2GZOA

Nmr structure of upf0301 protein so3346 from shewanella oneidensis: northeast structural genomics consortium target sor39
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
187
structure length
187
Chain Sequence
MESLQNHFLIAMPSLDDTFFERTVIYLCEHDEKGAMGLVINKPLGIEVNSLLEQMDLPTEQVSADLAMGSQVLMGGPVSQDRGFVLHTSQPYWANSTELGSGLMLTTSRDVLTAIGSKRSPDKFLVALGYAGWSKNQLEQELADNSWLTIPADHALLFDINHEDRWQQASRSLGFEAWQLSTQAGHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0301 protein SO3346
publication title NMR structure of UPF0301 PROTEIN SO3346 from Shewanella oneidensis: Northeast Structural Genomics Consortium target SOR39
rcsb
source organism Shewanella oneidensis
molecule tags Structural genomics, unknown function
total genus 35
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02622 DUF179 Uncharacterized ACR, COG1678
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1300 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits VC0467-like domains 2gzoA02
3.40.1740.10 Alpha Beta 3-Layer(aba) Sandwich VC0467-like VC0467-like 2gzoA01
2HRXA 2EW0A 2MUIA 2DO8A 2AJ2A 2GZOA 2GS5A 2HAFA
chains in the Genus database with same CATH superfamily
4DSKA 2PMHA 1Y3KA 2QE5A 2CJYB 2DNGA 2LA6A 5F0UA 2ZC3A 2BW2A 3VCDA 1U1MA 4PPDA 3NEKA 4ZVHA 3OJUA 2H48B 4EUVA 1T9TA 2LA4A 3OLAA 4RUHA 2BOAA 2CJXB 3BGUA 1NJXA 5B08A 4CTAA 1IWGA 3UVJB 4WPAA 1RTIA 3M8WA 1ACMB 3FFIB 4QQBA 2HFSA 3CPWR 2GAHC 3QIDA 4P74A 2CDRB 3G2XA 3MR2A 1C1CA 3OHAA 3GV8B 4M5KA 5C42B 5KFZA 1Q8LA 4EEYA 1C0UA 2VFRA 2DCUB 4C6AA 1SBRA 4P6QA 2F1FA 4EFAC 2HHQA 4EBEA 2O01C 1UWBA 2NPIA 4OZLA 4ECVA 3AJ2A 2GAGC 5CCLA 2R8KA 1M5SA 1LXJA 3ET6B 4ZP6A 3BM7A 1NKBA 2C2KB 2PI4A 4DF4A 2DNNA 2MSTA 2W8KA 1YRXA 5K5MA 2CZ4A 3KUGA 4OLOA 2WHOA 3HHLA 3TOQA 1FWLA 1IKVA 1WOPA 2HNDB 4TLRA 3CTRA 3DFEA 5ETKA 3QGHA 2DR9A 5DG7A 4CM0A 5CYMB 3DM2A 3MPWA 3LF0A 3TJ9A 2YWFA 4RU9A 1ZETA 4UQTA 4ECSA 4DL4A 4ZP8A 1Y00A 3BN7A 4OV6A 4G1QA 3PW0A 1VBZA 2RRNA 2N7YA 2OD4A 3J81Y 1TK5A 4FNIA 3CD5A 3EGNA 4DU7A 3H59A 1REVB 1CC8A 5F41A 3RTVA 3K59A 1VQMS 2W25A 1T05B 1RTZA 5KFWA 1WDTA 5A2QY 1LOUA 3D1HA 5E33A 2HVDA 1VQ7S 4AXJA 2MY7A 4FN5A 1KWMA 2HHXA 4ZP9A 2RHSB 1QE1A 1P1TA 3KWMA 3IFEA 2GQCA 3ADAC 3TANA 4LF8J 2Q6BA 2WRMA 2V8DA 1OYDA 3H42A 4PUOA 2CG4A 3O2IA 3FGVA 3DLBA 4GKJJ 1WTFA 4X4RA 5A6WA 4TQSA 4G3IA 3HM9A 1VIXA 1ZOTA 4LR8A 2ROEA 2ZVIA 3B82A 4QJVA 2L48A 3M8PA 1FI4A 3N28A 2MMYA 2XO6A 2KU7A 3D0GE 1LV5A 1LWFA 1U45A 1OQ3A 1B7FA 3LQVA 1TP7A 2MGZB 1V3RA 1T11A 2FJDB 3OL8A 3IWXA 1NJZA 2EC2A 3RB0A 4LF1A 4HI1A 3IGNA 3O1LA 1JNRB 3OTOF 3QT5A 4ZK7M 4QIFA 3CW2C 3W66A 1B4SA 4KE5A 4EYHB 1ELOA 1TKXB 1LKZA 4EZ6A 5I3QA 3C19A 4CO0A 2GHVC 5B0CA 2E5IA 5CXTA 1NH7A 4NI2B 2O67A 1HWJA 2N82B 5C25A 4DV7J 3FBCA 3D5MA 4ZCMA 2IJNA 3EDQB 1WACA 1R8AA 2E7XA 2IFXA 4X65J 3X1LB 2CPHA 5LSLA 3L4BC 2DNQA 2E1MC 4OYZA 4LSNA 1X4EA 4KTQA 2V9WA 1SL1A 2XMKA 3K2YA 2EK6A 3NGDA 2W9CA 1UFKA 3NS6A 3ONQA 3KLEB 2AYEA 2IVFB 1AFJA 3MR7A 3EVOA 3HSDA 2VFUA 1BY9A 2BRKA 3H40A 2F3JA 2KFYA 5CZVA 4CNYA 4JI0F 2LQBA 5DQGA 2YKAA 1DARA 3SCJE 3I96A 2JX2A 2ZE2A 2GZOA 2AYMA 5I3UA 3L7UA 3F44A 3UI3A 2Z56B 3M05A 1U1PA 2HHHJ 2BKNA 4JV5J 3DRPA 4EGLA 3CJTA 5GADU 4ILRA 2B8PA 2VIHA 2HNZA 2GVZA 4WTYA 1RT7B 3PW2A 3RJMB 4PRFA 4MK9A 3AQOA 4ZN3A 5A8KB 4XTTA 3DLGB 3F0NA 2EFOA 5ETMA 2AD9A 1UPPA 5IS2A 2HSEB 4ID5B 1Q8IA 1WWHA 5IM0A 4QOTA 1GXTA 2KFZA 1FNOA 2QFIA 4ZJLA 1D09B 3VZIA 2XM3A 4TLQA 3BEGB 1WHYA 5IQ6A 1WOOA 4MTPA 4QW9A 5FJ4A 4ZPCA 3DLLQ 4DPTA 1YJTA 5A8WB 2DH8A 2MZQA 2N4CA 1S79A 3D1OA 5H9FK 3TX8A 3VTIA 4B9LA 1KN6A 2R2RA 2ADCA 4IRCA 2Z8QA 5F9LA 1HBMA 2ZBQA 5ETPA 4BLGA 2HHWA 2VV5A 2CJAA 2HS3A 1CG2A 1S7HA 2D3UA 3QT8A 4P71A 2NSBA 4DR2J 1L5UA 2IA0A 2BKOA 1RGVA 2E9ZA 4KH1B 2ZH1A 2OGUA 1RTJB 1U0HA 2XNRA 5DGBA 5HQ8A 5KT4A 1YGYA 5LSOA 1P9QC 4BWMA 3HKWA 1D8ZA 5LMUF 1NK9A 1HQUA 4NZ0A 1UEUA 3ISND 5J2QA 4H4MB 5HVHA 4JP8A 4LF7J 3M8SA 4DR6F 1VRTB 4OJHA 2FZGB 2R7QA 1A7GE 2AGOA 2W9BA 3CMAS 4CO1A 1M90T 2VB6A 3KDNA 2GJ2A 4Y6IA 1K9MT 2QLBB 1R43A 2BYCA 1UVNA 1SC1B 4DV0F 1UA0A 2XB2D 4MK8A 4XDCA 4C11A 2HAIA 4R25A 3CDEA 2FHOB 4K7QA 2LLZA 4M5LA 1NO8A 2FUG9 5C7PA 2MLXA 3R97A 1NEEA 1H38A 1WSVA 1U48A 3DI6A 1FTCA 2E1PA 3IA0A 2R2TA 2UUWA 3VF0B 1RA6A 4EYIB 5CCMA 1AA1B 2GGPA 5DZ7A 3SMZA 2RIJA 1RT5B 1FFGB 2XMTA 2LEBA 1BQXA 3M2RB 3KYLA 3TRGA 2P9GA 3VHQA 1FX4A 3MPDA 3V6JA 2HAFA 1VDHA 3FZ2A 4NLTA 3T9NA 4Z7CA 1VQ6S 3ZXWA 2LMIA 4DSFA 4B3OA 4TY8B 4CQ1A 5C24A 2VD3A 3OW2R 1WC1A 3TA2A 5LXRA 2KJWA 1VYAA 3CT9A 1S7IA 2E7WA 1MMDA 4Y2IA 1EP4A 2JRSA 1RAOA 1CJTA 1WG1A 1JLFA 1S0OA 3M30B 1UJ4A 2FJAB 1XN9A 3T19A 2OPPA 2O5DA 4FPIA 1DLOB 1GMWA 3P45B 4KAIA 4USWA 3D28A 3M6XA 1UJ5A 4ZVPB 4X64J 4DFPA 3CO9A 3TNVA 3GFXA 1LWCA 3E01B 4FF4A 1XNQF 4ILLA 2EFGA 3OFHA 2QZ8A 3UCUP 5J1EB 3K7RA 3UD4P 2HQIA 2BABA 1XR7A 2LXIA 5K14A 4X66F 2KO1A 1MMLA 1N33F 1DBDA 2O1PA 3JTOA 4A8FA 2XS7A 2VJVA 1N6QB 2AZ3A 2HZCA 4OHYA 3VV2B 5BYSA 3CCTA 4P52A 5ETOA 3QRRA 1B70B 2ZBRA 1IKXA 1IBLF 4DG1A 2QSWA 2OHDA 3RBDA 2LEPA 2VZ9A 2PO4A 1FERA 2HBZB 3LP2B 2QA1A 2DNPA 4USKA 1U1OA 1PAEX 1HYSB 3T1YF 5KG0A 4NYPA 4B3SF 3DLHA 2HBYB 3EVMA 4C3KA 1JLCB 2DO4A 2NYIA 5GAEI 5DRKA 3PKMA 3W5YA 1S1WB 1B0VA 2V8GA 3HVTA 4P2MA 5D4LA 1IN0A 2KT3A 4O4GB 3DOMA 5DLGA 2FC9A 2EBEA 1S76D 1Q8KA 2LDYA 2C1EB 3ZZTA 1YJ9S 3DOKB 1YRTA 1S59A 3IGVA 4GVLA 5D3GA 3EXCX 3IR7B 4NMXA 2FC8A 2Q43A 1RWVB 5T7LA 3TUJC 1SC3B 2DKOB 4U6PA 5L8RC 3W60A 1NSQA 1EARA 4ED1A 2OPQA 4QWBA 1LNQA 2HHPA 4P7VA 3HVWA 3GZ7A 3FCVA 2VICA 1S1UB 4LR9A 1AUSL 2JL9A 1FE4A 1T0TV 2H5IB 4CP5A 1GNKA 4TXSA 4FXDA 3VAHA 3NCPA 3CJ5A 4R0JA 3HJVA 5I42A 4AQYJ 3CJ4A 5L1LA 2D69A 2MLYA 1NSPA 3L7OA 2B9YA 3MM9A 3D2WA 3VAGA 4PG4A 3B54A 4GC6A 5J1PA 1UCNA 3QO9B 1IR1A 2AV5A 4X4QA 4Q44A 1FKOA 2GQ2A 2M0GB 1UFWA 2FVSA 1IKYB 5HROB 1HNXJ 4O3OA 4URGA 4ZA1A 1VQNS 1AB8A 1NK0A 3LTOA 3MGJA 5J1NA 3NLCA 5G0RB 4KV8B 1UKUA 2WOMA 3IR5B 1MROA 4OI2A 1S1TA 4MT1A 1LWEB 4MKVA 2EW9A 1F5BA 4LRAA 3WZ0A 1LEOA 2WK4A 3M2VB 4EBCA 2BX6A 2SXLA 2N7CA 2DGOA 2XYPB 3LPEA 2RQKA 2FHJA 3ISZA 3VR1A 4ELTA 3JAMU 2WTFA 2G13A 4IDKB 5HJXA 1MU2A 5KTQA 2B9WA 3E8OA 4F4XA 5L9NA 1CQMA 1U1RA 1JWWA 5AJ3J 2VU5A 3IM9A 3DGVA 1NHUA 4ZVOB 2FJWA 2HW3A 4WU3A 5HJYA 4X2BA 4DFKA 4DX8H 3GFZA 1FDAA 4CT8A 2R7OA 1S9FA 1KTQA 2OO4A 4M1KA 2AJQA 2FHMA 2QYGA 1RLCL 5CH7B 2G0CA 2UVRA 1A6LA 1ZTWA 4PG5A 5KFOA 3GB0A 2B5JB 4CH7A 2ZHOA 3UVJA 3IR6B 4YOEA 3QT6A 1XC9A 2L9DA 4ECUA 1RISA 1X5PA 3A3PB 3QGGA 1HWKA 2AP6A 1DQAA 2GW8A 4RNNA 2EFPA 5C42A 3T6JA 5KFNA 2HFOA 2RU9A 5B7WA 1N52B 2YY3A 4F7VA 4B17A 2R4FA 2B4VA 1LXNA 2DY1A 3BSNA 1WKLA 4XPEA 4HTIA 1KFDA 1N88A 3TX0A 3CCRS 2A1BA 4YN3B 2CADA 4WU2A 1U2FA 2PA8D 5DZ6A 3PNIA 2UU9J 3V5RA 3J80U 2XWXA 3T1HF 2AX1A 3DU5A 2AQ4A 2HNDA 2FYXA 2QLFB 3MXHP 4J91A 1LW2B 1ZM4A 1VJWA 2RKIA 2BQRA 2PN6A 2XHCA 2UZAA 4I0WA 2DPIA 2LDIA 4OYOA 4ECZA 4KR0B 1EKSA 2XS5A 5CYMA 2DR6A 3MCMA 1DHMA 1XK8A 1XJWB 1TTHB 5J2NB 2R2SA 2BRLA 4KHRA 2HURA 3AD8C 3CJQA 1QD1A 2VC1A 2OKQA 3QGPA 2LYVA 4NZ6A 4NXNJ 1CLFA 1REVA 4OYPA 2R7WA 2CPEA 4FNHA 3GJSB 1T05A 3KHGA 4ANCA 5FLXU 4LIRA 2I8EA 5KG6A 3DN9A 3T5KA 4CLYA 1WC6A 5IC6B 3R7BB 1IR2A 4RW6B 1SH3A 2DRBA 5KFFA 3H98A 5KFLA 1NDCA 3PHEA 3KHHA 4NYOA 3MWBA 2B7CB 2FIUA 3A13A 2Z2MA 4HT5A 3PX0A 1BC6A 2EI5A 3BQ1A 1FE0A 2NXUA 3MEDA 3S01A 4DV3J 3BSAA 3B4DA 1HBUA 4PXCA 3PFEA 2MQPA 1X9MA 3D4JA 2F63A 3VVUA 2RILA 4CO5A 1J2VA 4MKYA 1L3VA 3ICLA 4IYQA 2LXFA 1RT4B 1NKEA 5DDRC 2CXEA 3LWLA 3DDKA 4NASA 4X84A 3ZO7A 4QR2A 1H3DA 4KO0B 1AZSB 4FYXB 4YDXA 1WG5A 2YKQA 3KLHA 2COLA 5LXYA 5I3PA 3I9V9 3PYFA 4LSLB 3MD3A 4Y0FA 3C6TB 2BVZA 4NCGB 1CSJA 4EI2A 3DU6A 3PJ9A 3N5FA 4F4AA 2Y1JA 3E51A 4N5SA 3D6TB 4QBUA 4F4YA 5HLFA 2YQ3A 3MTJA 3UDEA 5CYJA 4LBPA 2QL7B 3C16B 3MCOA 2DNOA 1CC7A 5M2UA 3DRRB 4NI2A 3TUIC 4DQRA 1U47A 2ZOMA 3I31A 1UETA 1Z4UA 1FJCA 2H54B 1OMSA 2UVUA 3GQCA 3VVTA 3POTA 4ZS6A 4MJKA 2VONA 4MKAA 1ZZFA 4LIWA 1AFIA 4QYZJ 2OH2A 3HHEA 4CIOA 3C3LA 5E2QA 5L1IA 3FSXA 1L3TA 1XWLA 3MUTP 2HGLA 2ZM6J 3H2VE 2Y1LB 1H72C 4HDHA 4YB5A 2QL9B 2C2RA 3IWNC 1Y5NB 1CEZA 2E9TA 4KPCA 4DL2A 3FK4A 4PWUA 4Y65A 3RB3A 3MEEB 4ED2A 4Q5VA 3KK2B 3EZUA 3MUMP 3RR7A 4RUBA 3HMJG 2MKYA 3EYZA 4WFZA 5E41A 2CIMA 4YFUA 2J0QD 4RL1A 3M8ZA 4DV4F 3H5UA 4C8LA 2HHTA 2BE7D 4RNMA 2R8JA 3D6MB 4DL5A 4KPYA 2JEIA 1RT7A 1Z2ZA 4M94A 4K4ZA 2R8HA 5DO2A 2DR5A 1Q16B 2K1RB 5A8KA 2C2OB 3DLGA 1PGZA 4EWTA 3N79A 4FYDA 1GMWD 1RXOB 3IM8A 4DL6A 2CUYA 4NXMJ 1VC0A 4ID5A 3KUEA 4DR5J 3RBXA 4WKRA 4DX7A 4NOHA 4NLGA 3PJWA 1GTEA 2CAJA 2BJ7A 1TL1B 4ZDNA 1T9WA 3R3TA 1X8DA 4HHUA 4KFBB 5A8WA 1MWQA 1UVLA 2IHR1 2WVEA 4K59A 4MMOA 4RBUA 4WTOB 5KFPA 3D6FB 3CSKA 2RQ4A 4ZPTR 3TO8A 2FLNA 4K2JA 1PYOB 2WCXA 1NK6A 2WBMA 4MKBA 1Q81T 5KFBA 1WC0A 2PGCA 4C2MA 4V19X 4ZLJA 1KDNA 3Q23A 2PFFB 