IA0 A;  1U47 A;  1UEV A;  2Y1L B;  1RWV B;  4ILR A;  1S9E A;  2OFG X;  3C66 A;  1EHW A;  5D4P A;  1RKJ A;  4NA2 A;  5IWA F;  1VQP S;  3OFE A;  2DH7 A;  4USV A;  4U7C A;  3VAG A;  4DX6 A;  1H74 A;  1E6Y B;  1J5O B;  1SC1 B;  2OUG A;  5LJ3 Y;  1W2I A;  1D3W A;  1UEU A;  4DUZ F;  4NLO A;  3VGU A;  2HGM A;  2DH8 A;  2V2V A;  1D09 B;  4LBH A;  4ENO A;  2WW4 A;  3QZ8 A;  1MN9 A;  1TU0 B;  2E7X A;  2X1B A;  2I8E A;  1X4D A;  4K8R A;  3RB4 A;  1GTH A;  1HWJ A;  4GRS A;  2A10 A;  4O4R A;  3R6L B;  2GHV C;  2YXL A;  4GKJ F;  1H7W A;  4JI5 F;  2JOQ A;  4AL5 A;  4OHV A;  3K5N A;  2B51 A;  3CJR A;  1ZET A;  4PYA A;  3RW6 A;  1QLN A;  1LWE A;  1MML A;  2HIY A;  5HL7 Q;  1IBK J;  4PUO A;  1DLO A;  2ZC3 A;  4ZS6 A;  2IRU A;  2H5J B;  4WYW A;  1RBO B;  4C8O A;  4WXO A;  3CO0 P;  4B08 A;  3EDR B;  3NGD A;  3D1H A;  4IYQ A;  4DG1 B;  1WEZ A;  4LVO P;  1RTI A;  4DPO A;  4PCQ A;  1QSS A;  1H72 C;  2AKW B;  4IO1 A;  2HPU A;  2KRB A;  2L48 A;  3ZZU A;  3CED A;  2NS1 B;  3AD9 C;  3D0I E;  3NY0 A;  4WU2 A;  3DLL Q;  3TAP A;  3ZXW A;  2ZUA A;  2LXF A;  4PG5 A;  4QCL A;  2BYC A;  3MTK A;  4BHQ A;  3EE3 A;  4ED0 A;  3PY8 A;  1G2E A;  4C6A A;  2EKY A;  4HTJ A;  2V8D A;  1PAE X;  3KK2 B;  2JLE A;  2C2O B;  2FJB B;  3T41 A;  2Y0S D;  3TQE A;  2W2N P;  4UY8 T;  5J1N A;  2QIF A;  2G1D A;  2QE5 A;  4B9L A;  1H38 A;  1CBK A;  4C3L A;  3HFZ B;  4M5H A;  4USU A;  5HMX A;  5KFA A;  4RW4 B;  1YRU A;  2O67 A;  3A4T A;  1RU2 A;  5AE1 A;  1RJJ A;  2DR6 A;  4WF9 Q;  2PT0 A;  3LPY A;  3RRK A;  4FBU A;  3PR5 B;  3DM2 A;  4NYO A;  4KKO A;  4IQX A;  1S1U B;  1RYR A;  2XO7 A;  1S0N A;  4KFB A;  4JI3 F;  2W4P A;  1KVI A;  4PQU B;  2OPS A;  1XNQ J;  1GNK A;  2DNG A;  1F2H A;  1HI1 A;  4ILL A;  4CLU A;  3H0P A;  3DLG A;  3M2R B;  4Q2L A;  3W5Y A;  2V8G A;  4C8Z A;  1RT6 A;  1YG0 A;  2NSC A;  3Q86 A;  1FFG B;  4DU7 A;  4JI0 F;  3NWG A;  1SBR A;  2GQ2 A;  1FKO A;  3IG1 A;  5FDL B;  5I3P A;  2F7V A;  1RHQ B;  3KUG A;  3DC2 A;  1SIW B;  4IDK A;  2C42 A;  4WZM A;  1U0H A;  2Y3Y A;  3FFI A;  5F8G A;  2MHE A;  4WZQ A;  1G7C B;  3ET6 B;  4TQR A;  4MKV A;  1YJ7 A;  5K20 B;  4X62 F;  4DPX A;  1JJ2 R;  3LP1 A;  2OEK A;  4K59 A;  4C7Q A;  1DJ0 A;  1DTQ A;  4UQT A;  4NLD A;  4P2S A;  2YKO A;  3MD1 A;  3IC1 A;  3M05 A;  4YN3 B;  3T3F A;  1DAR A;  2YKM B;  1EP4 B;  2NXE A;  4ZPA A;  2E5L J;  3HFK A;  2XLI A;  4FF4 A;  3H4B A;  4ECW A;  2KI2 A;  3MUR P;  2DCU B;  2IAJ B;  1JLE A;  4X64 J;  4F2S A;  1XR7 A;  3GIR A;  2Q6B A;  2HHS A;  3V6K A;  3RBX A;  1JLQ A;  2APO A;  3MD3 A;  4JV5 J;  1N32 F;  1RT7 A;  2KYX A;  1NZA A;  1FJG F;  5DLF A;  2XB2 D;  5DQG A;  4QYZ J;  2QN6 B;  4QWE A;  2F4V F;  1RI7 A;  2HGL A;  2HK3 A;  4WCE Q;  3WDO A;  5DO2 A;  5B0A A;  4DR3 F;  1R8A A;  2HBQ B;  1HNW F;  3AQP A;  4IR1 A;  2BQU A;  3CCT A;  1RA7 A;  2BM1 A;  1MN7 A;  3G4S S;  1M5O C;  1A6L A;  5L46 A;  3G6Y A;  2HS4 A;  2CVE A;  2AYB A;  3VGV A;  2D3Z A;  2GC8 A;  3W8G A;  3AHP A;  1FTC A;  3PG9 A;  4CO4 A;  1H73 A;  2FC8 A;  2W9B B;  1BC6 A;  3MUV P;  4X4T A;  3OSP A;  2ZBR A;  4OZL A;  1N33 F;  1ZM9 A;  3WIU A;  1K1S A;  4CLP A;  1QTM A;  3H2V E;  2WW8 A;  1ZH5 A;  1YJV A;  4HEA 9;  3QAT A;  4G3I A;  4FPR A;  2OPP A;  3EPG A;  2K1R A;  3M6W A;  1RAH B;  1AZS B;  4DS4 A;  2DRD A;  3BRE A;  2RIL A;  3UFC X;  4ETX A;  4J9Q A;  3DDK A;  4GKK F;  4N5S A;  1K73 T;  4RU9 A;  1ZAV A;  1T05 B;  2PEH A;  3MPD A;  1OQ3 A;  3UCU P;  2DKO B;  2HHP A;  3W62 A;  3W60 A;  2LU2 A;  5F8I A;  4WFB Q;  4H4O B;  2R2S A;  3IR5 B;  1UAW A;  1P1T A;  1RWM B;  4DX8 H;  2WRM A;  4WKY A;  3N0V A;  2YWW A;  3PYE A;  4I2P A;  1RWX B;  2NXJ A;  3IAM 9;  1PG5 B;  3G8T A;  3J7A N;  4LFC J;  2NXN A;  4M5M A;  4M5G A;  1SQF A;  3G6V A;  1FDD A;  4C4W A;  1HNX J;  2Y1J A;  3CJT A;  1Q5V A;  3VAM A;  3PW7 A;  1M1G A;  5DM7 Q;  4LFB J;  3DRR B;  1IKW B;  5CD4 H;  2UVV A;  4URQ U;  4DN9 A;  4EZ9 A;  3GTY X;  4EMD A;  3R1L A;  2KHC A;  2JDJ A;  3CB4 A;  1U6F A;  1HQU B;  4DV6 F;  3AFG A;  2XMT A;  1KNZ A;  4GO7 X;  4M95 A;  1FJE B;  1C0U B;  3NS7 B;  3OHB A;  1U02 A;  5F0W A;  2EW0 A;  3DLJ A;  2MXY A;  2D41 A;  5KT7 A;  2XNQ A;  2Z4P A;  3M8S A;  3VAH A;  3TZY A;  2ASJ A;  3PJX A;  1IWG A;  3QT5 A;  1NBE B;  1S7H A;  1XR5 A;  5C24 B;  3T6J A;  5LSO A;  2BJE A;  2IMO A;  3HI9 A;  2M0G B;  2DNO A;  4O4G B;  2RU9 A;  5J2Q B;  3H2U B;  4CLZ A;  4QU6 A;  3Q8Y A;  4Y28 C;  4HI2 A;  1T9T A;  5DS7 A;  1EB0 A;  4MT1 A;  1WF2 A;  1SJ4 P;  2MQQ A;  1SV5 A;  2VBW A;  1D0E A;  2AEJ A;  4L74 A;  4DI6 A;  1RYS A;  4LSN B;  1SI9 A;  5F8M A;  2VG6 B;  2KM8 C;  4AL6 A;  4X65 F;  1RWO B;  3W5X A;  1LWC A;  2CYY A;  3RJM B;  2WSE C;  3UR0 A;  4J9N A;  2K7J A;  3CCL S;  1HW9 A;  3BSN A;  4LQ3 A;  3VQS A;  4TY8 B;  2XLJ A;  2C2N A;  1Q7Y T;  1CJU B;  4HYK A;  4HH1 A;  3R7S B;  2HNY B;  4WYL A;  3P5B P;  3TJ8 A;  1RT2 B;  1E6Y A;  1J5O A;  1U1N A;  1VHF A;  3H5X A;  4DL4 A;  3PEH A;  3S8S A;  2PGC A;  1HWK A;  4LFA F;  4NLT A;  3T9Z A;  2ZC4 A;  1RCX B;  4TN2 A;  4IRC A;  3ISN D;  2ZH6 A;  4MIW A;  1F9E B;  4FXD A;  2IVY A;  2OTL S;  1LWX A;  1FNO A;  1SKS A;  5I3U B;  3D4J A;  3K5P A;  4QR0 A;  3MZI A;  4TKT A;  3FVY A;  1RAF B;  1E6V B;  1UVI A;  2KT5 A;  4DFJ A;  3I87 A;  1B7Y B;  4NLV A;  4OI0 A;  3C46 A;  2CJY B;  2EFV A;  2PSZ A;  2YWH A;  1GX6 A;  3DGP B;  1QUV A;  2Z30 B;  4ZPD A;  4ZOS A;  4DG1 A;  2CA9 A;  4ECZ A;  2DHX A;  5HI7 A;  1FD2 A;  3ZZZ A;  1SL1 A;  1OY6 A;  2RNE A;  4DV2 J;  4NLQ A;  2HWT A;  2UZA A;  5KT5 A;  2Y9H A;  4DZD A;  4Q2M A;  5KFL A;  4TU7 A;  2GJF A;  2RDJ A;  1WC4 A;  2ZBI A;  4OQJ A;  3BZQ A;  1Y11 A;  4AYB D;  2K8G A;  2FHJ A;  1MWY A;  4OV1 A;  1XR6 A;  1NU4 A;  3J80 Y;  2RUG A;  5CAB A;  3KK2 A;  1KOO A;  5IC4 B;  5E7O B;  2AGQ A;  1H3D A;  1WDT A;  3Q23 A;  1CJT B;  1NHU A;  1NUE A;  3MR5 A;  4G1Q B;  1N52 B;  3TWZ A;  4WP8 A;  2I1R A;  5LJ5 Y;  4RW4 A;  5EGY A;  3ENQ A;  2LDY A;  5KFI A;  5ADZ A;  2QSW A;  1KR4 A;  4KIA A;  2BAN B;  2BUN A;  2C22 A;  5KAK A;  4DF8 A;  1HI8 A;  3VHQ A;  4FXV A;  1XN9 A;  5KOX A;  1RWU A;  2EFG A;  5IV4 A;  2FY1 A;  1S1U A;  4DV7 J;  1RAA B;  4MIA A;  3SZ2 A;  5KFO A;  1WD6 A;  2BBE A;  1K44 A;  4PQU A;  2XC9 A;  3VVT A;  3M2R A;  5F0U A;  3DDN A;  2FGO A;  2VBZ A;  4YME A;  2AQ4 A;  1VIS A;  3M1V B;  3CCZ A;  4LF1 A;  2IYI A;  3B8H A;  2V94 A;  5FDL A;  2POK A;  5D6G A;  4Q8F A;  3NMR A;  5KFH A;  3D6M B;  5DRK A;  4CLW A;  2ASD A;  3JQJ A;  4PG6 A;  2MQM A;  3M9N B;  2ZE2 B;  1VQ7 S;  5HMZ A;  3MMJ A;  4ZPC A;  3MM9 B;  3ET6 A;  1QAI A;  3MM5 B;  3FZ2 A;  1AW0 A;  3SIP B;  1VBX A;  4ECV A;  3EGW B;  4DMZ A;  2DR5 A;  4B9M A;  3KJN B;  3KDO A;  1FX4 A;  1XER A;  4LF5 F;  4Y2M A;  4PG4 A;  2YKM A;  1EP4 A;  4XO0 A;  1VJQ A;  3BN4 A;  4DV5 J;  4IQM A;  4MK9 A;  2FJA B;  2OH2 A;  3BKF A;  4CLF A;  4FXW A;  1DQ9 A;  4DL3 A;  3D7S B;  3SEO A;  4O3S A;  3IA0 A;  2IAJ A;  4RX6 A;  2Z58 B;  3OFH A;  2OI2 A;  3TQ1 A;  2XWY A;  4WFA Q;  1VRU A;  5D4L A;  5CYM B;  2HVE A;  4KY3 A;  1F6T A;  4JI4 J;  1F2G A;  1X0P A;  1CSJ A;  3OVA A;  4CO3 A;  5KFC A;  4Y0F A;  3MPY A;  3CCQ S;  4QYR A;  2EWH A;  1SJ3 P;  4KGZ B;  4PG8 A;  1HHS A;  4KC5 A;  1WDD A;  3OBI A;  5L9X A;  3CMA S;  3VF0 B;  2UVR A;  1EQ0 A;  1BLU A;  2OEL A;  2I9S A;  3DHX A;  5IQQ A;  3SV4 A;  2V8H A;  4OX7 A;  4TLQ A;  1NDC A;  1N54 B;  1KVK A;  3CC2 S;  1MG7 A;  3MEG B;  2IMW P;  3RRG A;  4PRF A;  4MKA A;  3WHI A;  3I96 A;  3HSZ A;  3M32 B;  3BQ0 A;  4CT8 A;  1RTH B;  1FNX H;  2BZ2 A;  2E1R A;  1SXL A;  4IOB A;  2W9B A;  4ZHR B;  2BRL A;  2C2Z B;  3BSO A;  3G8Q A;  3Q8U A;  2EC2 A;  3T5L A;  4R5P B;  1IKY B;  3EWG A;  2DR7 A;  1U1L A;  3EGZ A;  3HHK A;  4J90 A;  4JYA J;  1AFI A;  1NXI A;  1TFY A;  3CCJ S;  1P8G A;  2NUU G;  4ZVO B;  4B3M F;  2N4C A;  5KT6 A;  1VIX A;  4YY3 F;  4U8V A;  3ILI A;  1SKR A;  1TTH B;  3RG6 A;  1AZS A;  2RQK A;  3NEK A;  3VTI A;  3M30 B;  3PRB A;  3CJ0 A;  5IFM A;  3DLE B;  3N28 A;  3N01 A;  2XLK A;  1FWP A;  2B8P A;  3UD4 P;  1JLG B;  5H9E J;  2JFK A;  5FD1 A;  5FLX Y;  2ZH5 A;  1T05 A;  5K8P A;  2R3V A;  2EW9 A;  2MZ1 A;  3QZ7 A;  3NLC A;  3DRY A;  1O8B A;  3CCU S;  3P3D A;  1R8P A;  3BQ2 A;  3CXC R;  4H4O A;  3JAM Y;  3K59 A;  4LT6 A;  3FMB A;  2W9C B;  4ETZ A;  1WKJ A;  3K5M A;  4QIG A;  1LWF B;  3LH2 S;  2OEM A;  2E1M C;  2J5A A;  1X9S A;  3DCA A;  1MMD A;  1RA6 A;  3PW0 A;  3AJ1 A;  1C4C A;  4DR6 J;  2XZD B;  2YPZ A;  4N56 A;  1S48 A;  5AJ3 F;  2OGU A;  4F4X A;  4N8N A;  3B54 A;  2DO4 A;  3MUT P;  2F5G A;  2ZH7 A;  4KGM A;  4NZ6 A;  3DRR A;  2Q3P A;  1IKW A;  3TVZ A;  3VWS A;  3ZC4 A;  1NDP A;  2XS2 A;  2E66 A;  2QGF B;  3QJP A;  2L3M A;  3AJ2 A;  2BKP A;  3M6X A;  3GCX P;  3B82 A;  2ILY A;  2KG1 A;  2BQ3 A;  1HQU A;  4Q0B B;  5KFQ A;  4OHY A;  2XMV A;  3PZP A;  1JB0 C;  1S12 A;  4J9M A;  4DWI A;  4KQZ A;  4ECR A;  1C0U A;  2B3T B;  4PXC A;  3VCD A;  5EDW A;  4IG0 B;  4EEY A;  1UW4 A;  1KTV A;  4DCO B;  4IUF A;  2AJ0 A;  5C24 A;  2AU0 A;  1I94 F;  3GV8 B;  3LA0 A;  2AGP A;  2VG5 B;  5KFE A;  1ZTW A;  1R8H A;  4LIW A;  1PYS B;  1WOS A;  1WI6 A;  4EK2 A;  3RB6 A;  4BS2 A;  3D3B J;  4O4G A;  2AV5 A;  4F36 A;  5J2Q A;  1R3N A;  3CUL A;  2VDH A;  4DR2 F;  2Q6C A;  2J7K A;  1DRZ A;  2XMK A;  3K0J A;  3TRG A;  4P2F A;  4NAS A;  2BJ9 A;  1O6X A;  2VU5 A;  2HFN A;  3DI6 B;  2UV8 G;  1FO1 A;  2J7U A;  1MRO B;  4LSN A;  3RBD A;  2VG6 A;  3MR2 A;  1X60 A;  2VHG A;  3PEJ A;  5IS2 A;  2OHD A;  3F41 A;  1WC3 A;  3IR7 B;  4NLP A;  3POT B;  2VQE F;  3AXK A;  4TY8 A;  3L09 A;  4KBI A;  2HWI A;  1WJ9 A;  4PXB A;  1SC6 A;  1CJU A;  3ETM A;  2HNY A;  1HWU A;  2KJV A;  3QGI A;  1RT2 A;  2OIH A;  4DV3 F;  3ENA A;  1IBL J;  3T5H A;  1Y7P A;  4ELV A;  2BMB A;  2EFO A;  4OX9 J;  4JI7 F;  4P7V A;  3DRS B;  2R42 A;  3FCV A;  4CLS A;  2VC1 A;  5RUB A;  1PIE A;  2HQI A;  3HHL B;  2MKK A;  1REV B;  4FNI A;  4S0M A;  2CDR B;  1VQ5 S;  1XMB A;  2ROE A;  2RD5 C;  2MQL A;  2KT3 A;  3T5K A;  2CAD A;  4RKU C;  5I3U A;  2XCA A;  3W7B A;  4LIR A;  1E6V A;  1FRK A;  1EKR A;  2RH3 A;  2E5I A;  4RWW A;  4PG7 A;  3EVW A;  1MW7 A;  2XBP A;  2FLN A;  3KG0 A;  3V6D B;  3A8I A;  3DGP A;  1VK3 A;  3QGP A;  1NPR A;  5GME A;  3PO5 A;  4GVL A;  4B9S A;  2B56 A;  1HMV B;  5ETP A;  2BE2 B;  1GMW D;  4MK7 A;  3SMZ A;  2F8E X;  3J80 U;  2HHH J;  3W66 A;  4ZLL A;  4DQP A;  3DN9 A;  1ZA1 B;  1L3S A;  3G82 B;  1VOM A;  1VHI A;  1YVF A;  1PJ7 A;  2GVD B;  1PC5 A;  4P72 A;  2UUB F;  2DJW A;  2DNM A;  2FJE B;  3OFG A;  3CCE S;  3AD8 C;  3TP2 A;  3AOD A;  4QW8 A;  3GFY A;  2FUG 9;  4LR7 A;  3QFW A;  4MK8 A;  5L1L A;  1NJI T;  3R8Y A;  4YP3 A;  5CAA A;  2GNK A;  2G1H A;  2NYH A;  2W8L A;  1S9G B;  1CJT A;  3K17 A;  4G1Q A;  4ID8 A;  4O3N A;  2B4U A;  3LUY A;  2XO6 A;  4YQW A;  3EYZ A;  3RR8 A;  5LSR A;  3TYT A;  2DHS A;  4RUA A;  1S59 A;  5GAG U;  2PII A;  2WB1 D;  3MM8 B;  3A8E A;  2RJZ A;  1TKD A;  2BAN A;  2UXD J;  1BMQ B;  1WKL A;  3N6M A;  2R9L A;  3K7R A;  4C0B A;  2ZZT A;  3UW1 A;  4KHP F;  2Y1I A;  4DHV A;  3FEZ A;  3JS9 A;  1DY3 A;  2VV5 A;  3GE9 A;  3O2I A;  3V5R A;  3G8S A;  1HLW A;  1FWK A;  3CO9 A;  4K2J A;  4NXN F;  2JEI A;  2EK6 A;  1UVL A;  4LF7 J;  4RW6 B;  3KHG A;  5E3P A;  3M1V A;  3CJ3 A;  1MSW D;  3GR1 A;  4FKY A;  3CE8 A;  4KV8 B;  1S6O A;  2MQP A;  2R7R A;  3PX4 A;  2B6A B;  4AFF A;  1CC7 A;  4RJV A;  3TVK A;  2BAB A;  4DV0 F;  5A8R B;  1WNE A;  4BCA A;  1Y5L B;  2X51 A;  3UDE A;  2ERR A;  4OJ1 A;  2RIJ A;  3OHA A;  3UDL A;  2MGZ B;  3BDE A;  2ZHO A;  3J81 U;  1RIS A;  3ZTS A;  1IBC B;  3MR6 A;  2UV8 A;  4HT5 A;  2ZE2 A;  4GVB B;  1XBW A;  3ZTR A;  1QY7 A;  3MM9 A;  3CPW R;  3MM5 A;  5E3Q A;  1NME B;  1PAU B;  4GC6 A;  1N48 A;  4U95 A;  3RTV A;  1GQE A;  2R8J A;  2V2Q A;  3KMQ A;  4OHZ A;  3EGV A;  3W8P A;  2DIT A;  4K4U A;  1RP5 A;  2ZH2 A;  3NGS A;  3KJQ B;  4TNO A;  3V4I B;  3KJV B;  1LKZ A;  3M9M B;  2KB2 A;  4H4K C;  4YFU A;  2GV1 A;  2NR0 A;  1KKH A;  2CJ9 A;  3RAQ A;  3CJS A;  1UA0 A;  2WK4 A;  1UET A;  2PDA A;  5IWA J;  1A9N B;  1KN6 A;  2LVW A;  2I0X A;  