3RUBL 2A2CA 2B4PA 1RB0A 1G3OA 3BQ0A 3MTKA 2DGWA 2RRBA 1RTJA 2JJ4D 5B0FA 2XMAA 4P73A 5HQMA 2OEKA 1KVKA 2MQOA 3PDNA 1UWAA 5KFSA 1RT3B 5SUHA 1SVDA 4H4MA 1SXLA 3TVZA 5BR8F 1S10A 3VAFA 3BPDA 4N7TA 4HHHA 4KB7A 2EFQA 4DFJA 2W7AA 2ZEJA 1S1VB 3H20A 3GWCA 2MSSA 5JJBA 4P2SA 3C2PA 3ZZRA 2J7UA 4M5JA 1FDBA 4TU8A 2E5LJ 2LQJA 1L3KA 2CA9A 1VBYA 2HFVA 4ZHRA 4YQWA 1IBKF 3CD6S 2V34A 4JOUA 3ZZ0A 3MR5A 3O8WA 5AE3A 3TJ8A 1OY6A 1YBAA 3MFIA 3H5SA 3OL9A 1GH8A 2G2OA 2BQUA 2WB4A 4KYZA 3KLIB 4J9LA 1IKWA 3M2RA 1QUPA 2FVCA 2Y9HA 1KFSA 3UN3A 3THTA 1SKSA 3HVRA 1RTDB 2QC3A 1WELA 5GAHI 3TYTA 2VG7B 5LM7E 4JI5F 2KVQE 2QGFB 5K9FA 1YRUA 3AY0A 2RJZA 2G1HA 4H4OA 4A48A 3JQJA 2J8SA 2P2CB 1HHTP 1HI8A 3AQPA 1UPMB 4ECYA 1VOMA 1WI8A 2A10A 3D68A 5F8GA 1DZ5A 2ZOGA 2YKNB 1URRA 4LF6J 2IM3A 3N6NA 3M30A 3ILIA 3WHIA 1DLOA 4YDDB 3A12A 3DMJA 3W8PA 2R7XA 3KHRA 1SQFA 4ZPBA 4UOCA 4WE1B 4OX7A 3UD3P 2YX1A 2VFVA 3X3UA 3O44A 4USJC 2XC9A 5KAKA 2EG1A 2W2NP 1RYRA 4HVZA 3M1VB 3E01A 3JTPA 5D77A 4A47A 5DS7A 4LT6A 5AXKA 4DL7A 1BLUA 5E3AA 3V4IB 4FS1A 3FQKA 4J9MA 1S9GB 5J1EA 4PR6A 2FHJD 3AOCA 2IYGA 2X1BA 4LRBA 1QDUB 4J9OA 1Q86T 3EX7B 1N6QA 3JAMY 4UT4A 3MPYA 1DURA 4D3HA 1XMQF 1YJNS 4DR4F 1VMBA 1FNMA 4J9QA 2B4OA 3BJYA 3P5TL 3LP2A 1REGX 5LMNF 2YVSA 1FK9A 3KNAA 2GO9A 3FCWA 5B0BA 3BREA 1FVSA 4J9UE 2GCFA 1QUVA 4QWAA 4YUDA 1VFJA 1HQ2A 4Z37A 4CTAB 2RUGA 3R6LB 4RPFA 2PDAA 4AL7A 1OPIA 5HP1B 3JQMA 4O4GA 3G6ES 3UDVA 4QIEA 3J7YU 2XMWA 2Q6CA 2ROGA 3J7AN 4G1IA 5A8RB 3MFHA 1EETB 4FKXA 4AE5A 4ED3A 3J81j 1C1CB 1NK5A 1B3TA 4F50A 1C0UB 4MAKA 4YS2A 1NHVA 2DH7A 2VBWA 1UW9A 1ITPA 4K4VA 3KLVA 3GYGA 1N36J 3IBWA 1OWXA 1VLOA 2F9DA 1IBMF 3PW4A 1T7PA 1SJ4P 1S1UA 1R27B 3GG1A 3J80Y 3KJQB 4ZP7A 1G7CB 3Q2SC 2NR0A 5F3ZA 4OHXA 3WDOA 1ZAWA 4OI4A 3CJ3A 4ICLA 5BYRA 1Y5IB 2Z2LA 1D8YA 3AT1B 3VZHA 4YY3F 1RWNB 2XQCA 4HDGA 2B8QA 2FLLA 1BXNA 3OBIA 2HQFA 2PIIA 3MM6A 4E0DA 4DEZA 3UE2A 3GCWP 3A3NB 3QO9A 1HNZJ 5KT5A 2JDJA 1NRKA 2V2KA 3K5LA 3DRSB 2JVRA 1IKYA 3PJXA 5HROA 5FLXY 3W64A 1RWMB 2E9RX 2QA4S 1VQLS 2AMCB 4AL5A 3KOAA 2RVJA 2DXEA 2U1AA 5G0RA 2ZH4A 4B9TA 1HR0F 2JC1A 4ZVGA 1QE1B 2H5EA 4CCHA 1LWEA 3OR2A 3MOJB 4PG8A 4K8RA 2HFNA 2ZBPA 3W3SA 3DDNA 2PE8A 4PUOB 1YZ7A 1HNIB 4M5MA 3NKYA 3PVXA 5ETVA 3JSYA 1S6QB 4WWSA 3G9CA 1YKWA 2BV3A 1AW0A 4WCEQ 4IDKA 4PG6A 1AROP 1RI7A 3DLEB 2BJ8A 1LW0A 2UUBF 3OTDA 1TK8A 1NJYA 2J5AA 3MPVA 3FMBA 1HNWJ 5GMEA 5HANA 3DRXA 1SJFA 1RTHB 4KGZB 1KQSR 3HPOA 4JV0A 4LSZB 3M8PB 4OZ2A 3PKYA 1N4LA 1RDRA 1FDDA 4WFAQ 1EIYB 2MZTA 1NHKL 2CQ1A 3PYDA 3LPYA 4LBHA 3QFWA 3SYZA 2B5JA 4MIAA 5IOLA 2K8GA 3P5BP 2ZH3A 2BANB 5A76A 1H73A 3I55S 4TN2A 1Q82T 2GX8A 4DV5J 4LF4F 2JLEA 3M9OB 2HQDA 3I5CA 1T02A 3PG9A 2UXDJ 1ZAVA 3M8QA 4NMLA 4O3NA 1TQLA 5ETRA 1VC5A 3BDPA 1FRJA 2VPWB 1J5OB 4PEOA 4YR0A 4QWCA 1NPPA 2VFTA 1CBKA 3G82B 5IXUA 2V2VA 3MEKA 4NL5A 3LUYA 3N6MA 4ED4A 2BEFA 2VDIA 3DLKA 4J9PA 5E3RA 4JI1F 4ALZA 4LSNB 2B7BB 3CD7A 3I0SA 2GVDB 2W9CB 5I4MA 3MM5B 2GQQA 4ED6A 3EPIA 2MKJA 4CRJA 1U4BA 3O5TB 4JI2F 3CVKA 3PXGa 1R8HA 3DGPB 2BMBA 3KK3A 1LW2A 2V2ZA 2XTJP 5KFYA 1ULRA 4C98A 2M2BA 1X0PA 2M7SA 2EK1A 2ZWOA 4F0HA 7AT1B 3W61A 4JI6J 3QQCD 2HMIB 6AT1B 3Q8PB 5J2NA 1VQPS 2YNFA 5ETLA 3EGVA 1UZDA 5I3UB 1TELA 3HXMA 4WYLA 3MURP 2VOOA 4LFCJ 4QU7A 4Y2MA 3DRPB 1IM4A 1BQMB 3G6XA 2QIFA 4JYAJ 2E7VA 2YWHA 2W4DA 4IG3A 4DR3J 1J5EJ 1M5OC 4DN0A 3OLBA 2P5VA 2BBEA 4I68A 5K8MA 3W2VB 4RW6A 4ZIWA 5ETQA 3ZNUA 1HW9A 3CULA 5J2MB 3HP6A 3FBFA 3UDCA 2DGUA 2BXJA 3GFHA 3KXDA 3FZBA 3Q8VA 3Q24A 1SIZA 1UP1A 4KY3A 5F9NA 4L3NA 5D4NA 2QMUB 5D0HA 2VODA 4F4ZA 3BV8A 4W4MA 3RYLA 2M9KA 2YWKA 4KGKA 1RT4A 5KFGA 2W7PA 1MSWD 3GTYX 1HBMB 5CZXA 2ILYA 2JVOA 4LFBJ 1TL3B 2BM1A 2W7OA 3A1YG 2V4QA 3ISNC 4J9RA 3H2LA 2G4BA 4OZ5A 2DGTA 4QIWD 2ZKTA 2DR8A 3PFOA 2W4PA 2HKEA 1TFWA 5D4PA 2B56A 1Q1KA 3MD1A 1M1KT 2PT0A 4OI0A 3H2UB 4LSLA 3D0IE 2HQGA 1SV5B 2J8AA 4TU9A 8AT1B 3C6TA 4F25A 4NCGA 4CDIA 1RHQB 3M2UA 3FMWA 4DV2J 1F60B 1G1XA 3NAHA 1JXEA 3CC7S 1HQUB 5A6PA 4B9MA 4DCJB 4RX6A 5CHCB 2WZ1A 4I2PB 3R27A 5AXLA 4I2QB 4LF8F 1RHMB 3C16A 2JEFA 3QGIA 2W9BB 3OTEA 1PG5B 1GX5A 3DRRA 1X4DA 1H7WA 2KTQA 3RRHA 4GKJF 4JUZA 3AXMA 2CPZA 1RSCA 2FJEB 1R8CA 4NLUA 1WKKA 2FY1A 1T9VA 5HSPA 1H0HB 2DR7A 4B9SA 2R2UA 3UR3C 2IBOA 2XLJA 2HZVA 2OPRA 1TL5A 4W98A 4UUWA 3FEXB 1SKWA 3U27A 2XNQA 2Y8WA 3BO3A 3MEEA 4ZLPA 4ZVUB 4DQSA 1YBUA 1MW7A 1RA7A 1SUQA 1B0TA 2B9XA 2AHOB 5EWFA 4URSA 4FBUA 4DUTA 1K1QA 4QYZK 1JLQA 3QT7A 2ZH5A 2WAQD 4BCAA 2MKIA 5C24B 2AJ0A 4PAAA 3Q8YA 4C8YA 2K1RA 4DV7F 1EP4B 4OJ3A 5H9EK 2CFXA 4X65F 3N0VA 4S0MA 3HSZA 2AJ2A 2DHAA 5CYQB 3UFCX 3V81A 1TL1A 1Y5LB 1TV6B 1WOSA 2HRXA 1Q7YT 4X4SA 2JOQA 4KFBA 2V5HG 2XLKA 5AXNA 2OFGX 4RU2A 1RCOB 1TUVA 2DB1A 3KJVB 2CJ9A 4DXLA 4R5PB 1N5QA 1H2TZ 4X4NA 3EUNA 3G8SA 1CJVB 3GV5B 1M1HA 3UCGA 2ZC4A 1VQ4S 3K5NA 2FVRA 1S72S 3L7PA 1NK7A 3C6UA 2HHHF 4JV5F 2E5HA 2MQQA 2C2DA 5KOXA 1UZHA 4OHVA 4OZ3A 3RW7A 2U2FA 1QAIA 2AIRB 2J6SA 4A8OA 1RAGB 1EAYC 1C0TB 3C14B 3CO0P 1RT3A 3CJRA 3R2CJ 2RRAA 4HH0A 2BR0A 2ZFHA 2VFSA 3JTNA 4KGMA 3IBCB 1APSA 2IM0A 3VALA 1RE1B 1S1VA 1D0EA 1VK3A 3BH7B 1TKTB 5AXMA 5HQLA 4O44B 1R7IA 2NYHA 5D0EA 1K47A 4ZCIA 3MM7B 4LF9J 1FF2A 2M4MA 4L73A 1IQZA 2DISA 2KG0A 1IVZA 3US5A 3TP2A 1T3OA 2HBRB 2R3VA 4RBVA 3G8TA 3TA1A 4DR2F 3BN4A 2M8DB 4GKKJ 1A9NB 2ASYA 1WJ9A 1X4FA 3ZZYA 1GFWB 2UXCJ 4ES3A 2BW7A 1S12A 3KLIA 1KSPA 2KFNA 3EMTA 2D3O1 1RHKB 1FXRA 3PYGA 3NMAA 1RLDA 4C7QA 4DR1J 4A8WA 2MQLA 1FFSB 2WSFC 1RBOB 1S48A 1RTDA 5KFAA 2VG7A 3VWSA 1RUSA 4KHPJ 4LF7F 2CQ2A 4CWBA 4IR1A 3BO2A 5IT0A 3MM9B 3IBFB 2DD8S 2WBRA 3LAKA 5IT4A 4K5SA 2CNLB 3VQTA 2YKNA 4LJMA 2VHGA 2XMMA 2MTLA 1RAHB 1KVJA 4MIBA 2PI5A 4WE1A 4IRKA 2C2MB 3ZTQA 3AA9A 3CCWA 1IM6A 2RS2A 2WOMB 4RWXA 2ATCB 3M1VA 4YB7A 1MROB 1S1TB 1N32J 1S0MA 3V4IA 3OR1A 3SQGB 2CQPA 4CYUB 1S9GA 3N01A 3QBCA 3L95X 3CCUS 3HD2A 5IZHA 3LP1B 3B4MA 2J7WA 4Q2LA 2HFZA 3KG1A 4DQQA 2YH0A 1F2GA 1QTNB 1NB2A 1UFLA 1IJEB 3SV3A 6FDRA 3GSIA 1X60A 3EDRB 3TAMB 3FRYA 1GXUA 1FRKA 1TU0B 3FEZA 3NG8A 2C2EA 1NCLA 3FEYB 2P6TA 3MZIA 3GYNA 3CUNA 2Z58B 5DDPC 4ED8A 2HBQB 1FJGJ 1HMVA 4IH6A 3MCSA 2HRTA 1EZZB 2XCPA 2Z0GA 3MMBB 1TKZB 3CJ0A 3THPA 3CNQP 5HVFA 5HP1A 1S97A 1GMUA 3KLGB 4CLKA 1RT6B 1QM9A 1X4HA 2FVQA 4DI6A 2HPUA 4N8OA 3K5MA 5A8RA 1YZ6A 4O3PA 3U7JA 1EETA 2AKWB 1T9UA 4I4BA 4RNOA 1ZA2B 2NCKL 1SKUB 1H7XA 2IBKA 2YKOA 1WEZA 1VJQA 1HQEB 4KH0B 3T1HJ 4W92B 1FRXA 3BKTA 1FRMA 3AAWB 5F8JA 2DEIA 2DIVA 5BXIA 2V68A 4WP8A 3ZTOA 2CQ4A 4CI0B 5DDQC 3IP0A 4WZMA 4K4WA 3VAMA 3OVSA 4IRDA 5JXSA 3WX8A 1ZPWX 2RKIB 4YR2A 3H5XA 4PG7A 3SIPB 1LFWA 2WVBA 3NL0A 2K06A 3IAS9 3PRVA 4ECXA 2HIYA 2XY7A 3PR4A 5FIIA 3B78A 1FKAF 3W9IA 1DY3A 4B9NA 2RQMA 1IJFB 2XLIA 4N76A 4Q0BA 1IQTA 4I1TA 4U7UD 3OSNA 4U8YA 2R9LA 3OPKA 3VGTA 4JI4J 1WORA 1XQIA 3DRSA 4JV2A 3CIMA 3SCLE 2W4CA 3IG1A 5BYQA 1U0SA 1S6OA 4X4OA 4IKAA 1DAXA 2CPYA 4PKDB 1Y4ZB 3MEDB 2GHWA 2CQBA 4QZVB 4WXOA 2LP4A 1HNIA 2IRXA 3QAUA 1HBUB 1RBAA 2F5GA 1S6QA 5DGAA 4OYWA 1BE4A 4AQYF 2R42A 2FJXA 3TZWA 3DLEA 4M5DB 4Y2KA 1RWOB 1FRHA 3NOGA 5L38A 2ALYB 3LANA 1DQ8A 4A8SA 2VQEJ 4KGXB 1RTHA 2IRYA 2RS8A 2J9CA 2M88A 2NSCA 2RAQA 3EZOA 3OV7A 2P6SA 4ZVFA 1U09A 3KLHB 1NKCA 2DNMA 1P27B 2KZZA 4DV1J 1SB6A 1HNXF 4BHQA 4KBIA 2UXBF 4WJBA 2CQ3A 3HHKA 1X9WA 3CC2S 3I4PA 2BANA 2RDIA 1H2VZ 3TQEA 4M5IA 3QRPA 4M63A 5HLFB 1FX2A 3FNNA 2G0IA 4OFZA 3LGHA 3FKBA 3BBBA 2MQNA 4FZVA 5KG1A 2ATLA 1EHWA 2ZKUA 2OP5A 2V67A 1U1NA 1J5OA 3I82A 2VJUA 3QWPA 2I5JB 3CCES 4DZ6A 2C3MA 3G82A 2IM1A 1JIHA 3TW0A 4TYAA 5KFCA 2CQDA 3VAJA 1PJ6A 1K73T 3LGNA 1CS4B 3KJNB 2EEYA 2N3OA 2QRRA 1FWPA 3I32A 2NPFA 2ERRA 2I1RA 2K2PA 4AYBD 5B0EA 3EGWB 2DXDA 3POTB 4YHHF 2GVDA 4ZVEA 3MM5A 4WK3A 5GAEU 1EQMA 1S0VA 3MAQA 4X4TA 3ETOA 3K8WA 1Q78A 3BZQA 4RR5A 3DGPA 1KC8T 3MMAB 2HQCA 2V94A 4J9NA 1N8RT 1YHQS 3W8GA 2DNYA 4MFBB 2K3KA 3NCRA 4LVNP 2KT2A 2Z2YB 3G87A 1SCJB 1HWUA 3GJQB 1PSDA 3HLUA 2O66A 2RUSA 3G6YA 2HMIA 4IOAQ 4CO2A 1OQ6A 2DIUA 4DV4J 3RB4A 2HS0A 2VPXB 2GV1A 5RUBA 1WUUA 5E5NA 3RR8A 1HWLA 3QSYB 4I6WA 1VK8A 1BQMA 2MJNA 4F0KA 1ZZNA 3GR1A 3WC2A 3P96A 3ZFVA 1FJEB 4USIA 2ZDOA 3W2VA 4JI8J 2F65A 3VAKA 2VUGA 2QMWA 3BF4A 4FYWB 5J2MA 3SI8A 2UU9F 2CWKA 3CEDA 2AJFE 2GIQA 5DG9A 1YVFA 2GIFA 2DHHA 2OELA 4B3RJ 2GNKA 1L3SA 2FGOA 4C8NA 3K5OA 1BMQB 4GVBB 3R9LA 5DM6Q 2D9PA 1TL3A 5KG2A 1HHSA 3BGOP 4UZCA 3DRYA 2JC0A 4NXNF 1CVJA 4FF1A 3PM9A 2AJ1A 4F67A 4DSEA 4FYYB 1SV5A 1RWUA 4O3RA 2PEBA 4C48A 1KONA 3VGUA 4UY85 1RJJA 2MZRA 2NXNA 4JI3J 1LQ9A 4ERDA 5LT5A 3W5XA 3OQ2A 2ASLA 2Q1LA 4J7CA 4I2PA 1VHIA 4I2QA 2ZD1A 5B0GA 4DV3F 3IWLA 3QFHA 1M5VC 5LJ5Y 3VQSA 4ZLLA 3M6WA 1FHTA 3M9NB 3PCOB 3SDEA 3KTQA 1IBKJ 5LOQA 3S7RA 2C28A 1NSKL 4P9SA 1LWXA 3C15A 3I4HX 4FVMA 3R8YA 1WEXA 1VCTA 1MWYA 1JLEB 4L6V3 2R7RA 5HO4A 4ZHRB 3TI0A 3EE3A 5F3TA 4DDFA 2XG8A 1PYTA 