4HHH A;  2W2Q P;  1DFD A;  2D1C A;  1TMM A;  2MKS A;  3A12 A;  2F40 A;  4PYD A;  4DUZ J;  2QA4 G;  3I32 A;  2ZBC A;  1HNV A;  3Q22 A;  1X5S A;  4K2X A;  2FZC B;  1H7X A;  1OS5 A;  1NPP A;  2YPY A;  4KGV B;  2J0X A;  2I2Y A;  4GKJ J;  3MEG A;  2M5Y A;  4JI5 J;  3AA8 A;  3H98 A;  2FLL A;  2VIC A;  3OLA A;  3ZZO A;  2PO4 A;  3M32 A;  1ELO A;  2VFS A;  5E3R A;  1RTH A;  3KG4 A;  2HK2 A;  3HFV A;  4C0H A;  2BV3 A;  4Q7A A;  3BPD A;  4ZHR A;  2DNZ A;  3W63 A;  1F9H A;  3IN5 A;  2CPF A;  4R5P A;  1IKY A;  3LOU A;  2XYH B;  2Y1R I;  2C2E A;  5KFV A;  4ZP9 A;  3TA0 A;  3FEY B;  5FLX U;  4HLB A;  2W1B A;  3CDA A;  4C97 A;  5HAT A;  3GPA A;  3M30 A;  2L08 A;  1WG4 A;  2U1A A;  4WP9 A;  3DLE A;  1ZPV A;  3RZA A;  3RB3 A;  1JLG A;  1T11 A;  2XQC A;  2HIQ A;  2WSF C;  5J2M B;  2QL9 B;  4QIE A;  4UOH A;  1KDN A;  3ILO A;  4JI6 F;  1U1M A;  3HKZ D;  1MNE A;  1TL5 A;  2DNP A;  1S6Q B;  1F3V A;  4OLP A;  1C2P A;  2GO8 A;  2XUL A;  4AD6 A;  4FS1 A;  2W9C A;  1LWF A;  1TVR A;  3HHL C;  4WK1 A;  5A76 A;  3B4M A;  4EZ6 A;  1HBU B;  3FUY A;  4CZC A;  4MYU A;  2JRS A;  4OYW A;  2YTC A;  1WHV A;  2W4D A;  2F1F A;  4N8O A;  3IO1 A;  4J9L A;  2YY3 A;  2MPU A;  1BQM B;  2DIU A;  3D2W A;  4U8Y A;  4JI3 J;  1BUX A;  3GON A;  3OR2 B;  3BV8 A;  4FN5 A;  4RUC A;  1H2T Z;  2QYG A;  3M2V B;  2LA4 A;  4R8U B;  1UJ4 A;  1G3O A;  4PAB A;  1OYE A;  3PHT A;  3CCR S;  4RBT A;  4Q0B A;  1YBT A;  5DM6 Q;  1JJC B;  4JI0 J;  4J9O A;  1HNI B;  3HO1 A;  4QBU A;  1U7L A;  2CPI A;  2R2R A;  1G6B A;  3LP0 B;  4IG0 A;  3EM1 A;  3GYX B;  1R43 A;  5G0R B;  2QLB B;  2X3G A;  3HK2 A;  2HFS A;  4ED3 A;  1Q78 A;  4P75 A;  1RTJ B;  5D3G B;  4D3H A;  1YJT A;  2NZC A;  1UFK A;  2VG5 A;  2IVM A;  4X62 J;  2ROP A;  2J9D E;  2RT3 A;  1IN0 A;  3CJK B;  1NJX A;  1DTT B;  4FP9 A;  4QWD A;  4YB1 P;  5DZ7 A;  3UE2 A;  2I5J B;  3LPE A;  3EXC X;  2Q79 A;  1U25 A;  1V3R A;  5ETN A;  1D9F A;  1N8R T;  2N4D A;  2PA3 A;  3DI6 A;  1I5O B;  4L73 A;  3H7H B;  4OZJ A;  3W2V B;  2GX8 A;  2BX6 A;  1YZ7 A;  2B8Q A;  4WIQ A;  1YLX A;  1W2B R;  2HMI B;  1Q95 G;  2B9E A;  2Y8W A;  1N32 J;  3POT A;  4KB7 A;  3TJ9 A;  4TY9 A;  2H5I B;  1FJG J;  2CWK A;  1PC4 A;  4K5S A;  4DCP B;  1XNR F;  2GIQ A;  3D67 A;  1AT1 B;  3MMB A;  2F4V J;  1FKP B;  1X9W A;  2VD3 A;  2O3D A;  4PZV A;  1QAX A;  2ILZ A;  3I55 S;  4C9D A;  4DR3 J;  1YRX A;  4ED2 A;  4CLK A;  2N3L A;  1Q16 B;  3DMJ B;  1HNW J;  5H9F J;  3N4W A;  3I4H X;  3DRS A;  5E33 A;  2HYI B;  2FIU A;  5LL6 d;  3Q83 A;  3ULH A;  4LSZ B;  5KT4 A;  2V2Z A;  3HHL A;  2QA2 A;  1REV A;  4V19 X;  5L9N A;  3QWU A;  3UDV A;  1K8A T;  3M8P B;  3ZNJ 1;  2QV6 A;  4WFZ A;  2G4B A;  2BE9 B;  2VOP A;  2R8K A;  1S76 D;  1N33 J;  3TEG A;  2PI4 A;  3KLG A;  1U4B A;  3CC7 S;  3LP2 B;  2NYI A;  5GMK a;  1ZAW A;  1J5E F;  5E41 A;  1N5Y B;  1FFS B;  3V6D A;  3W65 A;  4C98 A;  4JB8 B;  4KHR A;  4X84 A;  4OV6 A;  5KFZ A;  1WEL A;  4QR2 A;  2QRR A;  3THP A;  4NCG B;  4GKK J;  1HMV A;  3KLV A;  2BE2 A;  5IM0 B;  1GMU A;  3QMQ A;  3C2P A;  2YX4 A;  1ARO P;  2HFZ A;  3OL7 A;  4QPX A;  2Z2L A;  1WOO A;  1Q8K A;  3NGT A;  5CHC B;  3G82 A;  3PFE A;  2RF2 A;  3I0R B;  2GVD A;  3PAC A;  2FJD B;  1N0V C;  4YHH F;  1ZPW X;  5IV3 A;  1MLA A;  4BC7 A;  3JQK A;  3D68 A;  2XHW A;  5CYQ B;  4ZP6 A;  2EI5 A;  2JC0 A;  1S9G A;  2XCP A;  4B9U A;  3J7Y I;  2IM2 A;  7FD1 A;  2JSX A;  3RW7 A;  2IA6 A;  4DFK A;  3ZZT A;  1N56 A;  4FBT A;  2R7O A;  2XTJ P;  2RKI B;  3MM8 A;  4M5I A;  4C0O C;  3TUZ C;  3HMJ G;  2MLZ A;  4NOH A;  1S6P B;  2CDQ A;  4LF8 F;  5J1P A;  4QIF A;  3MEK A;  3BGU A;  2IBO A;  4CH7 A;  2VQF F;  4DV6 J;  4OFZ A;  4OZ3 A;  1K0V A;  3DOK B;  5HAN A;  2ALY B;  1NDL A;  3LAN A;  1KVJ A;  4RW6 A;  4P71 A;  4OYM A;  4KV8 A;  1OQ6 A;  1HD0 A;  2B6A A;  1S49 A;  5A8R A;  1EAR A;  1M5P C;  3D6T B;  5IQ6 A;  3N5F A;  4KO0 B;  3LW5 C;  2ZH3 A;  5F8L A;  2YNI B;  1NHV A;  2J0S D;  1PYO B;  2VIH A;  4AE5 A;  1RAO A;  3NBP B;  4GVB A;  4RL1 A;  1QTN B;  2J6T A;  3AB2 