2ASJA 4KIAA 3BPSP 1H2UX 2FVPA 2X51A 2CJBA 4WFNQ 2KHDA 4USVA 3HHDA 5LL6d 3AJDA 2XEXA 2KZMA 1VI7A 2EC0A 4HYKA 3PTWA 2VPZB 1RT2B 1IKWB 2J7KA 4FDFA 3P3DA 4ZPVR 1YTYA 4CT9A 1X5OA 3W62A 5GVQA 4PQAA 1HBOB 2Q66A 3ZTSA 3OSPA 4ZKAA 1HW8A 4Q8FA 1TVRB 3BO4A 1E6YB 4WFYA 4H4OB 1S6UA 3PO4A 1GEHA 3CCJS 4NLRA 1UVMA 2XHWA 2ZH7A 1VHFA 3E3XA 2DGXA 2RH3A 2UP1A 2UUAJ 2NXCA 3A8KA 3BGLA 3NGTA 2QX0A 2XSJB 2WVCA 2VG5B 2DNLA 4BDPA 4LF5F 1T3NA 3DMJB 5CYQA 3OHBA 1R0AB 1G2EA 1TV6A 3KNGA 1W2IA 1I5OB 2LQ5A 2KM8B 3OL6A 3ULHA 2HRYA 3B6BA 3M32B 3GE9A 2ZM6F 1N48A 2GHPA 3FSYA 1WHWA 1HIYA 1WSRA 4OL8A 2I38A 3KJVA 1CJKA 4R5PA 1Q53A 2HVIA 3HULA 1CJVA 5KFUA 3T1AA 2Y1IA 5ETNA 4AXIA 1N34J 2I9SA 3NGKA 5LMNJ 4ZIVA 4I67A 3HDSA 2XY5A 1XBWA 3SSSA 1Y9OA 2EWHA 4YB1P 1HNVB 1FK9B 1C0TA 3C14A 1CJUB 2DT9A 2L41A 2XMUA 1GK8A 4HL9A 3SSQA 4OHZA 4WIIA 5IC4B 1KOOA 1X0FA 1VRUB 3HJFA 2KN4A 4K4XA 1TUWA 1UVJA 4RLEA 3GILA 4B9VA 5F0WA 1SJRA 1TKTA 4OYMA 1TL7B 1PC4A 2IAJB 3R5JB 2EBGA 4O44A 4A8YA 3M7VA 1GX6A 3R5GA 3JXOA 4DUZJ 3MM7A 1C1BB 5D4OA 2ZNYA 1CQNA 3TJAA 2FD2A 2QL5B 4OZNA 5KG4A 3BGFA 1RHRB 4LFAJ 4DQIA 2FJVA 4C97A 1N5YB 2NZ4A 2G1DA 3QNWB 5E3PA 3NGRA 5CD4A 2DH9A 3OFEA 5A0YB 1VRQC 5ETTA 2FPHX 4RZRA 3BBFA 5CQGA 2JEJA 2CQCA 4CO4A 4XIUA 1VBKA 1GXLA 1F9EB 3QSIA 3NS7B 4B3TJ 4AT1B 3CE8A 2ZH2A 2OSQA 1XERA 4ICLB 1FFWB 1B64A 1Z1ZA 4LRDA 2MHNA 5EDWA 2OJ3A 1I94F 2V63A 4C3MA 3I9ZA 4GO5X 3MM6B 4LQ9A 4FS2A 1F3VA 2EVZA 3HZGA 1WNEA 4DS5A 2DNZA 5SZTA 7FDRA 3V6HA 4O0IA 4V1Ak 2E5LF 3QJLA 4G65A 3IC1A 3I87A 4K4TA 1PO6A 2E66A 2LXUA 2CQIA 1KHVA 1TL4A 1TMMA 3HT3A 4J9VA 3A8IA 3OR2B 4URQU 3SQGA 4CYUA 1PAUB 3P49B 3OXLA 3UWTA 4IR9A 4X4UA 3EM1A 1JLBB 3LP1A 4C0OC 5THWA 3MDFA 2OTJS 3NY0A 1QAJA 1VQ5S 5L39A 4MIWA 1B7YB 3AD9C 1NMEB 4DPWA 4KSEB 2J76E 4F3MA 4NRTA 1LW0B 2DJWA 3M9MB 3BGRB 3D0HE 3GJTB 3TAMA 3R5AA 4TQRA 5HMWA 1U02A 1NJWA 1AYEA 5JMNA 2XMJA 1QLNA 5D8HB 4DBQA 5GAGI 5KFXA 4QIGA 2NZCA 4A8XA 1SL0A 4UOHA 1XNRJ 3M6VA 5D0GA 2AEFA 1VGYA 5DQHA 3MMBA 1TKZA 4ILMA 1P8GA 3FCHA 3MUVP 5E3QA 4ZPDA 2RQCA 2DHSA 4OYAA 3KLGA 1JXVA 4QR0A 1RT6A 3NWGA 1FNXH 3M8QB 1UMJA 3UCZP 2NXEA 3DYAA 2VQFJ 5KFJA 4X4PA 2W24A 5HI7A 2AWZA 4H54A 2OEJA 2YXLA 2QA2A 5JUMA 4RW8B 1X31C 2QMXA 5ADZA 4P75A 2NREA 1SQEA 1HQEA 2KB2A 3I0RB 4H4KA 1S1XB 3DLKB 2WSEC 4UY8T 1NH8A 4JI2J 3ELHA 2RD5C 1MLAA 3Q2TC 2XULA 3I0SB 1E6VB 3O3LA 1FEHA 2N3LA 3KK1B 3SXLA 1O5JA 4I56A 1RKJA 4JI7J 3GIKA 3KK3B 3HD1A 4U95A 2RE1A 3CMQA 3K89A 1W26A 1TMJA 3KDOA 4LREA 1SH2A 2ZUAA 2HVZA 5FDLA 3MR6A 2V6AA 4WYWA 2YNFB 2OD6A 4MH8A 3AH6A 3QIPA 4RNHA 3K0JA 3N5BA 1EKRA 3U1MA 4KJIA 1U6ZA 4XPCA 3CF5Q 2EXUA 1DFDA 2F8EX 2FLOA 1HWIA 2J9DA 1FO1A 2WVDA 1V6HA 4IG3B 2V9KA 2J6TA 4LBIA 4B3MJ 2UVVA 2FTRA 1OS5A 4OQJA 1HPZB 1QAYA 3CXCR 4Q45A 2OPSB 1N36F 2G0JA 3CB4A 5HAOA 4ZVRB 2QTWA 1OIAA 5GAHU 4WF9Q 2UUCJ 4NX9A 4ECWA 5HMXA 3ILLA 1IXKA 4OMFG 4DZDA 1M5KC 3GYXB 3HVAA 4X62J 5KG7A 4DQPA 4OI1A 3K57A 4IFYA 1WC5A 2R7SA 2ZDPA 2KXNB 4M5DA 1KVIA 1WKJA 1QY7A 4EZ9A 3EJMA 2F4VJ 1FXDA 3CWJA 4DFMA 1XMOJ 2CG8A 1FRLA 2KHCA 1NK4A 2LU2A 4LUBA 3AFGA 4I6YA 4M95A 4D3GA 2CDQA 3QRQA 2V4JA 1DTTA 3PYEA 1HNZF 3EVWA 1D9FA 3A8EA 4I6AA 1S5ZA 4IOBA 2DPJA 3M2UB 4YB6A 5E0OA 1VQYA 2Y3YA 3KUHA 2H65B 2C42A 4OYIA 3LGMA 4OYXA 1SH0A 3UR0A 1HD1A 3NNHA 5HBMA 4IG0B 4DWIA 1JLAB 2I5JA 4FVCA 1U8SA 2KDOA 2QLWA 1F1BB 4MK7A 4ZVSB 2X1AA 2AYBA 1CS4A 5EWGA 2KI2A 4F36A 4F8RA 5E3CA 3EGZA 4K0KJ 5F8HA 1FA0A 2ABYA 1RAJA 1VR6A 1R3NA 4PXBA 1I51B 2ZZMA 3J7Z5 3EPGA 3A3OB 4DPXA 1HNWF 2NS1B 3AD7C 3ILOA 4WIQA 1AXQA 4F3OA 1YIJS 2MZSA 4DF8A 3MMAA 3G6VA 4J9KA 3C46A 2OTLS 5JVHQ 4MFBA 4B9UA 3G8QA 4CNZA 2OPRB 5H9EJ 4KT0C 4O4RA 4J37A 4R8UB 3LH2S 3SCKE 3PX6A 4ZN1A 3TZZA 1QAXA 5HN0A 4DV5F 2GS5A 2BM0A 4O3QA 2IA6A 2UXDF 1SUQB 2KM8C 3UW1A 4CH1A 2EW0A 1MNEA 2KG1A 3LALA 1JLQB 1RCXB 3AOAA 4NLOA 1U24A 2ZBCA 4BC7A 5E7OB 3CCVS 3MMCB 1DQ9A 4A8KA 1R89A 1WC4A 3MAHA 1JB0C 3HFKA 2XBPA 1MN7A 3P8BB 3CDAA 1T8EA 3S6EA 4EO8A 2ZOFA 2GMJA 2K3IA 1YLXA 2ZJQQ 3MR3A 2W2QP 1XIQA 3WIVA 2H1YA 3N4WA 3V81B 2A18A 4NLPA 4DPYA 2X3GA 2DGSA 2PMWA 1BHNA 3OVBA 4ED0A 3WX4A 2XZTB 3PRBA 1Y11A 5D6GA 4Z7YA 3SCIE 1WD6A 4GVBA 1KQFB 2CYYA 2CZVC 4QW8A 5IWAJ 1GTHA 5CABA 4JI6F 3TAPA 2LVWA 3TZYA 2ZITA 4DR7J 4K5RA 2R8GA 1ZM9A 4FYVB 4KKOB 4LFCF 2UVWA 3C6UB 3H90A 3H0PA 1N0UA 3A4TA 1U2RA 3BR9A 2YX7A 4CLFA 4JYAF 3U02A 4OJGA 1ZM3A 4DR3F 3Q8RB 1J5EF 4ZLNA 1IWAA 1SJQA 1ZAXA 3MF5A 4CO3A 5DLFA 1CULA 4C8ZA 4ECQA 2ZZTA 1U7LA 3UQSA 3QZ8A 1R0CB 2MZJA 1N54B 2HIQA 1FESA 2HZAA 1JJ4A 4NCAA 4AFFA 2MPUA 3V6KA 2VA2A 2DNKA 5EX0A 2C22A 3S8SA 3PO5A 5T41A 3CJKB 2L9WA 4N47A 4C0BA 4HEA9 4ITSA 2VKZG 2VH7A 2FY8A 3MHYA 1VLYA 4PWDB 3HFZB 4OX9J 3FBEA 1YITS 5B09A 5HK4A 4ZVQB 1K44A 4LFBF 3KLFB 4DLEA 1JLEA 4N8NA 3IO1A 2IMOA 4CM2A 4TU7A 1T9YA 4QR1A 5L46A 2BJ3A 4ANDA 3LO3A 2HWHA 1SKRA 3QLHB 1KEKA 1X4AA 2B6AB 2MEWA 4DV6J 3KJFB 2CPFA 2CQ0A 2D41A 1RT2A 2EPIA 3JSMB 4DV2F 1KNZA 2YNIB 2HG4A 1HBOA 2JLGA 1FDNA 1H98A 1QVGR 1FRIA 1KQKA 1S6PA 2VC0A 1TVRA 1E6YA 5KOWA 3QZ7A 4DL0C 1S57A 2CJKA 3OTBA 2E1CA 1FTRA 2XWYA 3WC0A 2A6MA 3DHXA 3NCQA 4K4SA 4OIXA 3N6LA 1QVFR 5KT2A 1YJUA 2KRRA 2QT7A 2OFHX 1KR4A 1U49A 3RAQA 3P6YC 3MM8A 2XSJA 4UOGA 2VG5A 3R7SB 3D9BA 4UW2A 1X4CA 3CIZA 4ZPAA 3EXYA 1R0AA 3Q22A 4PXDA 2AEJA 2K7JA 8ATCB 5F8MA 2ACMA 2M8HA 3M32A 4NYZA 4QYRA 4C8OA 2FHKA 3D67A 2XMVA 4X4VA 5KT6A 5EX3A 1YQHA 4IFVB 3OR1B 3CC4S 5D0RA 2HLUA 1N5SA 3RAXA 2KRBA 4CLZA 3PIPQ 4DUYJ 2A6OA 3CDUA 3V4MA 4LF2A 2ZBIA 1JKHA 3SFGA 2IC3B 1S0NA 4U7UK 3NNAA 2R7VA 3I5BA 1KP6A 3NS5A 2H51B 3PRDA 4F2RA 4XK8C 3NRBA 3WBZA 3Q0AA 2J9DE 5IV4A 1BQNB 4HACB 1HNVA 2WSCC 1CJUA 3AXKA 2QO3A 3W65A 1HMVB 4QWDA 3SBMA 3CCZA 3W2WB 1S9EA 1VRUA 4PQUA 1D1UA 1YI2S 4P72A 4GMKA 3PR5B 2H4YB 1TL7A 2OI2A 2IAJA 3QMQA 2IIHA 2IVMA 1C1BA 1AUDA 2EG2A 4E98A 3RBEA 2HYIB 3GG0A 4QU6A 4CLPA 2CPJA 1JLGB 4IQMA 4OLPA 1I1GA 2CPIA 2MDAA 2J0XA 3WIUA 2KYZA 1N5YA 2DY9A 3HHNB 3ENQA 4DSIA 3OFFA 4WZQA 4IH7A 5A0YA 3W1YC 2DTJA 3SQOP 4IQXA 1KD1T 4CH0S 4R0EA 2DNHA 2GJIA 4PWWA 4ZJQA 3W9HA 2CJQA 2AF6A 2ZUGA 2BQ3A 4Q7AA 4ETXA 3CCQS 5DQIA 3FJ2A 4E2FB 1BD6A 3BYRA 1U6BA 2XGPA 2QLXA 2CWXA 1HHQA 3F41A 3TQ1A 2DVIA 3E2EA 1YK9A 3J7ZT 3NP5A 1UL3A 1G4CA 3GMGA 3R5DA 3U1LA 4Q0BB 3UO0A 3LAMA 3Q8UA 3SZ2A 4GO7X 3RRKA 3AJ1A 5G4DA 2WONB 3H7HB 1MN9A 1OSDA 4FF2A 5K20B 1FD8A 2YKMB 4LF9F 2BE9B 4DOZA 4F04B 4RBTA 4NA2A 5GADI 3C66A 3IG1B 2XCAA 3HHLD 2MQMA 2J6UA 2DYAA 4O0NA 4GKKF 3BR8A 2ADBA 2WW8A 1OJ4A 2UXCF 3V6DB 5C2GA 6FD1A 1DTQA 2X3DA 5CA5A 3TUZC 4M5HA 2ALZA 1JJCB 3CJSA 5F8NA 1JLBA 2YX4A 2WB1D 2HQ3A 2YNHB 2PC6A 1V5IB 1RKIA 4DR1F 2F8HA 4Y2CA 3BS9A 2FDNA 4KHPF 1RT1B 4WXWA 5K8PA 3BGRA 1SPBP 2BJ9A 2H4WB 2QJ3A 1AT1B 3BYPA 2OLWA 1R31A 9RUBA 2UXBJ 3PIOQ 4F02A 5U47A 1V9OA 2DBBA 4G1PA 1VQ9S 3OTOJ 2H9ZA 4ECRA 4M8LA 3NWRA 3KG0A 2BUNA 4ES1A 5J2PB 1JX4A 1F0XA 3W63A 1F5AA 4CLTA 1V5VA 4TKTA 4MYUA 2HWTA 4KGVB 1N32F 2N4DA 3QJJA 4EMDA 3LWMA 2ASDA 1XEZA 4HI2A 1ICEB 4AUKA 4O3SA 4RW8A 2GC8A 2ROPA 4FF3A 3TA0A 4YHHJ 3I0RA 1S1XA 3W9JA 2Y1RI 2V8PA 2HS4A 1E6VA 3KK1A 2BE2B 1F2HA 2W2OP 1VQ8S 4QCLA 4JI0J 2LKZA 1O0PA 5C2CA 1O51A 2KL8A 3D1QA 4ELUA 3IAM9 2QV6A 1PBUA 1KLNA 1FJGF 2QLJB 3FFIA 2FGCA 4RWWA 2QG9B 3BB5A 1D3WA 4DN9A 3GSDA 1RK8A 4U96A 1OY8A 4RW7B 4QWEA 1Q95G 2YTCA 4HLBA 1XR5A 3PW7A 2AW0A 2D7SA 3DHWC 4WFXA 2V69A 2W2PP 3R2DJ 2F8MA 3L3CA 1F5CA 5BJRA 1NZAA 2DRDA 3GP9A 1XTZA 2F7VA 2UV8G 3ET6A 5KG3A 3HSGA 3IXQA 4PYAA 2DEJA 1XMBA 1HBNB 1X4BA 1HPZA 5KFHA 2PSZA 2OPSA 3G96A 4J90A 4NPOA 2RDJA 1T9XA 3OJSA 4NWBA 4OYBA 2OIHA 3FBBA 3VGVA 3UD5A 2JWNA 3U1NA 2YWEA 4PZVA 4NLVA 4EBDA 2A0FB 2M52A 1P9YA 4ENOA 1R8BA 2R7TA 3TAQA 1MG7A 2AZ1A 2RB7A 2CNNB 5JVGQ 3BSOA 1NBEB 2B0GA 4N41A 4DHVA 1IBCB 3IN5A 1ZS6A 2E5JA 4IO1A 2LEAA 2DXFA 2CNOB 4M5GA 4ELVA 5IT9U 1U6FA 3ITHB 3ENVA 1NDPA 1DRZA 3T5HA 3NNCA 2XY6A 2VBYA 1S99A 4MYTA 2MUIA 1BUXA 5EN1A 1GMVA 1YWXA 5M2PA 2B4UA 4N56A 2Y0SD 4JI4F 1X7VA 1WHXA 4F3QA 2ZHAA 2W9AA 5LMUJ 2KXHA 1TAUA 2E5GA 1Q79A 5ITHA 2EKYA 3RRGA 1QJHA 2VA3A 1UJ6A 1FXLA 4DR6J 1Y10A 2HGNA 1M0SA 2BA9A 4USHA 2GJFA 1NPKA 1NDKA 1SQGA 3JS9A 2MY8A 2LQ9A 4IG0A 4Y3CA 4RNFA 3IRWP 1JLAA 2ZD1B 1YJRA 5KFDA 2XGQA 4OZJA 4DV0J 2AX0A 1WG4A 4CLUA 1PJ7A 4OV1A 3HO1A 2MJUA 1RWXB 3P4UB 3SDEB 4DPOA 1KRPA 4LQ3A 2A3JA 2CVEA 1DJ0A 3C15B 1R0BG 3TEHB 3Q8SB 2VQEF 4WP3A 3I56S 4I7FB 5DETA 2XSFA 4DCOB 3GR0A 2BDPA 2K7KA 2QSFA 2MGZA 5LSRA 3JB9k 4OJ1A 2I6WA 3T3FA 2VKRA 4Y28C 1C2PA 1GQEA 1NDLA 1QSYA 4GRSA 4DV1F 3TARA 5L1JA 4R8UA 4OZ1A 1I6JA 2MKSA 4U67Q 2VBXA 3D7SB 3F56A 4DMZA 5L9XA 3TZXA 4ZCKA 1RWWB 1TKXA 2YNGB 2MXYA 2C3UA 4UTGA 3NBPB 4K4YA 2V4RA 2EKNA 3OUYB 2MB0B 3MMCA 1KKHA 2HRUA 4NE9C 2Z2ZA 4Y2AA 3HCXA 3OXGA 4Q8EA 4BBYA 3FC9A 2BJDA 4RW9B 5D15A 4LF5J 3KLEA 1VBXA 2RNEA 3JYTB 1W7WA 2BJEA 2ZJPQ 4NLWA 3KMSA 