B;  4YDX A;  3EGN A;  2Y8Y A;  1FTR A;  4DLG A;  1VQS A;  2ZWO A;  2HBR B;  3CC4 S;  4LRB A;  4CCH A;  1TL1 B;  1Q82 T;  2E9T A;  2VOO A;  4ZP7 A;  2ZBQ A;  2YQ3 A;  2W24 A;  3V4I A;  3KJV A;  4OI6 A;  1UVN A;  1RHU B;  2GML A;  4CM2 A;  1S99 A;  1U8S A;  1U2F A;  5CYJ A;  4ED7 A;  4HI1 A;  4X65 J;  1KP6 A;  2K06 A;  1Q5Y A;  1WC5 A;  3CIZ A;  3DLH A;  1SUQ B;  3LF0 A;  1DTQ B;  3SXL A;  2F9D A;  5CZV A;  4AQY F;  3D5M A;  4U9R A;  2NQP A;  1AB8 A;  4CLL A;  4DU8 A;  1Q8B A;  5CH7 B;  3LWM A;  3H4D A;  4LFA J;  2HZC A;  5IXU A;  3CDW A;  5SZT A;  1TQL A;  4NZ0 A;  4UUW A;  1N5T A;  1JLB A;  4ECY A;  1S72 S;  1JLA B;  4OYP A;  1MU2 B;  1JLE B;  2G0C A;  5KFJ A;  4I2Q B;  4F25 A;  1BY9 A;  1KQF B;  3I5C A;  4UTG A;  1QAY A;  2NUH A;  1KQS R;  2AEM A;  2EG1 A;  2B9W A;  2MJN A;  3BF4 A;  2AIR B;  5JJB A;  4OI3 A;  3MI7 X;  3Q8Q B;  1IWA A;  2MKI A;  3HCX A;  3IBW A;  4KGK A;  2RE1 A;  2EVZ A;  1JXE A;  4Y3C A;  3MUM P;  1I1G A;  5JVH Q;  3PXG a;  1WWH A;  1VYA A;  4IR9 A;  2IRY A;  2ZD1 B;  1RAC B;  2HHW A;  1FKA F;  4X4V A;  3W9J A;  4UY8 5;  4XAK A;  3FSI A;  3QAU A;  2C3P A;  2MZR A;  1Q8I A;  3RGI A;  3BO2 A;  2A6O A;  4I0W A;  3QSI A;  5GAD U;  3CW2 C;  2UUC F;  1VRQ C;  2E5G A;  3HVR A;  3OL8 A;  5E0O A;  4ZP8 A;  2IFX A;  1FXD A;  2DNL A;  2K7K A;  2XG8 A;  3KHH A;  2LCW A;  3IMQ J;  4Z2X A;  2CPJ A;  5J2M A;  1B99 A;  3SSS A;  5DJB A;  4WWS A;  4ZN3 A;  1R8C A;  3EZ5 A;  2VUG A;  5AE2 A;  3OUY B;  4EBC A;  2CNO B;  3FKB A;  1S6Q A;  4IH5 A;  1GMW A;  3WBZ A;  4F3Q A;  3M4X A;  3H8Y A;  5C5J A;  1U49 A;  4F2R A;  4DQR A;  2EC0 A;  4UOF A;  2YX7 A;  3H40 A;  1VQ6 S;  1TK8 A;  2YWE A;  1HBU A;  2P6S A;  2DGW A;  4ZVE A;  1K9M T;  5GMD A;  1WI8 A;  2WB4 A;  5D0E A;  1BD6 A;  2E44 A;  2AWZ A;  3UI3 A;  1HR0 F;  4M63 A;  5KFX A;  3B78 A;  4ANC A;  2HWH A;  4OIX A;  2P9E A;  3ZZY A;  4DJB A;  2QZ8 A;  2VOD A;  2G13 A;  1GAO A;  4TU9 A;  3SV3 A;  1JLF B;  2LU1 A;  5C42 B;  2YH0 A;  1FDA A;  3LAM A;  1BQM A;  3OR1 B;  3NGR A;  2VA2 A;  3OR2 A;  4U7U D;  2PE8 A;  3MFH A;  3U02 A;  2OPR B;  3A13 A;  3TUP A;  3M2V A;  4ZCI A;  4R8U A;  4J5O A;  2H5E A;  2ZFH A;  2CQI A;  3I82 A;  3NXZ A;  1NKE A;  5F8N A;  3IFE A;  1NPK A;  5DDO C;  2FVP A;  3BJY A;  5KT2 A;  1HNI A;  3TEH B;  4ATN A;  3R2D J;  3LP0 A;  1RBL A;  2ZDP A;  2ZBP A;  4DEZ A;  3CT9 A;  5L39 A;  1BXN A;  5G0R A;  3V81 B;  3MM7 B;  1UTA A;  4K4Y A;  4KAI A;  4WFN Q;  1Q1K A;  1R0B G;  2D9O A;  5D3G A;  2ZEJ A;  2WOM B;  3FGV A;  2IVF B;  3LGM A;  3THT A;  4WBF A;  3EXY A;  1L5U A;  2FLP A;  2QO3 A;  2MUI A;  2DO0 A;  3Q8V A;  4K5R A;  1DTT A;  2XWX A;  5C2G A;  3K8W A;  1YIT S;  3A1Y G;  1NK4 A;  3FBE A;  2CQD A;  2ADC A;  2I5J A;  1CQM A;  3NNA A;  2IPO B;  4LF5 J;  1NM2 A;  1IM6 A;  1NAQ A;  4FYV B;  2HS0 A;  5KFU A;  1JIH A;  2CQ2 A;  1B0T A;  1Q7L B;  4LBP A;  3D3C J;  3GJS B;  3CSK A;  3D1O A;  3ADA C;  3CD0 A;  3QID A;  3W2V A;  3FCH A;  1Q81 T;  3SYZ A;  1WOP A;  3IWN C;  3DLK A;  1P6T A;  1Y5N B;  4RBU A;  2LEB A;  2HMI A;  2YNH A;  1AUS L;  4UOC A;  1OSC A;  4ED5 A;  2VG7 B;  5KG6 A;  1T9W A;  4NCA A;  2CFX A;  3PYF A;  5BYR A;  3I31 A;  2COL A;  2LMI A;  1U45 A;  1TKT B;  2F8M A;  1FKP A;  1PYT A;  3IR6 B;  1Z2Z A;  2XM3 A;  4MH8 A;  5HRO B;  5L1K A;  5KFF A;  1R6V A;  2ZM6 J;  2BOP A;  4OZ5 A;  3DMJ A;  1AXQ A;  3T6B A;  3ZNU A;  3MPV A;  3DYA B;  2F65 A;  2I38 A;  3TOQ A;  1XIQ A;  1YBU A;  2MJU A;  1U24 A;  1XK8 A;  2ACM A;  3M8P A;  3GIK A;  2H9Z A;  1NJY A;  5HP1 B;  1KHW A;  3QQC D;  4LR8 A;  2RU3 A;  3BB5 A;  1NK7 A;  2J8A A;  3Q2T C;  5ETS A;  2R7U A;  1ZTT A;  3AY0 A;  4WE1 B;  4ILM A;  8RUC A;  1FK9 B;  4KR0 B;  3T1A A;  2FHO B;  3M7V A;  3KNG A;  2VJV A;  1V3S A;  3THV A;  2VZ9 A;  3NG8 A;  4ZLN A;  3LP2 A;  4B3M J;  1RLD A;  2E1A A;  1N5Y A;  2MZT A;  4N41 A;  1RGV A;  5IT9 Y;  1FRI A;  3I6P A;  1F5C A;  1RBA A;  4DPU A;  2R7X A;  2CAJ A;  2CZV C;  4NCG A;  5IM0 A;  4HHJ A;  1C1C A;  4TLR A;  1HNZ F;  2DGS A;  3LGN A;  4DLE A;  4CIO A;  4AXI A;  2EBG A;  1GEH A;  4RNH A;  5KFG A;  1YHQ S;  3A3P B;  3I0R A;  3IM9 A;  2W4C A;  1ZOT A;  4M5J A;  3BYP A;  2R4F A;  2MQ8 A;  2DB1 A;  2F8H A;  1VC6 A;  1SQE A;  2CKW A;  1P9Y A;  2IJF A;  1UPP A;  2XNR A;  5CYQ A;  1FDN A;  3A8K A;  2P2C B;  4JV0 A;  3TR5 A;  2G0J A;  3KMS A;  3BO3 A;  4B3R F;  2CQC A;  4MAK A;  5I4M A;  2NPI A;  1X0F A;  1LW2 B;  2CNN B;  1FRH A;  5AJ3 J;  2A6M A;  4WXW A;  1UZD A;  4P73 A;  4TQS A;  3GV5 B;  2RKI A;  2WVC A;  2DXF A;  1VQY A;  2HRT A;  1UEK A;  3GU0 A;  4DBQ A;  4B17 A;  1S6P A;  3I9Z A;  3IRX B;  3Q89 A;  1HHQ A;  1M90 T;  3W5Z A;  1SC4 B;  4NWB A;  3MAH A;  2E7V A;  3DOK A;  5HBM B;  1FA0 A;  2ZOG A;  3MCN A;  4WII A;  2CPH A;  3BGR B;  4KSE B;  4L75 A;  1HWL A;  4C48 A;  3SCI E;  1N6Q B;  2FVQ A;  4R0J A;  1TMJ A;  1ZZN A;  1FRX A;  1W25 A;  4DUY F;  5C7P A;  4JI1 F;  1AFJ A;  2J0W A;  1I94 J;  2ZNY A;  4KO0 A;  2V4J A;  3ICL A;  2YNI A;  1KWM A;  2LP4 A;  1U1R A;  3O3L A;  2FJW A;  4ID5 B;  2VL1 A;  3NBP A;  5HQL A;  3OFF A;  4DS5 A;  1GH8 A;  2YKP A;  1BE4 A;  2ZVI A;  5KFS A;  3MAQ A;  2DHA A;  4DR2 J;  1HBN B;  3MXH P;  4HDG A;  1ZAX A;  1TL1 A;  1YDL A;  5HQ8 A;  4J9S A;  1B7F A;  2ZWP A;  1WOR A;  3BPS P;  1JXV A;  4NE9 C;  3KLI B;  3PJW A;  5LSL A;  3DU6 A;  2WVD A;  3HSG A;  4DOZ A;  4RNO A;  1SL0 A;  2BEF A;  2VFR A;  1O5J A;  3TX8 A;  4FYD A;  3FBC A;  3DRP B;  3KOA A;  3OTC A;  5LMN F;  4I68 A;  2VQE J;  3HT3 A;  4RBV A;  2MKJ A;  1SUQ A;  1KON A;  4L72 B;  1D9D A;  4NLW A;  3AA9 A;  4GO5 X;  3BM7 A;  3PNI A;  3GWC A;  1KRP A;  2DHG A;  2KN4 A;  4PPD A;  5BR8 F;  1EKS A;  4DV3 J;  2R8G A;  1U1Q A;  1YIJ S;  4LF6 J;  1CS4 B;  1FJC A;  4JI7 J;  3QLH B;  4MFB B;  2D74 B;  1VFJ A;  2HQF A;  4P2M A;  3UD5 A;  1WF1 A;  3N9U C;  1JXL A;  1JLA A;  2XEX A;  2AX0 A;  1MU2 A;  2ZDO A;  2A2C A;  1UPM B;  2RUS A;  4BWJ A;  4B3O B;  4I2Q A;  3JSR A;  3HUL A;  1VRU B;  1B3T A;  5KFY A;  2CPD A;  1CVJ A;  1OY8 A;  2YWG A;  9ATC B;  2GS5 A;  3PW5 A;  3T19 A;  4LF4 F;  1TP7 A;  2BW7 A;  2ZHB A;  1OMS A;  3QO9 A;  1UWB B;  3PJ9 A;  3EZO A;  3Q2S C;  2ZD1 A;  4QPT A;  3OW2 R;  4A47 A;  2GZO A;  1NSA A;  2B4O A;  2OPQ B;  1DAX A;  3OL9 A;  4RUH A;  2BE7 D;  4YB7 A;  1IQZ A;  1T8E A;  1YKW A;  2IIH A;  3GQC A;  4K4X A;  2RAQ A;  3TUI C;  5LXR A;  1KC8 T;  3H25 A;  4ED4 A;  5EUH A;  2IDE A;  3K5L A;  2FPH X;  2UUB J;  4QIV A;  1LK5 A;  4EGL A;  1NB7 A;  2X1G A;  1PJ6 A;  1FD8 A;  1UA1 A;  4C8M A;  2QMU B;  3TX0 A;  1HWI A;  1SKU B;  3OUY A;  5D4N A;  4EYI B;  2EFN A;  1FE0 A;  5ETR A;  2CG8 A;  2I6W A;  4Y2I A;  3RR7 A;  2KVQ E;  4WU3 A;  4TXS A;  3PRD A;  1Y0H A;  2DGX A;  4M1K A;  2CPE A;  2YKA A;  2QFJ A;  4X66 F;  3HDS A;  2XY6 A;  2H4Y B;  3M9O B;  4NI2 B;  1O0P A;  1SVD A;  2D9P A;  4KHP J;  4UQG A;  5D78 A;  2Z2Y B;  1JLF A;  1WHY A;  5C42 A;  1WTB A;  3WC2 A;  2HS3 A;  3MMC B;  3OR1 A;  1XTZ A;  4MJK A;  1RE1 B;  4ZVS B;  2BKN A;  1F0X A;  4LQ9 A;  4NLG A;  2OPR A;  4EFA C;  4NXN J;  3P96 A;  4OYI A;  4E98 A;  4EBE A;  5K8N A;  1D8Y A;  3RBZ A;  3A3N B;  3R5A A;  5EWF A;  5AXK A;  2RRA A;  2CNL B;  1FVS A;  4F3M A;  4DV0 J;  2DY9 A;  5DG9 A;  3VV2 B;  3BYR A;  1BHN A;  1TKX B;  2DY1 A;  2HHT A;  4O0N A;  2IJN A;  3T1Y F;  3V81 A;  2HUR A;  3MM7 A;  2FHM A;  3EZU A;  2IY5 B;  2GMH A;  1HHT P;  2IYG A;  2WOM A;  3WZ0 A;  1B4S A;  3P5T L;  4C3M A;  1NKC A;  1TAU A;  3PV8 A;  3HSJ A;  4A4J A;  2EXU A;  4ZPV R;  1IR2 A;  2XMU A;  1OIA A;  2WON B;  3M6V A;  1NH8 A;  2GGP B;  2VPX B;  4R25 A;  3RRH A;  4ZVP B;  2XY7 A;  1TR0 A;  1WUU A;  3J7Z T;  3OTE A;  3KXD A;  4KYZ A;  1DQ8 A;  2XMW A;  4MIB A;  1VS3 A;  2A3J A;  2XY5 A;  1UCN A;  3R6G B;  4RW7 B;  2C3Y A;  3KLH B;  3R3T A;  3CTR A;  1NJW A;  1NZ8 A;  3GG0 A;  3KLE B;  4QYZ K;  2VG7 A;  2DNY A;  3MDF A;  1QVF R;  2V6A A;  2HNZ B;  1NLK L;  1YJN S;  3BSA A;  5D4O A;  2QMX A;  1TKT A;  4ZPT R;  4AND A;  3RB0 A;  5ETL A;  4F0H A;  4YDD B;  2JNJ A;  5HRO A;  3O1L A;  