2Q79A 3THVA 1XNQJ 3GIJA 5DG8A 3DLJA 1OPZA 1Z2LA 2PD1A 4ED5A 2W01A 1S77D 2ZWPA 1HARA 4O23A 4ER8A 4NA1A 5KFTA 2FJBB 1EQ0A 4DPUA 4X66J 2VDHA 1N33J 1CJKB 3LOUA 2WVFA 4TNOA 2VBZA 4DX5A 3PV8A 1NU4A 3DKDA 3HK2A 4K2XA 3RB6A 1IBLJ 3LP0B 3H4DA 1WDDA 4KKOA 1URNA 3OTCA 1KLMB 3KHLA 2IRUA 4P7TA 1GAOA 2BZ2A 2CKWA 2Z57B 3ZZOA 4J9SA 2OMOA 3T1YJ 5HMZA 4DU8A 2OEMA 3MEGB 4TYBA 4B3SJ 1YJVA 2MLZA 4ANEA 3KG4A 1ZYQA 3ZZZA 3PZPA 1Q4RA 4LVOP 1VIOA 3KMQA 4JI8F 3T9ZA 4F4KA 2ZH9A 1JJ2R 1N0VC 3QWUA 1R6YA 2PFDA 1IR0A 1TAQA 3WQPA 2HNYB 4USTA 2D9OA 3DCAA 2HVHA 3UPFA 2BKPA 3FSIA 3MAAB 3CJKA 4B3RF 1TK0A 1C4AA 4NLYA 4JBCA 4PWDA 1VQOS 1JQGA 3KLFA 2KXFA 3GONA 4J5OA 1YG0A 4XAKA 4BS2A 4FXVA 4KC5A 2IYIA 4IO9Q 2RSQA 2DO8A 4PPZA 5GMKa 2RF2B 1Y7PA 3QLHA 2IDLA 3L9ZA 2LU1A 2B6AA 2VPYB 4QPTA 3TVKA 4DCPB 3IMQJ 3O6QA 1Q5YA 3MECB 3JSMA 1M5PC 2IJFA 4OX6A 4JI3F 2YNIA 1I94J 2JSXA 1C4CA 1VRTA 3IS9B 2JHEA 3ZNJ1 2IPOB 3OT9A 9ATCB 2FLPA 2YKPA 1VISA 3T6BA 4UOFA 4ZITA 1SC6A 2G2ZA 4RW4B 1SIWB 3DDIA 1UVKA 2KJVA 3MCNA 3DXBA 1F9FA 4KHMA 2HK2A 1FKPB 4OI3A 3GV7B 3OVAA 4P2FA 3EICA 1U1KA 1HLWA 2D1CA 3FUYA 2DO0A 3ZTPA 5KT7A 2DNRA 4JV1A 2X1FA 1EB0A 3ETMA 1ZM2A 4LMZA 3GCXP 1O6XA 1N56A 2CPXA 3GU0A 5HMYA 1UA1A 1RT5A 2W2MP 2AEMA 3DOLB 1D9AA 1OY9A 4IFVA 3D3CJ 3Q83A 4EU0A 4RUCA 4RKUC 4Y00A 3B8HA 2E29A 1B99A 1RBLA 3H5YA 4TY8A 2LFVA 5F8LA 1T03B 3IRXB 2NQPA 2IC3A 2V0NA 1N5TA 2OSRA 1U1LA 3HKZD 1TR0A 1UEKA 3CJ2A 3QJPA 1UEVA 3CMES 1WTBA 2RDDA 1F6TA 1HI1A 2VG6B 4OI6A 3KKFA 4DS4A 3T41A 1BQNA 2XS2A 4NRUA 4K50A 4HACA 2XYHB 3M6UA 4F0MA 2UUAF 1LFPA 1YX2A 2C2NA 4ZVTB 1VC6A 3QATA 1PYSB 2MHEA 3W2WA 1R8PA 2YQ0A 5AE2A 1PILA 1RAIB 3HI9A 4X64F 4HHJA 1PIEA 4OX8A 2GMLA 2G9OA 3DYAB 1ZBTA 4ZPWR 3S1TA 1VS3A 2EFVA 2YPZA 4PYDA 2DK2A 3PX4A 1JLGA 3NGUA 1A0OB 1PJ5A 2IM2A 4UQGA 4C8MA 2E1AA 3R5CA 1N34F 1NAQA 4BWJA 1ZA1B 1HYSA 2P9EA 1ZPVA 4WFBQ 3D6HB 2NXJA 1FD2A 1JLCA 3D66A 1YSJA 4L75A 2PA3A 4C8KA 4XDDA 2ZHBA 1RADB 3RZAA 2DGQA 4L3KA 3KFWX 1S1WA 1RQ0A 1RTIB 3NAIA 3HZEA 3RU0A 3PACA 3R7NB 1Y3JA 2C3PA 5FDLB 2P9CA 4I64A 5AE1A 3CDBA 3DOKA 1JJHA 4WK1A 4CZCA 3QIPB 2LECA 5F8IA 1WF0A 2M70A 1W2BR 3AODA 2JZ5A 4NLSA 2WONA 4ATNA 4DUZF 1UWBB 5T14A 3G86A 2YKMA 1NK8A 3OFGA 2ZJRQ 7FD1A 2G2YA 2YWGA 2V2QA 1WC3A 4QPXA 1I3OB 4LFAF 2F9JA 2Y8YA 2LCWA 4ID8A 3L09A 2B9EA 1P1LA 1H74A 1X5SA 2WW4A 1KHWA 2R7UA 2Q3PA 3HHLB 3CCLS 3LA0A 3BKFA 1IKVB 4NLXA 4Q43A 4ZOSA 3V6DA 4U8VA 3FDSA 2JFKA 3HSJA 3JSBA 4BC9A 3GIIA 4DSJA 2LQ8A 2YNHA 3H4BA 2AGPA 2DRAA 1L3UA 4B3TF 3DM2B 2RU3A 4IFYB 5EGYA 1UVIA 3R5BA 3OL7A 3UDLA 2GFFA 2KT5A 4G1QB 1RT1A 4NEYA 4LRCA 4B08A 2D74B 2FQQB 4EK2A 5IT9Y 1T94A 1S4EA 3PW5A 3ENWA 4C9DA 3G71S 4DSLA 4L72B 2V4JB 1DTTB 1K0VA 4I69A 5B0DA 2HEKA 2E44A 1LK7A 5KFEA 1P6TA 2W8LA 4KV8A 2Z30B 2M3DA 3W7BA 2OAUA 1FWKA 4Z2XA 2QFJA 2MYFA 1RZMA 1NPRA 5FD1A 5J2PA 1U8WA 3CDWA 3R1HA 3K58A 3M2VA 2HLTA 1NUEA 1RU2A 3ENAA 3A8JA 2YWWA 4DL3A 2GA7A 2DHXA 3OD2A 5HBMB 1TUGB 3QPIA 1PBAA 3FQLA 3NMRA 3MPUB 5LJ3Y 3H25A 2MKCA 5M2RA 3EWGA 3RW6A 1NZ8A 4YEAA 2AU0A 2HWIA 4IUFA 2GO8A 4ZMMA 5KFKA 4C0HA 1YBTA 5AJ3F 5KFQA 1Y0HA 1OYEA 4DJBA 2YH1A 2QEXS 1LWFB 4B02A 5DJBA 3NGSA 5K8OA 5KFRA 1PC5A 1H6KX 2BE2A 5KG5A 2KVIA 4A46A 4ECTA 2BACA 5CD4H 1NB7A 1XNRF 4L76A 1WF2A 2YPYA 3JSRA 1VQKS 1X5TA 2W1BA 2IVYA 4HTJA 2POKA 1G6BA 4PABA 1M1GA 2IJRA 4NZ7A 5L1KA 3VAIA 1S4FA 4RW7A 3EZ5A 3AOBA 3SV4A 4HKQA 1UW4A 2H3EB 3GIMA 3K5PA 2VQFF 3BDEA 3Q86A 3I6PA 5C25B 4CLWA 2APOA 3GLJA 2J0SD 3Q89A 4HT7A 4NEZA 4FBTA 3BSCA 3TVYA 1HBNA 3UN5A 3R1LA 2CPDA 3OXFA 2RHQB 2QYCA 3NOCA 1MWZA 2BJ1A 1B0PA 2DCLA 3TR5A 4L74A 3D3BJ 3GJRB 4FXWA 5EWEA 1RAEB 2DITA 4FP9A 3SSRA 3MMJA 3DC2A 2AT1B 4UZBA 4JI7F 2P8IA 3GPAA 1PCAA 2CQGA 3QYYA 1HL6A 1RWPB 3Q8QB 2ZE2B 2NUHA 2FZCB 4K4UA 3J81U 2KH9A 5KT3A 2ACYA 2VASA 1N5VA 3ITHA 1OO0B 1UTAA 2HNZB 2GVZB 5H9FJ 4YP3A 3M8RA 2F40A 1HFEL 4E8UA 5A2QU 1Q5VA 4ES2A 3T5JA 3HFVA 4AD6A 2HFUA 3C8YA 2ILZA 2AGQA 2DHGA 2M5YA 4CLSA 3UN2A 4B3MF 1MMNA 5D78A 4RO0A 8RUCA 2MKHA 2HHVA 4OZ0A 1SJ1A 1CULB 1IUJA 1BGXT 2ZH6A 2MQ8A 5KFIA 5BR8J 5IM0B 4F2SA 1WF1A 2ZZNA 2ZNZA 2UUCF 4EO6A 2XI3A 3F73A 3MOZA 2VF3A 2ZH8A 4C4WA 5H1SV 2D3OR 4X62F 1CPZA 1Q7LB 5CAAA 3SEOA 1F3FA 4ED7A 5C5JA 3DNCA 1F9HA 1FT8A 4KO0A 3MI7X 2CRLA 1KBRA 1U2CA 5GAGU 3J7YI 1AZSA 2F4VF 1K0TA 1QSSA 1XMOF 3QAEA 4ETZA 4I7FA 5DM7Q 1K8AT 2A2DA 3M4XA 1NXIA 4PXEA 3N9UC 2L9NA 2YQ1A 1OSCA 3VGSA 1GT8A 3V2UC 4RUAA 1U0HB 3TWZA 4PCQA 4QIVA 3GIRA 2CVIA 2MZ1A 5J2QB 1U25A 3RBZA 4JI5J 3RGIA 3BH6B 4DX6A 4TVAB 2X7IA 2YNGA 3CGIA 1U26A 3NBPA 5HL7Q 1TKDA 3OUYA 3BBCA 1S6PB 2GS8A 3K8VA 1BWVA 2CNKB 2V50A 4JB8B 1FCAA 2JLFA 4TY9A 3FRZA 3LW5C 4RW9A 3CCSS 4LRFA 4C11B 4K0KF 2V8HA 2CZ9A 5MLCV 5KFVA 2F4FA 3MM8B 3JYTA 2VL1A 2YBVA 1FJ7A 3M8YA 3PEJA 2NLWA 1SC4B 1RAFB 2XO7A 3PHTA 4NA3A 3DI6B 2JNJA 4AL6A 1W25A 1K1SA 1RACB 1FVQA 2GGPB 2HHUA 1NSAA 1JK9B 2GIRA 3PY8A 2IDEA 2PMZD 4YMEA 1RAAB 1S49A 3KK2A 3K17A 1HI0P 3BKUA 4P2XA 2L3MA 1XMQJ 1HD0A 1XR6A 4B3OB 3D54A 1JKHB 4DR4J 3LP0A 2ZVSA 2FB0A 1RU1A 3J7A1 4HH1A 1KLMA 2XZWA 4G6VB 3MEGA 1CJTB 3I5AA 4F4WA 4N77A 1BWEA 1RP5A 2C2ZB 1JLFB 1NNDA 2OPPB 2J9EA 3HT0A 1UAWA 2UV8A 1JXLA 4NXMF 4H4KC 2E1RA 4UF4A 2JH3A 4WKYA 3R6GB 1YDLA 2H5JB 4DR5F 2HNYA 1S9EB 2VOPA 4U7CA 4WP9A 1LWCB 2V8VA 4PQUB 2GMHA 1SI9A 3MAAA 5IQQA 2I2YA 4IOCQ 2D3ZA 1VQSA 2DGVA 4USMA 2QN6B 1T95A 3RAMA 2Z4PA 3H8YA 5B0AA 5K14B 1NLKL 3DXSX 1ZH5A 5IWAF 3TUPA 2HHSA 1EJ7L 2J0WA 2JEGA 4DR7F 2C3YA 1IBMJ 4Y34A 1IKXB 4DG1B 2XYGB 4FKYA 1TFYA 2RF2A 2Y0BB 5MAOA 3NXZA 4U9RA 4ZCLA 1KTVA 2R8IA 3CCMS 5DDOC 1X9SA 1ROFA 1WI6A 2O3DA 3CD0A 3MECA 2OUGA 1NM2A 3ZZPA 1KS2A 4A8QA 4W90B 1TZ0A 1JNZB 4YY3J 3IS9A 3AA8A 1X4GA 4IH5A 3HVTB 5IFMA 2IY5B 4NLQA 3DOMB 5HATA 1SJ3P 3HHLC 4UUXA 1QSLA 1V3SA 1RHUB 1HA1A 4FPRA 4RW4A 1NJIT 2EFNA 3CJ8A 4F26A 2JFDA 2XZDB 5GMDA 3GFYA 3RG6A 1FKPA 1M5HA 5D3GB 1ZTTA 2RMLA 2X1GA 2CQHA 3ZTRA 4KQZA 5T7LB 4OX9F 2PEHA 1RYSA 1YJWS 1V3ZA 2IMWP 2KYXA 4A8MP 5ETSA 1SL2A 2I0XA 1O8BA 3SFUA 1HR0J 2HVEA 3BQ2A 2OPQB 4HR2A 2AJ4A 4V19J 5EHHA 1R6VA 1HKAA 3G4SS 1Q0NA 1RABB 4NLDA 3DOLA 1YJ7A 4CLLA 1JMTA 4DV6F 4LR7A 1DTQB 4XO0A 5I42B 3UNYA 3ILJA 1QTMA 4C3LA 2UUBJ 1J27A 4YR3A 1T03A 3IRXA 2L08A 3ZC4A 1FEEA 2B3TB 3AHPA 2XI2A 2HGMA 4RJVA 2HK3A 1RWKB 1WHVA 2VG6A 2B43A 3TEGA 1FKOB 4A4JA 3JQKA 1KQGB 3ZZUA 4KRWA 1EX8A 4GC7A 4LF6F 4LF4J 4NCBA 1KOHA 4P10A 1PKUA 2NUUG 2QA4G 3HX9A 1WEYA 5IV3A 3W5ZA 4M5NA 4USUA 2MKKA 2RT3A 5K8NA 3AB2B 1LK5A 1Q8BA 2UUTA 3T5LA 2OMLA 4OHWA 4ZJOA 4Q2MA 5AT1B 2AYGA 2C3OA 3FVYA 3HF5A 5KFMA 5EUHA 3UNGC 5HVGA 1D9DA 2KKHA 3PEHA 2FZKB 2B51A 4DUYF 1MU2B 3AB4B 4DLGA 2BOPA 4WBFA 1RHJB 1U1QA 4JI1J
chains in the Genus database with same CATH topology
2HRXA 2EW0A 2MUIA 2DO8A 2AJ2A 2GZOA 2GS5A 2HAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HRX A;  2EW0 A;  2MUI A;  2DO8 A;  2AJ2 A;  2GZO A;  2GS5 A;  2HAF A; 
#chains in the Genus database with same CATH topology
 4DSK A;  2PMH A;  1Y3K A;  2QE5 A;  2CJY B;  2DNG A;  2LA6 A;  5F0U A;  2ZC3 A;  2BW2 A;  3VCD A;  1U1M A;  4PPD A;  3NEK A;  4ZVH A;  3OJU A;  2H48 B;  4EUV A;  1T9T A;  2LA4 A;  3OLA A;  4RUH A;  2BOA A;  2CJX B;  3BGU A;  1NJX A;  5B08 A;  4CTA A;  1IWG A;  3UVJ B;  4WPA A;  1RTI A;  3M8W A;  1ACM B;  3FFI B;  4QQB A;  2HFS A;  3CPW R;  2GAH C;  3QID A;  4P74 A;  2CDR B;  3G2X A;  3MR2 A;  1C1C A;  3OHA A;  3GV8 B;  4M5K A;  5C42 B;  5KFZ A;  1Q8L A;  4EEY A;  1C0U A;  2VFR A;  2DCU B;  4C6A A;  1SBR A;  4P6Q A;  2F1F A;  4EFA C;  2HHQ A;  4EBE A;  2O01 C;  1UWB A;  2NPI A;  4OZL A;  4ECV A;  3AJ2 A;  2GAG C;  5CCL A;  2R8K A;  1M5S A;  1LXJ A;  3ET6 B;  4ZP6 A;  3BM7 A;  1NKB A;  2C2K B;  2PI4 A;  4DF4 A;  2DNN A;  2MST A;  2W8K A;  1YRX A;  5K5M A;  2CZ4 A;  3KUG A;  4OLO A;  2WHO A;  3HHL A;  3TOQ A;  1FWL A;  1IKV A;  1WOP A;  2HND B;  4TLR A;  3CTR A;  3DFE A;  5ETK A;  3QGH A;  2DR9 A;  5DG7 A;  4CM0 A;  5CYM B;  3DM2 A;  3MPW A;  3LF0 A;  3TJ9 A;  2YWF A;  4RU9 A;  1ZET A;  4UQT A;  4ECS A;  4DL4 A;  4ZP8 A;  1Y00 A;  3BN7 A;  4OV6 A;  4G1Q A;  3PW0 A;  1VBZ A;  2RRN A;  2N7Y A;  2OD4 A;  3J81 Y;  1TK5 A;  4FNI A;  3CD5 A;  3EGN A;  4DU7 A;  3H59 A;  1REV B;  1CC8 A;  5F41 A;  3RTV A;  3K59 A;  1VQM S;  2W25 A;  1T05 B;  1RTZ A;  5KFW A;  1WDT A;  5A2Q Y;  1LOU A;  3D1H A;  5E33 A;  2HVD A;  1VQ7 S;  4AXJ A;  2MY7 A;  4FN5 A;  1KWM A;  2HHX A;  4ZP9 A;  2RHS B;  1QE1 A;  1P1T A;  3KWM A;  3IFE A;  2GQC A;  3ADA C;  3TAN A;  4LF8 J;  2Q6B A;  2WRM A;  2V8D A;  1OYD A;  3H42 A;  4PUO A;  2CG4 A;  3O2I A;  3FGV A;  3DLB A;  4GKJ J;  1WTF A;  4X4R A;  5A6W A;  4TQS A;  4G3I A;  3HM9 A;  1VIX A;  1ZOT A;  4LR8 A;  2ROE A;  2ZVI A;  3B82 A;  4QJV A;  2L48 A;  3M8P A;  1FI4 A;  3N28 A;  2MMY A;  2XO6 A;  2KU7 A;  3D0G E;  1LV5 A;  1LWF A;  1U45 A;  1OQ3 A;  1B7F A;  3LQV A;  1TP7 A;  2MGZ B;  1V3R A;  1T11 A;  2FJD B;  3OL8 A;  3IWX A;  1NJZ A;  2EC2 A;  3RB0 A;  4LF1 A;  4HI1 A;  3IGN A;  3O1L A;  1JNR B;  3OTO F;  3QT5 A;  4ZK7 M;  4QIF A;  3CW2 C;  3W66 A;  1B4S A;  4KE5 A;  4EYH B;  1ELO A;  1TKX B;  1LKZ A;  4EZ6 A;  5I3Q A;  3C19 A;  4CO0 A;  2GHV C;  5B0C A;  2E5I A;  5CXT A;  1NH7 A;  4NI2 B;  2O67 A;  1HWJ A;  2N82 B;  5C25 A;  4DV7 J;  3FBC A;  3D5M A;  4ZCM A;  2IJN A;  3EDQ B;  1WAC A;  1R8A A;  2E7X A;  2IFX A;  4X65 J;  3X1L B;  2CPH A;  5LSL A;  3L4B C;  2DNQ A;  2E1M C;  4OYZ A;  4LSN A;  1X4E A;  4KTQ A;  2V9W A;  1SL1 A;  2XMK A;  3K2Y A;  2EK6 A;  3NGD A;  2W9C A;  1UFK A;  3NS6 A;  3ONQ A;  3KLE B;  2AYE A;  2IVF B;  1AFJ A;  3MR7 A;  3EVO A;  3HSD A;  2VFU A;  1BY9 A;  2BRK A;  3H40 A;  2F3J A;  2KFY A;  5CZV A;  4CNY A;  4JI0 F;  2LQB A;  5DQG A;  2YKA A;  1DAR A;  3SCJ E;  3I96 A;  2JX2 A;  2ZE2 A;  2GZO A;  2AYM A;  5I3U A;  3L7U A;  3F44 A;  3UI3 A;  2Z56 B;  3M05 A;  1U1P A;  2HHH J;  2BKN A;  4JV5 J;  3DRP A;  4EGL A;  3CJT A;  5GAD U;  4ILR A;  2B8P A;  2VIH A;  2HNZ A;  2GVZ A;  4WTY A;  1RT7 B;  3PW2 A;  3RJM B;  4PRF A;  4MK9 A;  3AQO A;  4ZN3 A;  5A8K B;  4XTT A;  3DLG B;  3F0N A;  2EFO A;  5ETM A;  2AD9 A;  1UPP A;  5IS2 A;  2HSE B;  4ID5 B;  1Q8I A;  1WWH A;  5IM0 A;  4QOT A;  1GXT A;  2KFZ A;  1FNO A;  2QFI A;  4ZJL A;  1D09 B;  3VZI A;  2XM3 A;  4TLQ A;  3BEG B;  1WHY A;  5IQ6 A;  1WOO A;  4MTP A;  4QW9 A;  5FJ4 A;  4ZPC A;  3DLL Q;  4DPT A;  1YJT A;  5A8W B;  2DH8 A;  2MZQ A;  2N4C A;  1S79 A;  3D1O A;  5H9F K;  3TX8 A;  3VTI A;  4B9L A;  1KN6 A;  2R2R A;  2ADC A;  4IRC A;  2Z8Q A;  5F9L A;  1HBM A;  2ZBQ A;  5ETP A;  4BLG A;  2HHW A;  2VV5 A;  2CJA A;  2HS3 A;  1CG2 A;  1S7H A;  2D3U A;  3QT8 A;  4P71 A;  2NSB A;  4DR2 J;  1L5U A;  2IA0 A;  2BKO A;  1RGV A;  2E9Z A;  4KH1 B;  2ZH1 A;  2OGU A;  1RTJ B;  1U0H A;  2XNR A;  5DGB A;  5HQ8 A;  5KT4 A;  1YGY A;  5LSO A;  1P9Q C;  4BWM A;  3HKW A;  1D8Z A;  5LMU F;  1NK9 A;  1HQU A;  4NZ0 A;  1UEU A;  3ISN D;  5J2Q A;  4H4M B;  5HVH A;  4JP8 A;  4LF7 J;  3M8S A;  4DR6 F;  1VRT B;  4OJH A;  2FZG B;  2R7Q A;  1A7G E;  2AGO A;  2W9B A;  3CMA S;  4CO1 A;  1M90 T;  2VB6 A;  3KDN A;  2GJ2 A;  4Y6I A;  1K9M T;  2QLB B;  1R43 A;  2BYC A;  1UVN A;  1SC1 B;  4DV0 F;  1UA0 A;  2XB2 D;  4MK8 A;  4XDC A;  4C11 A;  2HAI A;  4R25 A;  3CDE A;  2FHO B;  4K7Q A;  2LLZ A;  4M5L A;  1NO8 A;  2FUG 9;  5C7P A;  2MLX A;  3R97 A;  1NEE A;  1H38 A;  1WSV A;  1U48 A;  3DI6 A;  1FTC A;  2E1P A;  3IA0 A;  2R2T A;  2UUW A;  3VF0 B;  1RA6 A;  4EYI B;  5CCM A;  1AA1 B;  2GGP A;  5DZ7 A;  3SMZ A;  2RIJ A;  1RT5 B;  1FFG B;  2XMT A;  2LEB A;  1BQX A;  3M2R B;  3KYL A;  3TRG A;  2P9G A;  3VHQ A;  1FX4 A;  3MPD A;  3V6J A;  2HAF A;  1VDH A;  3FZ2 A;  4NLT A;  3T9N A;  4Z7C A;  1VQ6 S;  3ZXW A;  2LMI A;  4DSF A;  4B3O A;  4TY8 B;  4CQ1 A;  5C24 A;  2VD3 A;  3OW2 R;  1WC1 A;  3TA2 A;  5LXR A;  2KJW A;  1VYA A;  3CT9 A;  1S7I A;  2E7W A;  1MMD A;  4Y2I A;  1EP4 A;  2JRS A;  1RAO A;  1CJT A;  1WG1 A;  1JLF A;  1S0O A;  3M30 B;  1UJ4 A;  2FJA B;  1XN9 A;  3T19 A;  2OPP A;  2O5D A;  4FPI A;  1DLO B;  1GMW A;  3P45 B;  4KAI A;  4USW A;  3D28 A;  3M6X A;  1UJ5 A;  4ZVP B;  4X64 J;  4DFP A;  3CO9 A;  3TNV A;  3GFX A;  1LWC A;  3E01 B;  4FF4 A;  1XNQ F;  4ILL A;  2EFG A;  3OFH A;  2QZ8 A;  3UCU P;  5J1E B;  3K7R A;  3UD4 P;  2HQI A;  2BAB A;  1XR7 A;  2LXI A;  5K14 A;  4X66 F;  2KO1 A;  1MML A;  1N33 F;  1DBD A;  2O1P A;  3JTO A;  4A8F A;  2XS7 A;  2VJV A;  1N6Q B;  2AZ3 A;  2HZC A;  4OHY A;  3VV2 B;  5BYS A;  3CCT A;  4P52 A;  5ETO A;  3QRR A;  1B70 B;  2ZBR A;  1IKX A;  1IBL F;  4DG1 A;  2QSW A;  2OHD A;  3RBD A;  2LEP A;  2VZ9 A;  2PO4 A;  1FER A;  2HBZ B;  3LP2 B;  2QA1 A;  2DNP A;  4USK A;  1U1O A;  1PAE X;  1HYS B;  3T1Y F;  5KG0 A;  4NYP A;  4B3S F;  3DLH A;  2HBY B;  3EVM A;  4C3K A;  1JLC B;  2DO4 A;  2NYI A;  5GAE I;  5DRK A;  3PKM A;  3W5Y A;  1S1W B;  1B0V A;  2V8G A;  3HVT A;  4P2M A;  5D4L A;  1IN0 A;  2KT3 A;  4O4G B;  3DOM A;  5DLG A;  2FC9 A;  2EBE A;  1S76 D;  1Q8K A;  2LDY A;  2C1E B;  3ZZT A;  1YJ9 S;  3DOK B;  1YRT A;  1S59 A;  3IGV A;  4GVL A;  5D3G A;  3EXC X;  3IR7 B;  4NMX A;  2FC8 A;  2Q43 A;  1RWV B;  5T7L A;  3TUJ C;  1SC3 B;  2DKO B;  4U6P A;  5L8R C;  3W60 A;  1NSQ A;  1EAR A;  4ED1 A;  2OPQ A;  4QWB A;  1LNQ A;  2HHP A;  4P7V A;  3HVW A;  3GZ7 A;  3FCV A;  2VIC A;  1S1U B;  4LR9 A;  1AUS L;  2JL9 A;  1FE4 A;  1T0T V;  2H5I B;  4CP5 A;  1GNK A;  4TXS A;  4FXD A;  3VAH A;  3NCP A;  3CJ5 A;  4R0J A;  3HJV A;  5I42 A;  4AQY J;  3CJ4 A;  5L1L A;  2D69 A;  2MLY A;  1NSP A;  3L7O A;  2B9Y A;  3MM9 A;  3D2W A;  3VAG A;  4PG4 A;  3B54 A;  4GC6 A;  5J1P A;  1UCN A;  3QO9 B;  1IR1 A;  2AV5 A;  4X4Q A;  4Q44 A;  1FKO A;  2GQ2 A;  2M0G B;  1UFW A;  2FVS A;  1IKY B;  5HRO B;  1HNX J;  4O3O A;  4URG A;  4ZA1 A;  1VQN S;  1AB8 A;  1NK0 A;  3LTO A;  3MGJ A;  5J1N A;  3NLC A;  5G0R B;  4KV8 B;  1UKU A;  2WOM A;  3IR5 B;  1MRO A;  4OI2 A;  1S1T A;  4MT1 A;  1LWE B;  4MKV A;  2EW9 A;  1F5B A;  4LRA A;  3WZ0 A;  1LEO A;  2WK4 A;  3M2V B;  4EBC A;  2BX6 A;  2SXL A;  2N7C A;  2DGO A;  2XYP B;  3LPE A;  2RQK A;  2FHJ A;  3ISZ A;  3VR1 A;  4ELT A;  3JAM U;  2WTF A;  2G13 A;  4IDK B;  5HJX A;  1MU2 A;  5KTQ A;  2B9W A;  3E8O A;  4F4X A;  5L9N A;  1CQM A;  1U1R A;  1JWW A;  5AJ3 J;  2VU5 A;  3IM9 A;  3DGV A;  1NHU A;  4ZVO B;  2FJW A;  2HW3 A;  4WU3 A;  5HJY A;  4X2B A;  4DFK A;  4DX8 H;  3GFZ A;  1FDA A;  4CT8 A;  2R7O A;  1S9F A;  1KTQ A;  2OO4 A;  4M1K A;  2AJQ A;  2FHM A;  2QYG A;  1RLC L;  5CH7 B;  2G0C A;  2UVR A;  1A6L A;  1ZTW A;  4PG5 A;  5KFO A;  3GB0 A;  2B5J B;  4CH7 A;  2ZHO A;  3UVJ A;  3IR6 B;  4YOE A;  3QT6 A;  1XC9 A;  2L9D A;  4ECU A;  1RIS A;  1X5P A;  3A3P B;  3QGG A;  1HWK A;  2AP6 A;  1DQA A;  2GW8 A;  4RNN A;  2EFP A;  5C42 A;  3T6J A;  5KFN A;  2HFO A;  2RU9 A;  5B7W A;  1N52 B;  2YY3 A;  4F7V A;  4B17 A;  2R4F A;  2B4V A;  1LXN A;  2DY1 A;  3BSN A;  1WKL A;  4XPE A;  4HTI A;  1KFD A;  1N88 A;  3TX0 A;  3CCR S;  2A1B A;  4YN3 B;  2CAD A;  4WU2 A;  1U2F A;  2PA8 D;  5DZ6 A;  3PNI A;  2UU9 J;  3V5R A;  3J80 U;  2XWX A;  3T1H F;  2AX1 A;  3DU5 A;  2AQ4 A;  2HND A;  2FYX A;  2QLF B;  3MXH P;  4J91 A;  1LW2 B;  1ZM4 A;  1VJW A;  2RKI A;  2BQR A;  2PN6 A;  2XHC A;  2UZA A;  4I0W A;  2DPI A;  2LDI A;  4OYO A;  4ECZ A;  4KR0 B;  1EKS A;  2XS5 A;  5CYM A;  2DR6 A;  3MCM A;  1DHM A;  1XK8 A;  1XJW B;  1TTH B;  5J2N B;  2R2S A;  2BRL A;  4KHR A;  2HUR A;  3AD8 C;  3CJQ A;  1QD1 A;  2VC1 A;  2OKQ A;  3QGP A;  2LYV A;  4NZ6 A;  4NXN J;  1CLF A;  1REV A;  4OYP A;  2R7W A;  2CPE A;  4FNH A;  3GJS B;  1T05 A;  3KHG A;  4ANC A;  5FLX U;  4LIR A;  2I8E A;  5KG6 A;  3DN9 A;  3T5K A;  4CLY A;  1WC6 A;  5IC6 B;  3R7B B;  1IR2 A;  4RW6 B;  1SH3 A;  2DRB A;  5KFF A;  3H98 A;  5KFL A;  1NDC A;  3PHE A;  3KHH A;  4NYO A;  3MWB A;  2B7C B;  2FIU A;  3A13 A;  2Z2M A;  4HT5 A;  3PX0 A;  1BC6 A;  2EI5 A;  3BQ1 A;  1FE0 A;  2NXU A;  3MED A;  3S01 A;  4DV3 J;  3BSA A;  3B4D A;  1HBU A;  4PXC A;  3PFE A;  2MQP A;  1X9M A;  3D4J A;  2F63 A;  3VVU A;  2RIL A;  4CO5 A;  1J2V A;  4MKY A;  1L3V A;  3ICL A;  4IYQ A;  2LXF A;  1RT4 B;  1NKE A;  5DDR C;  2CXE A;  3LWL A;  3DDK A;  4NAS A;  4X84 A;  3ZO7 A;  4QR2 A;  1H3D A;  4KO0 B;  1AZS B;  4FYX B;  4YDX A;  1WG5 A;  2YKQ A;  3KLH A;  2COL A;  5LXY A;  5I3P A;  3I9V 9;  3PYF A;  4LSL B;  3MD3 A;  4Y0F A;  3C6T B;  2BVZ A;  4NCG B;  1CSJ A;  4EI2 A;  3DU6 A;  3PJ9 A;  3N5F A;  4F4A A;  2Y1J A;  3E51 A;  4N5S A;  3D6T B;  4QBU A;  4F4Y A;  5HLF A;  2YQ3 A;  3MTJ A;  3UDE A;  5CYJ A;  4LBP A;  2QL7 B;  3C16 B;  3MCO A;  2DNO A;  1CC7 A;  5M2U A;  3DRR B;  4NI2 A;  3TUI C;  4DQR A;  1U47 A;  2ZOM A;  3I31 A;  1UET A;  1Z4U A;  1FJC A;  2H54 B;  1OMS A;  2UVU A;  3GQC A;  3VVT A;  3POT A;  4ZS6 A;  4MJK A;  2VON A;  4MKA A;  1ZZF A;  4LIW A;  1AFI A;  4QYZ J;  2OH2 A;  3HHE A;  4CIO A;  3C3L A;  5E2Q A;  5L1I A;  3FSX A;  1L3T A;  1XWL A;  3MUT P;  2HGL A;  2ZM6 J;  3H2V E;  2Y1L B;  1H72 C;  4HDH A;  4YB5 A;  2QL9 B;  2C2R A;  3IWN C;  1Y5N B;  1CEZ A;  2E9T A;  4KPC A;  4DL2 A;  3FK4 A;  4PWU A;  4Y65 A;  3RB3 A;  3MEE B;  4ED2 A;  4Q5V A;  3KK2 B;  3EZU A;  3MUM P;  3RR7 A;  4RUB A;  3HMJ G;  2MKY A;  3EYZ A;  4WFZ A;  5E41 A;  2CIM A;  4YFU A;  2J0Q D;  4RL1 A;  3M8Z A;  4DV4 F;  3H5U A;  4C8L A;  2HHT A;  2BE7 D;  4RNM A;  2R8J A;  3D6M B;  4DL5 A;  4KPY A;  2JEI A;  1RT7 