2CQH A;  1X31 C;  4ZJL A;  5B08 A;  2RHS B;  1L3V A;  4OZ1 A;  1KBR A;  5KG0 A;  1VQK S;  2M88 A;  3KK1 B;  3DYA A;  3TUJ C;  1RWP B;  3OTB A;  4CO0 A;  1BQX A;  1VIO A;  3MTJ A;  2BA9 A;  4JUZ A;  3SFG A;  1J27 A;  4M5L A;  2R7Q A;  1DQA A;  5HP1 A;  3H90 A;  1X5O A;  1FRM A;  2A2D A;  2E29 A;  1R0C B;  3WX4 A;  1S10 A;  4WE1 A;  3F73 A;  4I7F B;  3HLU A;  1FK9 A;  5IT9 U;  3M6U A;  1ZM3 A;  4M8L A;  2K3I A;  2JH3 A;  2YNG B;  1ULR A;  3OTO F;  4DR1 F;  4H54 A;  3BGF A;  2FHK A;  4GMK A;  3EVM A;  1NRK A;  1TL3 B;  4DL6 A;  2R2T A;  1X4G A;  3MWB A;  4WP3 A;  1NSK L;  1CJK A;  4NEY A;  3I5A A;  2X1A A;  3UDC A;  1GFW B;  2CQ4 A;  3BEG B;  3L4B C;  1P1L A;  4LVN P;  4O0I A;  4A8Q A;  3TAQ A;  1TL7 B;  2UUW A;  4P6Q A;  4J37 A;  1X8D A;  4NL5 A;  2OEJ A;  2RQ4 A;  4JI6 J;  3U1L A;  1T7P A;  1KHV A;  1M0S A;  1EET B;  2M4M A;  4OZN A;  2DIV A;  2HND B;  8ATC B;  3G9C A;  4F0K A;  2W25 A;  4CH1 A;  2LFV A;  3HVT B;  4ZVH A;  4UOG A;  3GB0 A;  2DRB A;  3R1H A;  4ED8 A;  2ALZ A;  1LW2 A;  1VC0 A;  3HJV A;  3ZZR A;  2GS8 A;  5EWG A;  1JLC B;  3UCG A;  2AMC B;  1LOU A;  1K1Q A;  4JI8 F;  1RHR B;  1UL3 A;  1PKU A;  1VI7 A;  3W61 A;  6AT1 B;  1HBO A;  5KG5 A;  4DCJ B;  4JI2 F;  3IBC B;  5F3Z A;  3IRX A;  4YOE A;  2QYC A;  3HXM A;  3W2W B;  4G1P A;  4CO5 A;  1U2R A;  3EJM A;  5T7L B;  1W7W A;  1P9Q C;  3U7J A;  2EK1 A;  2MZJ A;  2CPX A;  5HBM A;  1JMT A;  1SB6 A;  5HAO A;  3TO8 A;  3BGR A;  4AL7 A;  2FHJ D;  1N6Q A;  4F04 B;  3DLB A;  2YX1 A;  1N36 F;  2GQC A;  4M5D B;  4ZIW A;  3V2U C;  5A2Q Y;  2HHH F;  4FDF A;  2VPW B;  4ES3 A;  1CPZ A;  4ID5 A;  4EBD A;  4ALZ A;  3R5C A;  3AB4 B;  2BAC A;  2WAQ D;  3C19 A;  3HHN B;  4I69 A;  4J9R A;  2FVR A;  2BJ1 A;  1HBN A;  3PYD A;  5CZX A;  5D8H B;  1MWZ A;  3R5B A;  4JBC A;  1TV6 B;  2JFD A;  4NCB A;  2XMA A;  1UMJ A;  2HSE B;  2D7S A;  4ZMM A;  2QLF B;  3CDE A;  4B9V A;  2ZH8 A;  3L9Z A;  3KLI A;  1YZ6 A;  5DGB A;  3G96 A;  4DXL A;  2KFN A;  3PTW A;  4DPY A;  1WC1 A;  2OKQ A;  3CDU A;  3DRP A;  3M8W A;  4Y2C A;  2RQC A;  3QBC A;  2MQO A;  4UST A;  3OPK A;  1T3O A;  4IO9 Q;  1XNR J;  3H5Y A;  2BXJ A;  2JVR A;  5A8K B;  1IBM F;  3IXQ A;  4O44 B;  3J81 Y;  4YR0 A;  4I6W A;  5AE3 A;  3N6N A;  4LUB A;  5HLF B;  3SI8 A;  2AT1 B;  2F63 A;  2DBB A;  3W9I A;  3PR4 A;  2BJD A;  2H4W B;  1CS4 A;  4YUD A;  3ELH A;  4NYZ A;  3QLH A;  4MFB A;  1PO6 A;  2HHX A;  1FEH A;  3TJA A;  1G4C A;  4QZV B;  2DR9 A;  4Y6I A;  1WHX A;  3MHY A;  4C11 B;  4OI2 A;  1RHJ B;  4B3O A;  3WX8 A;  2AP6 A;  2XHC A;  2UUA F;  3CMQ A;  2JHE A;  3ZTP A;  2VC0 A;  4H4M B;  1U48 A;  2HLT A;  1HNV B;  1T03 B;  4CTA B;  1HYS B;  1J5E J;  1S0O A;  2G2Z A;  1TKZ B;  2L9N A;  3NS6 A;  3R27 A;  2VFT A;  2KKH A;  4RW8 B;  2HZV A;  1UWB A;  2PI5 A;  1B0V A;  5KG7 A;  1UW9 A;  4OYO A;  4PR6 A;  3MEC A;  1HQE B;  2QLX A;  4IKA A;  2DNQ A;  4X4O A;  2OPQ A;  5T14 A;  2MB0 B;  3NP5 A;  2QG9 B;  2ACY A;  2V63 A;  4ZLJ A;  3AAW B;  3FRZ A;  3ZTO A;  2LXI A;  3GSD A;  1WC6 A;  3MPW A;  1YK9 A;  4LJM A;  1LEO A;  1LNQ A;  3CME S;  4URS A;  4TYA A;  1YJW S;  3NCP A;  4YHH J;  2QL5 B;  4RW9 B;  2XYP B;  1VQM S;  1UVK A;  2ZVS A;  1U2C A;  2YBV A;  2AJ2 A;  3HP6 A;  2WBM A;  1OJ4 A;  4KGX B;  3DDI A;  2VBY A;  2O01 C;  4DQQ A;  2BRK A;  3HKW A;  1KLM A;  4ELT A;  2PMH A;  3H2L A;  1NHK L;  1H98 A;  1X4C A;  4DSE A;  4RPF A;  3ZO7 A;  1K0T A;  5CD4 A;  1NK9 A;  3NGK A;  3GYN A;  4E8U A;  4OZ2 A;  5D15 A;  4CH0 S;  1RSC A;  1URR A;  5LXY A;  3UD3 P;  4KHM A;  4NI2 A;  4ECX A;  2VBX A;  4XPC A;  3C6U B;  3CCM S;  4CLY A;  3D1Q A;  4LF8 J;  3NNC A;  4X4U A;  4R0E A;  4YS2 A;  2VQF J;  1RAI B;  1P27 B;  5J2P B;  3MMC A;  2VA3 A;  3RAM A;  4ZVF A;  1TVR B;  3C3L A;  3GMG A;  2J9E A;  2LQB A;  4NXM F;  2G2Y A;  2N7C A;  2RVJ A;  3F0N A;  2XSJ B;  1HI0 P;  1TAQ A;  3CDB A;  1FF2 A;  3M8Q B;  5DDR C;  4USH A;  3KUE A;  4F4A A;  1CQN A;  3N79 A;  3HX9 A;  2IC3 B;  4CNZ A;  1TKX A;  1N5Q A;  3EIC A;  1S77 D;  1FRJ A;  3GR0 A;  3T1H F;  1SH3 A;  2J9D A;  4IFY B;  1RT4 B;  4Q45 A;  5A6W A;  3BH7 B;  1ICE B;  1WEX A;  1RK8 A;  1EZZ B;  5JUM A;  1PBU A;  2IJR A;  4CRJ A;  1GXL A;  1S4E A;  3MR7 A;  2E9R X;  4DSI A;  2EPI A;  2RS8 A;  3LAL A;  4P2X A;  2DEJ A;  1C0T A;  4FVC A;  1TFW A;  4F8R A;  2VKR A;  1F3F A;  3GJQ B;  2HVZ A;  2WON A;  4E2F B;  1S4F A;  1UFL A;  4M5N A;  2GGP A;  3BS9 A;  2R8I A;  2ZJQ Q;  2C2K B;  4ZKA A;  2ASY A;  2UP1 A;  4MKY A;  4PXD A;  1VMB A;  3S7R A;  2Z2Z A;  5AT1 B;  2A0F B;  4B3S F;  4KT0 C;  3EX7 B;  1YQH A;  3FSY A;  4RW7 A;  2DYA A;  3KLH A;  3ISZ A;  1B0P A;  2DNK A;  2KM8 B;  4DR5 F;  2B4V A;  4YB6 A;  3KLE A;  2B5J A;  2VB6 A;  5B0D A;  5KT3 A;  3QT7 A;  2W9A A;  3PCO B;  3S01 A;  4N7T A;  2ZOM A;  1B70 B;  2HAI A;  4AQY J;  4USM A;  2QL7 B;  3GJT B;  2HLU A;  2R7S A;  2HNZ A;  3U27 A;  5GAE I;  4OZ0 A;  4W4M A;  4A8O A;  2N3O A;  4UZB A;  4MYT A;  4J9K A;  4DQS A;  1V5I B;  4DR7 F;  5A6P A;  1M1K T;  4WK3 A;  5KG1 A;  1LXN A;  5D77 A;  2P9C A;  1LK7 A;  3L7O A;  1S1W B;  1VR6 A;  2K2P A;  3FMW A;  2MLY A;  3QRP A;  4PWD B;  2CG4 A;  2JJ4 D;  4OYA A;  3P4U B;  3GJR B;  1CEZ A;  3KK1 A;  2AJF E;  3MR3 A;  3BBC A;  1YJ9 S;  1YI2 S;  2CQP A;  3D66 A;  2VON A;  1RWK B;  4A46 A;  5K9F A;  3PVX A;  3RUB L;  3P49 B;  2MZQ A;  4F67 A;  4BC9 A;  2BOA A;  2HFO A;  3BBF A;  3MMB B;  5L1J A;  1UWA A;  1NK0 A;  1QD1 A;  1S1T B;  3FC9 A;  5EHH A;  3N5B A;  4F26 A;  3BO4 A;  4I7F A;  1L3T A;  2LQJ A;  4I6Y A;  4DSF A;  1SL2 A;  2YNG A;  2OD4 A;  2GA7 A;  4ITS A;  2QFI A;  1XMQ F;  2CQ3 A;  1HPZ A;  4NLY A;  4XPE A;  4C3K A;  2PA8 D;  1TL3 A;  5E3A A;  5H1S V;  5H9E K;  1VJW A;  3GSI A;  3QRQ A;  2UUC J;  4DSJ A;  1OYD A;  4DUT A;  2DPI A;  4ANE A;  2HW3 A;  5EX0 A;  3IM8 A;  5KFT A;  3HJF A;  4X4N A;  3IGN A;  1WG5 A;  3EUN A;  1TL7 A;  1Y3J A;  3CJ8 A;  3KLG B;  2QC3 A;  4UT4 A;  3TI0 A;  2C28 A;  4DQI A;  1EET A;  4QOT A;  5FJ4 A;  3DXS X;  3FSX A;  3TZW A;  5F41 A;  4PWU A;  3NS5 A;  1S1X B;  2HND A;  4K4T A;  2W7O A;  3R97 A;  5LMU F;  4RUB A;  4ZVT B;  3HVT A;  1H0H B;  1M5H A;  2CIM A;  3GG1 A;  1U8W A;  4Z37 A;  2UXB F;  1HR0 J;  2E5H A;  1H2U X;  4OYB A;  3IP0 A;  1JLC A;  2RF2 B;  3OSN A;  1SJ1 A;  1UKU A;  2MDA A;  1H2V Z;  2R7T A;  4B9N A;  2DHH A;  1VQL S;  3R5J B;  2UVU A;  1TUG B;  5D0H A;  4I67 A;  3IBF B;  1I51 B;  3CD6 S;  3KUH A;  1C1B B;  3O44 A;  4DL0 C;  3S1T A;  2KTQ A;  3W2W A;  4CLT A;  2AJQ A;  5T7L A;  2O5D A;  3LWL A;  1U1P A;  3UQS A;  2BJ7 A;  3PX0 A;  5A2Q U;  2MST A;  1S79 A;  3PM9 A;  2CJA A;  1D1U A;  1T9V A;  2ATL A;  2KH9 A;  3RAX A;  5F8J A;  3KK3 A;  3PX6 A;  1FI4 A;  2A1B A;  3TW0 A;  2PN6 A;  3D54 A;  3Q8P B;  1JJH A;  4ICL B;  3ISN C;  2FQQ B;  4IH7 A;  4M5D A;  1M1H A;  1N88 A;  2RSQ A;  3DHW C;  1IJF B;  4NA1 A;  4AUK A;  2KG0 A;  3KJF B;  4LF9 F;  1WTF A;  2DNN A;  1TUV A;  1RT5 B;  3AQO A;  3VAF A;  7FDR A;  1T3N A;  4XTT A;  1SKW A;  1TV6 A;  2RRN A;  4LBI A;  1B64 A;  3FJ2 A;  2VPY B;  4UZC A;  4O3P A;  1URN A;  1FE4 A;  4FF3 A;  2MQN A;  2KHD A;  3OV7 A;  3M8Z A;  4QWB A;  2C1E B;  2FVS A;  1ZS6 A;  3PYG A;  2Z56 B;  3JSB A;  5KFM A;  4DPT A;  3BGL A;  2DGU A;  2LEC A;  9RUB A;  4P7T A;  3NGU A;  5A8K A;  2CJQ A;  3LAK A;  4O44 A;  1KLN A;  3NOG A;  4WFY A;  2J6S A;  3E01 B;  5HLF A;  3LTO A;  1GK8 A;  1GXT A;  4USI A;  4OX8 A;  1RHK B;  2GIF A;  1GTE A;  2H51 B;  3VAL A;  1I3O B;  2IM1 A;  5DLG A;  3UVJ B;  5KOW A;  5DZ6 A;  4F7V A;  5HVG A;  4C11 A;  1RAB B;  5ETT A;  4A8S A;  2MSS A;  2YKN B;  3IS9 B;  3R5G A;  1N34 F;  1A7G E;  2M8H A;  2KJW A;  2PFF B;  3SDE B;  2V8V A;  2FYX A;  1M5S A;  3QIP B;  3WIV A;  3ILL A;  3AD7 C;  4O23 A;  1T9Y A;  2HQD A;  4H4M A;  3DGV A;  1S9F A;  1T03 A;  2CWX A;  4CTA A;  2OD6 A;  1WEY A;  1HYS A;  3M2U B;  1TKZ A;  5HVF A; 
#chains in the Genus database with same CATH homology
 2DO8 A;  2GS5 A;  2GZO A;  2MUI A;  2HAF A;  2AJ2 A;  2HRX A;  2EW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...