A;  1Z2Z A;  4M94 A;  4K4Z A;  2R8H A;  5DO2 A;  2DR5 A;  1Q16 B;  2K1R B;  5A8K A;  2C2O B;  3DLG A;  1PGZ A;  4EWT A;  3N79 A;  4FYD A;  1GMW D;  1RXO B;  3IM8 A;  4DL6 A;  2CUY A;  4NXM J;  1VC0 A;  4ID5 A;  3KUE A;  4DR5 J;  3RBX A;  4WKR A;  4DX7 A;  4NOH A;  4NLG A;  3PJW A;  1GTE A;  2CAJ A;  2BJ7 A;  1TL1 B;  4ZDN A;  1T9W A;  3R3T A;  1X8D A;  4HHU A;  4KFB B;  5A8W A;  1MWQ A;  1UVL A;  2IHR 1;  2WVE A;  4K59 A;  4MMO A;  4RBU A;  4WTO B;  5KFP A;  3D6F B;  3CSK A;  2RQ4 A;  4ZPT R;  3TO8 A;  2FLN A;  4K2J A;  1PYO B;  2WCX A;  1NK6 A;  2WBM A;  4MKB A;  1Q81 T;  5KFB A;  1WC0 A;  2PGC A;  4C2M A;  4V19 X;  4ZLJ A;  1KDN A;  3Q23 A;  2PFF B;  3RUB L;  2A2C A;  2B4P A;  1RB0 A;  1G3O A;  3BQ0 A;  3MTK A;  2DGW A;  2RRB A;  1RTJ A;  2JJ4 D;  5B0F A;  2XMA A;  4P73 A;  5HQM A;  2OEK A;  1KVK A;  2MQO A;  3PDN A;  1UWA A;  5KFS A;  1RT3 B;  5SUH A;  1SVD A;  4H4M A;  1SXL A;  3TVZ A;  5BR8 F;  1S10 A;  3VAF A;  3BPD A;  4N7T A;  4HHH A;  4KB7 A;  2EFQ A;  4DFJ A;  2W7A A;  2ZEJ A;  1S1V B;  3H20 A;  3GWC A;  2MSS A;  5JJB A;  4P2S A;  3C2P A;  3ZZR A;  2J7U A;  4M5J A;  1FDB A;  4TU8 A;  2E5L J;  2LQJ A;  1L3K A;  2CA9 A;  1VBY A;  2HFV A;  4ZHR A;  4YQW A;  1IBK F;  3CD6 S;  2V34 A;  4JOU A;  3ZZ0 A;  3MR5 A;  3O8W A;  5AE3 A;  3TJ8 A;  1OY6 A;  1YBA A;  3MFI A;  3H5S A;  3OL9 A;  1GH8 A;  2G2O A;  2BQU A;  2WB4 A;  4KYZ A;  3KLI B;  4J9L A;  1IKW A;  3M2R A;  1QUP A;  2FVC A;  2Y9H A;  1KFS A;  3UN3 A;  3THT A;  1SKS A;  3HVR A;  1RTD B;  2QC3 A;  1WEL A;  5GAH I;  3TYT A;  2VG7 B;  5LM7 E;  4JI5 F;  2KVQ E;  2QGF B;  5K9F A;  1YRU A;  3AY0 A;  2RJZ A;  2G1H A;  4H4O A;  4A48 A;  3JQJ A;  2J8S A;  2P2C B;  1HHT P;  1HI8 A;  3AQP A;  1UPM B;  4ECY A;  1VOM A;  1WI8 A;  2A10 A;  3D68 A;  5F8G A;  1DZ5 A;  2ZOG A;  2YKN B;  1URR A;  4LF6 J;  2IM3 A;  3N6N A;  3M30 A;  3ILI A;  3WHI A;  1DLO A;  4YDD B;  3A12 A;  3DMJ A;  3W8P A;  2R7X A;  3KHR A;  1SQF A;  4ZPB A;  4UOC A;  4WE1 B;  4OX7 A;  3UD3 P;  2YX1 A;  2VFV A;  3X3U A;  3O44 A;  4USJ C;  2XC9 A;  5KAK A;  2EG1 A;  2W2N P;  1RYR A;  4HVZ A;  3M1V B;  3E01 A;  3JTP A;  5D77 A;  4A47 A;  5DS7 A;  4LT6 A;  5AXK A;  4DL7 A;  1BLU A;  5E3A A;  3V4I B;  4FS1 A;  3FQK A;  4J9M A;  1S9G B;  5J1E A;  4PR6 A;  2FHJ D;  3AOC A;  2IYG A;  2X1B A;  4LRB A;  1QDU B;  4J9O A;  1Q86 T;  3EX7 B;  1N6Q A;  3JAM Y;  4UT4 A;  3MPY A;  1DUR A;  4D3H A;  1XMQ F;  1YJN S;  4DR4 F;  1VMB A;  1FNM A;  4J9Q A;  2B4O A;  3BJY A;  3P5T L;  3LP2 A;  1REG X;  5LMN F;  2YVS A;  1FK9 A;  3KNA A;  2GO9 A;  3FCW A;  5B0B A;  3BRE A;  1FVS A;  4J9U E;  2GCF A;  1QUV A;  4QWA A;  4YUD A;  1VFJ A;  1HQ2 A;  4Z37 A;  4CTA B;  2RUG A;  3R6L B;  4RPF A;  2PDA A;  4AL7 A;  1OPI A;  5HP1 B;  3JQM A;  4O4G A;  3G6E S;  3UDV A;  4QIE A;  3J7Y U;  2XMW A;  2Q6C A;  2ROG A;  3J7A N;  4G1I A;  5A8R B;  3MFH A;  1EET B;  4FKX A;  4AE5 A;  4ED3 A;  3J81 j;  1C1C B;  1NK5 A;  1B3T A;  4F50 A;  1C0U B;  4MAK A;  4YS2 A;  1NHV A;  2DH7 A;  2VBW A;  1UW9 A;  1ITP A;  4K4V A;  3KLV A;  3GYG A;  1N36 J;  3IBW A;  1OWX A;  1VLO A;  2F9D A;  1IBM F;  3PW4 A;  1T7P A;  1SJ4 P;  1S1U A;  1R27 B;  3GG1 A;  3J80 Y;  3KJQ B;  4ZP7 A;  1G7C B;  3Q2S C;  2NR0 A;  5F3Z A;  4OHX A;  3WDO A;  1ZAW A;  4OI4 A;  3CJ3 A;  4ICL A;  5BYR A;  1Y5I B;  2Z2L A;  1D8Y A;  3AT1 B;  3VZH A;  4YY3 F;  1RWN B;  2XQC A;  4HDG A;  2B8Q A;  2FLL A;  1BXN A;  3OBI A;  2HQF A;  2PII A;  3MM6 A;  4E0D A;  4DEZ A;  3UE2 A;  3GCW P;  3A3N B;  3QO9 A;  1HNZ J;  5KT5 A;  2JDJ A;  1NRK A;  2V2K A;  3K5L A;  3DRS B;  2JVR A;  1IKY A;  3PJX A;  5HRO A;  5FLX Y;  3W64 A;  1RWM B;  2E9R X;  2QA4 S;  1VQL S;  2AMC B;  4AL5 A;  3KOA A;  2RVJ A;  2DXE A;  2U1A A;  5G0R A;  2ZH4 A;  4B9T A;  1HR0 F;  2JC1 A;  4ZVG A;  1QE1 B;  2H5E A;  4CCH A;  1LWE A;  3OR2 A;  3MOJ B;  4PG8 A;  4K8R A;  2HFN A;  2ZBP A;  3W3S A;  3DDN A;  2PE8 A;  4PUO B;  1YZ7 A;  1HNI B;  4M5M A;  3NKY A;  3PVX A;  5ETV A;  3JSY A;  1S6Q B;  4WWS A;  3G9C A;  1YKW A;  2BV3 A;  1AW0 A;  4WCE Q;  4IDK A;  4PG6 A;  1ARO P;  1RI7 A;  3DLE B;  2BJ8 A;  1LW0 A;  2UUB F;  3OTD A;  1TK8 A;  1NJY A;  2J5A A;  3MPV A;  3FMB A;  1HNW J;  5GME A;  5HAN A;  3DRX A;  1SJF A;  1RTH B;  4KGZ B;  1KQS R;  3HPO A;  4JV0 A;  4LSZ B;  3M8P B;  4OZ2 A;  3PKY A;  1N4L A;  1RDR A;  1FDD A;  4WFA Q;  1EIY B;  2MZT A;  1NHK L;  2CQ1 A;  3PYD A;  3LPY A;  4LBH A;  3QFW A;  3SYZ A;  2B5J A;  4MIA A;  5IOL A;  2K8G A;  3P5B P;  2ZH3 A;  2BAN B;  5A76 A;  1H73 A;  3I55 S;  4TN2 A;  1Q82 T;  2GX8 A;  4DV5 J;  4LF4 F;  2JLE A;  3M9O B;  2HQD A;  3I5C A;  1T02 A;  3PG9 A;  2UXD J;  1ZAV A;  3M8Q A;  4NML A;  4O3N A;  1TQL A;  5ETR A;  1VC5 A;  3BDP A;  1FRJ A;  2VPW B;  1J5O B;  4PEO A;  4YR0 A;  4QWC A;  1NPP A;  2VFT A;  1CBK A;  3G82 B;  5IXU A;  2V2V A;  3MEK A;  4NL5 A;  3LUY A;  3N6M A;  4ED4 A;  2BEF A;  2VDI A;  3DLK A;  4J9P A;  5E3R A;  4JI1 F;  4ALZ A;  4LSN B;  2B7B B;  3CD7 A;  3I0S A;  2GVD B;  2W9C B;  5I4M A;  3MM5 B;  2GQQ A;  4ED6 A;  3EPI A;  2MKJ A;  4CRJ A;  1U4B A;  3O5T B;  4JI2 F;  3CVK A;  3PXG a;  1R8H A;  3DGP B;  2BMB A;  3KK3 A;  1LW2 A;  2V2Z A;  2XTJ P;  5KFY A;  1ULR A;  4C98 A;  2M2B A;  1X0P A;  2M7S A;  2EK1 A;  2ZWO A;  4F0H A;  7AT1 B;  3W61 A;  4JI6 J;  3QQC D;  2HMI B;  6AT1 B;  3Q8P B;  5J2N A;  1VQP S;  2YNF A;  5ETL A;  3EGV A;  1UZD A;  5I3U B;  1TEL A;  3HXM A;  4WYL A;  3MUR P;  2VOO A;  4LFC J;  4QU7 A;  4Y2M A;  3DRP B;  1IM4 A;  1BQM B;  3G6X A;  2QIF A;  4JYA J;  2E7V A;  2YWH A;  2W4D A;  4IG3 A;  4DR3 J;  1J5E J;  1M5O C;  4DN0 A;  3OLB A;  2P5V A;  2BBE A;  4I68 A;  5K8M A;  3W2V B;  4RW6 A;  4ZIW A;  5ETQ A;  3ZNU A;  1HW9 A;  3CUL A;  5J2M B;  3HP6 A;  3FBF A;  3UDC A;  2DGU A;  2BXJ A;  3GFH A;  3KXD A;  3FZB A;  3Q8V A;  3Q24 A;  1SIZ A;  1UP1 A;  4KY3 A;  5F9N A;  4L3N A;  5D4N A;  2QMU B;  5D0H A;  2VOD A;  4F4Z A;  3BV8 A;  4W4M A;  3RYL A;  2M9K A;  2YWK A;  4KGK A;  1RT4 A;  5KFG A;  2W7P A;  1MSW D;  3GTY X;  1HBM B;  5CZX A;  2ILY A;  2JVO A;  4LFB J;  1TL3 B;  2BM1 A;  2W7O A;  3A1Y G;  2V4Q A;  3ISN C;  4J9R A;  3H2L A;  2G4B A;  4OZ5 A;  2DGT A;  4QIW D;  2ZKT A;  2DR8 A;  3PFO A;  2W4P A;  2HKE A;  1TFW A;  5D4P A;  2B56 A;  1Q1K A;  3MD1 A;  1M1K T;  2PT0 A;  4OI0 A;  3H2U B;  4LSL A;  3D0I E;  2HQG A;  1SV5 B;  2J8A A;  4TU9 A;  8AT1 B;  3C6T A;  4F25 A;  4NCG A;  4CDI A;  1RHQ B;  3M2U A;  3FMW A;  4DV2 J;  1F60 B;  1G1X A;  3NAH A;  1JXE A;  3CC7 S;  1HQU B;  5A6P A;  4B9M A;  4DCJ B;  4RX6 A;  5CHC B;  2WZ1 A;  4I2P B;  3R27 A;  5AXL A;  4I2Q B;  4LF8 F;  1RHM B;  3C16 A;  2JEF A;  3QGI A;  2W9B B;  3OTE A;  1PG5 B;  1GX5 A;  3DRR A;  1X4D A;  1H7W A;  2KTQ A;  3RRH A;  4GKJ F;  4JUZ A;  3AXM A;  2CPZ A;  1RSC A;  2FJE B;  1R8C A;  4NLU A;  1WKK A;  2FY1 A;  1T9V A;  5HSP A;  1H0H B;  2DR7 A;  4B9S A;  2R2U A;  3UR3 C;  2IBO A;  2XLJ A;  2HZV A;  2OPR A;  1TL5 A;  4W98 A;  4UUW A;  3FEX B;  1SKW A;  3U27 A;  2XNQ A;  2Y8W A;  3BO3 A;  3MEE A;  4ZLP A;  4ZVU B;  4DQS A;  1YBU A;  1MW7 A;  1RA7 A;  1SUQ A;  1B0T A;  2B9X A;  2AHO B;  5EWF A;  4URS A;  4FBU A;  4DUT A;  1K1Q A;  4QYZ K;  1JLQ A;  3QT7 A;  2ZH5 A;  2WAQ D;  4BCA A;  2MKI A;  5C24 B;  2AJ0 A;  4PAA A;  3Q8Y A;  4C8Y A;  2K1R A;  4DV7 F;  1EP4 B;  4OJ3 A;  5H9E K;  2CFX A;  4X65 F;  3N0V A;  4S0M A;  3HSZ A;  2AJ2 A;  2DHA A;  5CYQ B;  3UFC X;  3V81 A;  1TL1 A;  1Y5L B;  1TV6 B;  1WOS A;  2HRX A;  1Q7Y T;  4X4S A;  2JOQ A;  4KFB A;  2V5H G;  2XLK A;  5AXN A;  2OFG X;  4RU2 A;  1RCO B;  1TUV A;  2DB1 A;  3KJV B;  2CJ9 A;  4DXL A;  4R5P B;  1N5Q A;  1H2T Z;  4X4N A;  3EUN A;  3G8S A;  1CJV B;  3GV5 B;  1M1H A;  3UCG A;  2ZC4 A;  1VQ4 S;  3K5N A;  2FVR A;  1S72 S;  3L7P A;  1NK7 A;  3C6U A;  2HHH F;  4JV5 F;  2E5H A;  2MQQ A;  2C2D A;  5KOX A;  1UZH A;  4OHV A;  4OZ3 A;  3RW7 A;  2U2F A;  1QAI A;  2AIR B;  2J6S A;  4A8O A;  1RAG B;  1EAY C;  1C0T B;  3C14 B;  3CO0 P;  1RT3 A;  3CJR A;  3R2C J;  2RRA A;  4HH0 A;  2BR0 A;  2ZFH A;  2VFS A;  3JTN A;  4KGM A;  3IBC B;  1APS A;  2IM0 A;  3VAL A;  1RE1 B;  1S1V A;  1D0E A;  1VK3 A;  3BH7 B;  1TKT B;  5AXM A;  5HQL A;  4O44 B;  1R7I A;  2NYH A;  5D0E A;  1K47 A;  4ZCI A;  3MM7 B;  4LF9 J;  1FF2 A;  2M4M A;  4L73 A;  1IQZ A;  2DIS A;  2KG0 A;  1IVZ A;  3US5 A;  3TP2 A;  1T3O A;  2HBR B;  2R3V A;  4RBV A;  3G8T A;  3TA1 A;  4DR2 F;  3BN4 A;  2M8D B;  4GKK J;  1A9N B;  2ASY A;  1WJ9 A;  1X4F A;  3ZZY A;  1GFW B;  2UXC J;  4ES3 A;  2BW7 A;  1S12 A;  3KLI A;  1KSP A;  2KFN A;  3EMT A;  2D3O 1;  1RHK B;  1FXR A;  3PYG A;  3NMA A;  1RLD A;  4C7Q A;  4DR1 J;  4A8W A;  2MQL A;  1FFS B;  2WSF C;  1RBO B;  1S48 A;  1RTD A;  5KFA A;  2VG7 A;  3VWS A;  1RUS A;  4KHP J;  4LF7 F;  2CQ2 A;  4CWB A;  4IR1 A;  3BO2 A;  5IT0 A;  3MM9 B;  3IBF B;  2DD8 S;  2WBR A;  3LAK A;  5IT4 A;  4K5S A;  2CNL B;  3VQT A;  2YKN A;  4LJM A;  2VHG A;  2XMM A;  2MTL A;  1RAH B;  1KVJ A;  4MIB A;  2PI5 A;  4WE1 A;  4IRK A;  2C2M B;  3ZTQ A;  3AA9 A;  3CCW A;  1IM6 A;  2RS2 A;  2WOM B;  4RWX A;  2ATC B;  3M1V A;  4YB7 A;  1MRO B;  1S1T B;  1N32 J;  1S0M A;  3V4I A;  3OR1 A;  3SQG B;  2CQP A;  4CYU B;  1S9G A;  3N01 A;  3QBC A;  3L95 X;  3CCU S;  3HD2 A;  5IZH A;  3LP1 B;  3B4M A;  2J7W A;  4Q2L A;  2HFZ A;  3KG1 A;  4DQQ A;  2YH0 A;  1F2G A;  1QTN B;  1NB2 A;  1UFL A;  1IJE B;  3SV3 A;  6FDR A;  3GSI A;  1X60 A;  3EDR B;  3TAM B;  3FRY A;  1GXU A;  1FRK A;  1TU0 B;  3FEZ A;  3NG8 A;  2C2E A;  1NCL A;  3FEY B;  2P6T A;  3MZI A;  3GYN A;  3CUN A;  2Z58 B;  5DDP C;  4ED8 A;  2HBQ B;  1FJG J;  1HMV A;  4IH6 A;  3MCS A;  2HRT A;  1EZZ B;  2XCP A;  2Z0G A;  3MMB B;  1TKZ B;  3CJ0 A;  3THP A;  3CNQ P;  5HVF A;  5HP1 A;  1S97 A;  1GMU A;  3KLG B;  4CLK A;  1RT6 B;  1QM9 A;  1X4H A;  2FVQ A;  4DI6 A;  2HPU A;  4N8O A;  3K5M A;  5A8R A;  1YZ6 A;  4O3P A;  3U7J A;  1EET A;  2AKW B;  1T9U A;  4I4B A;  4RNO A;  1ZA2 B;  2NCK L;  1SKU B;  1H7X A;  2IBK A;  2YKO A;  1WEZ A;  1VJQ A;  1HQE B;  4KH0 B;  3T1H J;  4W92 B;  1FRX A;  3BKT A;  1FRM A;  3AAW B;  5F8J A;  2DEI A;  2DIV A;  5BXI A;  2V68 A;  4WP8 A;  3ZTO A;  2CQ4 A;  4CI0 B;  5DDQ C;  3IP0 A;  4WZM A;  4K4W A;  3VAM A;  3OVS A;  4IRD A;  5JXS A;  3WX8 A;  1ZPW X;  2RKI B;  4YR2 A;  3H5X A;  4PG7 A;  3SIP B;  1LFW A;  2WVB A;  3NL0 A;  2K06 A;  3IAS 9;  3PRV A;  4ECX A;  2HIY A;  2XY7 A;  3PR4 A;  5FII A;  3B78 A;  1FKA F;  3W9I A;  1DY3 A;  4B9N A;  2RQM A;  1IJF B;  2XLI A;  4N76 A;  4Q0B A;  1IQT A;  4I1T A;  4U7U D;  3OSN A;  4U8Y A;  2R9L A;  3OPK A;  3VGT A;  4JI4 J;  1WOR A;  1XQI A;  3DRS A;  4JV2 A;  3CIM A;  3SCL E;  2W4C A;  3IG1 A;  5BYQ A;  1U0S A;  1S6O A;  4X4O A;  4IKA A;  1DAX A;  2CPY A;  4PKD B;  1Y4Z B;  3MED B;  2GHW A;  2CQB A;  4QZV B;  4WXO A;  2LP4 A;  1HNI A;  2IRX A;  3QAU A;  1HBU B;  1RBA A;  2F5G A;  1S6Q A;  5DGA A;  4OYW A;  1BE4 A;  4AQY F;  2R42 A;  2FJX A;  3TZW A;  3DLE A;  4M5D B;  4Y2K A;  1RWO B;  1FRH A;  3NOG A;  5L38 A;  2ALY B;  3LAN A;  1DQ8 A;  4A8S A;  2VQE J;  4KGX B;  1RTH A;  2IRY A;  2RS8 A;  2J9C A;  2M88 A;  2NSC A;  2RAQ A;  3EZO A;  3OV7 A;  2P6S A;  4ZVF A;  1U09 A;  3KLH B;  1NKC A;  2DNM A;  1P27 B;  2KZZ A;  4DV1 J;  1SB6 A;  1HNX F;  4BHQ A;  4KBI A;  2UXB F;  4WJB A;  2CQ3 A;  3HHK A;  1X9W A;  3CC2 S;  3I4P A;  2BAN A;  2RDI A;  1H2V Z;  3TQE A;  4M5I A;  3QRP A;  4M63 A;  5HLF B;  1FX2 A;  3FNN A;  2G0I A;  4OFZ A;  3LGH A;  3FKB A;  3BBB A;  2MQN A;  4FZV A;  5KG1 A;  2ATL A;  1EHW A;  2ZKU A;  2OP5 A;  2V67 A;  1U1N A;  1J5O A;  3I82 A;  2VJU A;  3QWP A;  2I5J B;  3CCE S;  4DZ6 A;  2C3M A;  3G82 A;  2IM1 A;  1JIH A;  3TW0 A;  4TYA A;  5KFC A;  2CQD A;  3VAJ A;  1PJ6 A;  1K73 T;  3LGN A;  1CS4 B;  3KJN B;  2EEY A;  2N3O A;  2QRR A;  1FWP A;  3I32 A;  2NPF A;  2ERR A;  2I1R A;  2K2P A;  4AYB D;  5B0E A;  3EGW B;  2DXD A;  3POT B;  4YHH F;  2GVD A;  4ZVE A;  3MM5 A;  4WK3 A;  5GAE U;  1EQM A;  1S0V A;  3MAQ A;  4X4T A;  3ETO A;  3K8W A;  1Q78 A;  3BZQ A;  4RR5 A;  3DGP A;  1KC8 T;  3MMA B;  2HQC A;  2V94 A;  4J9N A;  1N8R T;  1YHQ S;  3W8G A;  2DNY A;  4MFB B;  2K3K A;  3NCR A;  4LVN P;  2KT2 A;  2Z2Y B;  3G87 A;  1SCJ B;  1HWU A;  3GJQ B;  1PSD A;  3HLU A;  2O66 A;  2RUS A;  3G6Y A;  2HMI A;  4IOA Q;  4CO2 A;  1OQ6 A;  2DIU A;  4DV4 J;  3RB4 A;  2HS0 A;  2VPX B;  2GV1 A;  5RUB A;  1WUU A;  5E5N A;  3RR8 A;  1HWL A;  3QSY B;  4I6W A;  1VK8 A;  1BQM A;  2MJN A;  4F0K A;  1ZZN A;  3GR1 A;  3WC2 A;  3P96 A;  3ZFV A;  1FJE B;  4USI A;  2ZDO A;  3W2V A;  4JI8 J;  2F65 A;  3VAK A;  2VUG A;  2QMW A;  3BF4 A;  4FYW B;  5J2M A;  3SI8 A;  2UU9 F;  2CWK A;  3CED A;  2AJF E;  2GIQ A;  5DG9 A;  1YVF A;  2GIF A;  2DHH A;  2OEL A;  4B3R J;  2GNK A;  1L3S A;  2FGO A;  4C8N A;  3K5O A;  1BMQ B;  4GVB B;  3R9L A;  5DM6 Q;  2D9P A;  1TL3 A;  5KG2 A;  1HHS A;  3BGO P;  4UZC A;  3DRY A;  2JC0 A;  4NXN F;  1CVJ A;  4FF1 A;  3PM9 A;  2AJ1 A;  4F67 A;  4DSE A;  4FYY B;  1SV5 A;  1RWU A;  4O3R A;  2PEB A;  4C48 A;  1KON A;  3VGU A;  4UY8 5;  1RJJ A;  2MZR A;  2NXN A;  4JI3 J;  1LQ9 A;  4ERD A;  5LT5 A;  3W5X A;  3OQ2 A;  2ASL A;  2Q1L A;  4J7C A;  4I2P A;  1VHI A;  4I2Q A;  2ZD1 A;  5B0G A;  4DV3 F;  3IWL A;  3QFH A;  1M5V C;  5LJ5 Y;  3VQS A;  4ZLL A;  3M6W A;  1FHT A;  3M9N B;  3PCO B;  3SDE A;  3KTQ A;  1IBK J;  5LOQ A;  3S7R A;  2C28 A;  1NSK L;  4P9S A;  1LWX A;  3C15 A;  3I4H X;  4FVM A;  3R8Y A;  1WEX A;  1VCT A;  1MWY A;  1JLE B;  4L6V 3;  2R7R A;  5HO4 A;  4ZHR B;  3TI0 A;  3EE3 A;  5F3T A;  4DDF A;  2XG8 A;  1PYT A;  2ASJ A;  4KIA A;  3BPS P;  1H2U X;  2FVP A;  2X51 A;  2CJB A;  4WFN Q;  2KHD A;  4USV A;  3HHD A;  5LL6 d;  3AJD A;  2XEX A;  2KZM A;  1VI7 A;  2EC0 A;  4HYK A;  3PTW A;  2VPZ B;  1RT2 B;  1IKW B;  2J7K A;  4FDF A;  3P3D A;  4ZPV R;  1YTY A;  4CT9 A;  1X5O A;  3W62 A;  5GVQ A;  4PQA A;  1HBO B;  2Q66 A;  3ZTS A;  3OSP A;  4ZKA A;  1HW8 A;  4Q8F A;  1TVR B;  3BO4 A;  1E6Y B;  4WFY A;  4H4O B;  1S6U A;  3PO4 A;  1GEH A;  3CCJ S;  4NLR A;  1UVM A;  2XHW A;  2ZH7 A;  1VHF A;  3E3X A;  2DGX A;  2RH3 A;  2UP1 A;  2UUA J;  2NXC A;  3A8K A;  3BGL A;  3NGT A;  2QX0 A;  2XSJ B;  2WVC A;  2VG5 B;  2DNL A;  4BDP A;  4LF5 F;  1T3N A;  3DMJ B;  5CYQ A;  3OHB A;  1R0A B;  1G2E A;  1TV6 A;  3KNG A;  1W2I A;  1I5O B;  2LQ5 A;  2KM8 B;  3OL6 A;  3ULH A;  2HRY A;  3B6B A;  3M32 B;  3GE9 A;  2ZM6 F;  1N48 A;  2GHP A;  3FSY A;  1WHW A;  1HIY A;  1WSR A;  4OL8 A;  2I38 A;  3KJV A;  1CJK A;  4R5P A;  1Q53 A;  2HVI A;  3HUL A;  1CJV A;  5KFU A;  3T1A A;  2Y1I A;  5ETN A;  4AXI A;  1N34 J;  2I9S A;  3NGK A;  5LMN J;  4ZIV A;  4I67 A;  3HDS A;  2XY5 A;  1XBW A;  3SSS A;  1Y9O A;  2EWH A;  4YB1 P;  1HNV B;  1FK9 B;  1C0T A;  3C14 A;  1CJU B;  2DT9 A;  2L41 A;  2XMU A;  1GK8 A;  4HL9 A;  3SSQ A;  4OHZ A;  4WII A;  5IC4 B;  1KOO A;  1X0F A;  1VRU B;  3HJF A;  2KN4 A;  4K4X A;  1TUW A;  1UVJ A;  4RLE A;  3GIL A;  4B9V A;  5F0W A;  1SJR A;  1TKT A;  4OYM A;  1TL7 B;  1PC4 A;  2IAJ B;  3R5J B;  2EBG A;  4O44 A;  4A8Y A;  3M7V A;  1GX6 A;  3R5G A;  3JXO A;  4DUZ J;  3MM7 A;  1C1B B;  5D4O A;  2ZNY A;  1CQN A;  3TJA A;  2FD2 A;  2QL5 B;  4OZN A;  5KG4 A;  3BGF A;  1RHR B;  4LFA J;  4DQI A;  2FJV A;  4C97 A;  1N5Y B;  2NZ4 A;  2G1D A;  3QNW B;  5E3P A;  3NGR A;  5CD4 A;  2DH9 A;  3OFE A;  5A0Y B;  1VRQ C;  5ETT A;  2FPH X;  4RZR A;  3BBF A;  5CQG A;  2JEJ A;  2CQC A;  4CO4 A;  4XIU A;  1VBK A;  1GXL A;  1F9E B;  3QSI A;  3NS7 B;  4B3T J;  4AT1 B;  3CE8 A;  2ZH2 A;  2OSQ A;  1XER A;  4ICL B;  1FFW B;  1B64 A;  1Z1Z A;  4LRD A;  2MHN A;  5EDW A;  2OJ3 A;  1I94 F;  2V63 A;  4C3M A;  3I9Z A;  4GO5 X;  3MM6 B;  4LQ9 A;  4FS2 A;  1F3V A;  2EVZ A;  3HZG A;  1WNE A;  4DS5 A;  2DNZ A;  5SZT A;  7FDR A;  3V6H A;  4O0I A;  4V1A k;  2E5L F;  3QJL A;  4G65 A;  3IC1 A;  3I87 A;  4K4T A;  1PO6 A;  2E66 A;  2LXU A;  2CQI A;  1KHV A;  1TL4 A;  1TMM A;  3HT3 A;  4J9V A;  3A8I A;  3OR2 B;  4URQ U;  3SQG A;  4CYU A;  1PAU B;  3P49 B;  3OXL A;  3UWT A;  4IR9 A;  4X4U A;  3EM1 A;  1JLB B;  3LP1 A;  4C0O C;  5THW A;  3MDF A;  2OTJ S;  3NY0 A;  1QAJ A;  1VQ5 S;  5L39 A;  4MIW A;  1B7Y B;  3AD9 C;  1NME B;  4DPW A;  4KSE B;  2J76 E;  4F3M A;  4NRT A;  1LW0 B;  2DJW A;  3M9M B;  3BGR B;  3D0H E;  3GJT B;  3TAM A;  3R5A A;  4TQR A;  5HMW A;  1U02 A;  1NJW A;  1AYE A;  5JMN A;  2XMJ A;  1QLN A;  5D8H B;  4DBQ A;  5GAG I;  5KFX A;  4QIG A;  2NZC A;  4A8X A;  1SL0 A;  4UOH A;  1XNR J;  3M6V A;  5D0G A;  2AEF A;  1VGY A;  5DQH A;  3MMB A;  1TKZ A;  4ILM A;  1P8G A;  3FCH A;  3MUV P;  5E3Q A;  4ZPD A;  2RQC A;  2DHS A;  4OYA A;  3KLG A;  1JXV A;  4QR0 A;  1RT6 A;  3NWG A;  1FNX H;  3M8Q B;  1UMJ A;  3UCZ P;  2NXE A;  3DYA A;  2VQF J;  5KFJ A;  4X4P A;  2W24 A;  5HI7 A;  2AWZ A;  4H54 A;  2OEJ A;  2YXL A;  2QA2 A;  5JUM A;  4RW8 B;  1X31 C;  2QMX A;  5ADZ A;  4P75 A;  2NRE A;  1SQE A;  1HQE A;  2KB2 A;  3I0R B;  4H4K A;  1S1X B;  3DLK B;  2WSE C;  4UY8 T;  1NH8 A;  4JI2 J;  3ELH A;  2RD5 C;  1MLA A;  3Q2T C;  2XUL A;  3I0S B;  1E6V B;  3O3L A;  1FEH A;  2N3L A;  3KK1 B;  3SXL A;  1O5J A;  4I56 A;  1RKJ A;  4JI7 J;  3GIK A;  3KK3 B;  3HD1 A;  4U95 A;  2RE1 A;  3CMQ A;  3K89 A;  1W26 A;  1TMJ A;  3KDO A;  4LRE A;  1SH2 A;  2ZUA A;  2HVZ A;  5FDL A;  3MR6 A;  2V6A A;  4WYW A;  2YNF B;  2OD6 A;  4MH8 A;  3AH6 A;  3QIP A;  4RNH A;  3K0J A;  3N5B A;  1EKR A;  3U1M A;  4KJI A;  1U6Z A;  4XPC A;  3CF5 Q;  2EXU A;  1DFD A;  2F8E X;  2FLO A;  1HWI A;  2J9D A;  1FO1 A;  2WVD A;  1V6H A;  4IG3 B;  2V9K A;  2J6T A;  4LBI A;  4B3M J;  2UVV A;  2FTR A;  1OS5 A;  4OQJ A;  1HPZ B;  1QAY A;  3CXC R;  4Q45 A;  2OPS B;  1N36 F;  2G0J A;  3CB4 A;  5HAO A;  4ZVR B;  2QTW A;  1OIA A;  5GAH U;  4WF9 Q;  2UUC J;  4NX9 A;  4ECW A;  5HMX A;  3ILL A;  1IXK A;  4OMF G;  4DZD A;  1M5K C;  3GYX B;  3HVA A;  4X62 J;  5KG7 A;  4DQP A;  4OI1 A;  3K57 A;  4IFY A;  1WC5 A;  2R7S A;  2ZDP A;  2KXN B;  4M5D A;  1KVI A;  1WKJ A;  1QY7 A;  4EZ9 A;  3EJM A;  2F4V J;  1FXD A;  3CWJ A;  4DFM A;  1XMO J;  2CG8 A;  1FRL A;  2KHC A;  1NK4 A;  2LU2 A;  4LUB A;  3AFG A;  4I6Y A;  4M95 A;  4D3G A;  2CDQ A;  3QRQ A;  2V4J A;  1DTT A;  3PYE A;  1HNZ F;  3EVW A;  1D9F A;  3A8E A;  4I6A A;  1S5Z A;  4IOB A;  2DPJ A;  3M2U B;  4YB6 A;  5E0O A;  1VQY A;  2Y3Y A;  3KUH A;  2H65 B;  2C42 A;  4OYI A;  3LGM A;  4OYX A;  1SH0 A;  3UR0 A;  1HD1 A;  3NNH A;  5HBM A;  4IG0 B;  4DWI A;  1JLA B;  2I5J A;  4FVC A;  1U8S A;  2KDO A;  2QLW A;  1F1B B;  4MK7 A;  4ZVS B;  2X1A A;  2AYB A;  1CS4 A;  5EWG A;  2KI2 A;  4F36 A;  4F8R A;  5E3C A;  3EGZ A;  4K0K J;  5F8H A;  1FA0 A;  2ABY A;  1RAJ A;  1VR6 A;  1R3N A;  4PXB A;  1I51 B;  2ZZM A;  3J7Z 5;  3EPG A;  3A3O B;  4DPX A;  1HNW F;  2NS1 B;  3AD7 C;  3ILO A;  4WIQ A;  1AXQ A;  4F3O A;  1YIJ S;  2MZS A;  4DF8 A;  3MMA A;  3G6V A;  4J9K A;  3C46 A;  2OTL S;  5JVH Q;  4MFB A;  4B9U A;  3G8Q A;  4CNZ A;  2OPR B;  5H9E J;  4KT0 C;  4O4R A;  4J37 A;  4R8U B;  3LH2 S;  3SCK E;  3PX6 A;  4ZN1 A;  3TZZ A;  1QAX A;  5HN0 A;  4DV5 F;  2GS5 A;  2BM0 A;  4O3Q A;  2IA6 A;  2UXD F;  1SUQ B;  2KM8 C;  3UW1 A;  4CH1 A;  2EW0 A;  1MNE A;  2KG1 A;  3LAL A;  1JLQ B;  1RCX B;  3AOA A;  4NLO A;  1U24 A;  2ZBC A;  4BC7 A;  5E7O B;  3CCV S;  3MMC B;  1DQ9 A;  4A8K A;  1R89 A;  1WC4 A;  3MAH A;  1JB0 C;  3HFK A;  2XBP A;  1MN7 A;  3P8B B;  3CDA A;  1T8E A;  3S6E A;  4EO8 A;  2ZOF A;  2GMJ A;  2K3I A;  1YLX A;  2ZJQ Q;  3MR3 A;  2W2Q P;  1XIQ A;  3WIV A;  2H1Y A;  3N4W A;  3V81 B;  2A18 A;  4NLP A;  4DPY A;  2X3G A;  2DGS A;  2PMW A;  1BHN A;  3OVB A;  4ED0 A;  3WX4 A;  2XZT B;  3PRB A;  1Y11 A;  5D6G A;  4Z7Y A;  3SCI E;  1WD6 A;  4GVB A;  1KQF B;  2CYY A;  2CZV C;  4QW8 A;  5IWA J;  1GTH A;  5CAB A;  4JI6 F;  3TAP A;  2LVW A;  3TZY A;  2ZIT A;  4DR7 J;  4K5R A;  2R8G A;  1ZM9 A;  4FYV B;  4KKO B;  4LFC F;  2UVW A;  3C6U B;  3H90 A;  3H0P A;  1N0U A;  3A4T A;  1U2R A;  3BR9 A;  2YX7 A;  4CLF A;  4JYA F;  3U02 A;  4OJG A;  1ZM3 A;  4DR3 F;  3Q8R B;  1J5E F;  4ZLN A;  1IWA A;  1SJQ A;  1ZAX A;  3MF5 A;  4CO3 A;  5DLF A;  1CUL A;  4C8Z A;  4ECQ A;  2ZZT A;  1U7L A;  3UQS A;  3QZ8 A;  1R0C B;  2MZJ A;  1N54 B;  2HIQ A;  1FES A;  2HZA A;  1JJ4 A;  4NCA A;  4AFF A;  2MPU A;  3V6K A;  2VA2 A;  2DNK A;  5EX0 A;  2C22 A;  3S8S A;  3PO5 A;  5T41 A;  3CJK B;  2L9W A;  4N47 A;  4C0B A;  4HEA 9;  4ITS A;  2VKZ G;  2VH7 A;  2FY8 A;  3MHY A;  1VLY A;  4PWD B;  3HFZ B;  4OX9 J;  3FBE A;  1YIT S;  5B09 A;  5HK4 A;  4ZVQ B;  1K44 A;  4LFB F;  3KLF B;  4DLE A;  1JLE A;  4N8N A;  3IO1 A;  2IMO A;  4CM2 A;  4TU7 A;  1T9Y A;  4QR1 A;  5L46 A;  2BJ3 A;  4AND A;  3LO3 A;  2HWH A;  1SKR A;  3QLH B;  1KEK A;  1X4A A;  2B6A B;  2MEW A;  4DV6 J;  3KJF B;  2CPF A;  2CQ0 A;  2D41 A;  1RT2 A;  2EPI A;  3JSM B;  4DV2 F;  1KNZ A;  2YNI B;  2HG4 A;  1HBO A;  2JLG A;  1FDN A;  1H98 A;  1QVG R;  1FRI A;  1KQK A;  1S6P A;  2VC0 A;  1TVR A;  1E6Y A;  5KOW A;  3QZ7 A;  4DL0 C;  1S57 A;  2CJK A;  3OTB A;  2E1C A;  1FTR A;  2XWY A;  3WC0 A;  2A6M A;  3DHX A;  3NCQ A;  4K4S A;  4OIX A;  3N6L A;  1QVF R;  5KT2 A;  1YJU A;  2KRR A;  2QT7 A;  2OFH X;  1KR4 A;  1U49 A;  3RAQ A;  3P6Y C;  3MM8 A;  2XSJ A;  4UOG A;  2VG5 A;  3R7S B;  3D9B A;  4UW2 A;  1X4C A;  3CIZ A;  4ZPA A;  3EXY A;  1R0A A;  3Q22 A;  4PXD A;  2AEJ A;  2K7J A;  8ATC B;  5F8M A;  2ACM A;  2M8H A;  3M32 A;  4NYZ A;  4QYR A;  4C8O A;  2FHK A;  3D67 A;  2XMV A;  4X4V A;  5KT6 A;  5EX3 A;  1YQH A;  4IFV B;  3OR1 B;  3CC4 S;  5D0R A;  2HLU A;  1N5S A;  3RAX A;  2KRB A;  4CLZ A;  3PIP Q;  4DUY J;  2A6O A;  3CDU A;  3V4M A;  4LF2 A;  2ZBI A;  1JKH A;  3SFG A;  2IC3 B;  1S0N A;  4U7U K;  3NNA A;  2R7V A;  3I5B A;  1KP6 A;  3NS5 A;  2H51 B;  3PRD A;  4F2R A;  4XK8 C;  3NRB A;  3WBZ A;  3Q0A A;  2J9D E;  5IV4 A;  1BQN B;  4HAC B;  1HNV A;  2WSC C;  1CJU A;  3AXK A;  2QO3 A;  3W65 A;  1HMV B;  4QWD A;  3SBM A;  3CCZ A;  3W2W B;  1S9E A;  1VRU A;  4PQU A;  1D1U A;  1YI2 S;  4P72 A;  4GMK A;  3PR5 B;  2H4Y B;  1TL7 A;  2OI2 A;  2IAJ A;  3QMQ A;  2IIH A;  2IVM A;  1C1B A;  1AUD A;  2EG2 A;  4E98 A;  3RBE A;  2HYI B;  3GG0 A;  4QU6 A;  4CLP A;  2CPJ A;  1JLG B;  4IQM A;  4OLP A;  1I1G A;  2CPI A;  2MDA A;  2J0X A;  3WIU A;  2KYZ A;  1N5Y A;  2DY9 A;  3HHN B;  3ENQ A;  4DSI A;  3OFF A;  4WZQ A;  4IH7 A;  5A0Y A;  3W1Y C;  2DTJ A;  3SQO P;  4IQX A;  1KD1 T;  4CH0 S;  4R0E A;  2DNH A;  2GJI A;  4PWW A;  4ZJQ A;  3W9H A;  2CJQ A;  2AF6 A;  2ZUG A;  2BQ3 A;  4Q7A A;  4ETX A;  3CCQ S;  5DQI A;  3FJ2 A;  4E2F B;  1BD6 A;  3BYR A;  1U6B A;  2XGP A;  2QLX A;  2CWX A;  1HHQ A;  3F41 A;  3TQ1 A;  2DVI A;  3E2E A;  1YK9 A;  3J7Z T;  3NP5 A;  1UL3 A;  1G4C A;  3GMG A;  3R5D A;  3U1L A;  4Q0B B;  3UO0 A;  3LAM A;  3Q8U A;  3SZ2 A;  4GO7 X;  3RRK A;  3AJ1 A;  5G4D A;  2WON B;  3H7H B;  1MN9 A;  1OSD A;  4FF2 A;  5K20 B;  1FD8 A;  2YKM B;  4LF9 F;  2BE9 B;  4DOZ A;  4F04 B;  4RBT A;  4NA2 A;  5GAD I;  3C66 A;  3IG1 B;  2XCA A;  3HHL D;  2MQM A;  2J6U A;  2DYA A;  4O0N A;  4GKK F;  3BR8 A;  2ADB A;  2WW8 A;  1OJ4 A;  2UXC F;  3V6D B;  5C2G A;  6FD1 A;  1DTQ A;  2X3D A;  5CA5 A;  3TUZ C;  4M5H A;  2ALZ A;  1JJC B;  3CJS A;  5F8N A;  1JLB A;  2YX4 A;  2WB1 D;  2HQ3 A;  2YNH B;  2PC6 A;  1V5I B;  1RKI A;  4DR1 F;  2F8H A;  4Y2C A;  3BS9 A;  2FDN A;  4KHP F;  1RT1 B;  4WXW A;  5K8P A;  3BGR A;  1SPB P;  2BJ9 A;  2H4W B;  2QJ3 A;  1AT1 B;  3BYP A;  2OLW A;  1R31 A;  9RUB A;  2UXB J;  3PIO Q;  4F02 A;  5U47 A;  1V9O A;  2DBB A;  4G1P A;  1VQ9 S;  3OTO J;  2H9Z A;  4ECR A;  4M8L A;  3NWR A;  3KG0 A;  2BUN A;  4ES1 A;  5J2P B;  1JX4 A;  1F0X A;  3W63 A;  1F5A A;  4CLT A;  1V5V A;  4TKT A;  4MYU A;  2HWT A;  4KGV B;  1N32 F;  2N4D A;  3QJJ A;  4EMD A;  3LWM A;  2ASD A;  1XEZ A;  4HI2 A;  1ICE B;  4AUK A;  4O3S A;  4RW8 A;  2GC8 A;  2ROP A;  4FF3 A;  3TA0 A;  4YHH J;  3I0R A;  1S1X A;  3W9J A;  2Y1R I;  2V8P A;  2HS4 A;  1E6V A;  3KK1 A;  2BE2 B;  1F2H A;  2W2O P;  1VQ8 S;  4QCL A;  4JI0 J;  2LKZ A;  1O0P A;  5C2C A;  1O51 A;  2KL8 A;  3D1Q A;  4ELU A;  3IAM 9;  2QV6 A;  1PBU A;  1KLN A;  1FJG F;  2QLJ B;  3FFI A;  2FGC A;  4RWW A;  2QG9 B;  3BB5 A;  1D3W A;  4DN9 A;  3GSD A;  1RK8 A;  4U96 A;  1OY8 A;  4RW7 B;  4QWE A;  1Q95 G;  2YTC A;  4HLB A;  1XR5 A;  3PW7 A;  2AW0 A;  2D7S A;  3DHW C;  4WFX A;  2V69 A;  2W2P P;  3R2D J;  2F8M A;  3L3C A;  1F5C A;  5BJR A;  1NZA A;  2DRD A;  3GP9 A;  1XTZ A;  2F7V A;  2UV8 G;  3ET6 A;  5KG3 A;  3HSG A;  3IXQ A;  4PYA A;  2DEJ A;  1XMB A;  1HBN B;  1X4B A;  1HPZ A;  5KFH A;  2PSZ A;  2OPS A;  3G96 A;  4J90 A;  4NPO A;  2RDJ A;  1T9X A;  3OJS A;  4NWB A;  4OYB A;  2OIH A;  3FBB A;  3VGV A;  3UD5 A;  2JWN A;  3U1N A;  2YWE A;  4PZV A;  4NLV A;  4EBD A;  2A0F B;  2M52 A;  1P9Y A;  4ENO A;  1R8B A;  2R7T A;  3TAQ A;  1MG7 A;  2AZ1 A;  2RB7 A;  2CNN B;  5JVG Q;  3BSO A;  1NBE B;  2B0G A;  4N41 A;  4DHV A;  1IBC B;  3IN5 A;  1ZS6 A;  2E5J A;  4IO1 A;  2LEA A;  2DXF A;  2CNO B;  4M5G A;  4ELV A;  5IT9 U;  1U6F A;  3ITH B;  3ENV A;  1NDP A;  1DRZ A;  3T5H A;  3NNC A;  2XY6 A;  2VBY A;  1S99 A;  4MYT A;  2MUI A;  1BUX A;  5EN1 A;  1GMV A;  1YWX A;  5M2P A;  2B4U A;  4N56 A;  2Y0S D;  4JI4 F;  1X7V A;  1WHX A;  4F3Q A;  2ZHA A;  2W9A A;  5LMU J;  2KXH A;  1TAU A;  2E5G A;  1Q79 A;  5ITH A;  2EKY A;  3RRG A;  1QJH A;  2VA3 A;  1UJ6 A;  1FXL A;  4DR6 J;  1Y10 A;  2HGN A;  1M0S A;  2BA9 A;  4USH A;  2GJF A;  1NPK A;  1NDK A;  1SQG A;  3JS9 A;  2MY8 A;  2LQ9 A;  4IG0 A;  4Y3C A;  4RNF A;  3IRW P;  1JLA A;  2ZD1 B;  1YJR A;  5KFD A;  2XGQ A;  4OZJ A;  4DV0 J;  2AX0 A;  1WG4 A;  4CLU A;  1PJ7 A;  4OV1 A;  3HO1 A;  2MJU A;  1RWX B;  3P4U B;  3SDE B;  4DPO A;  1KRP A;  4LQ3 A;  2A3J A;  2CVE A;  1DJ0 A;  3C15 B;  1R0B G;  3TEH B;  3Q8S B;  2VQE F;  4WP3 A;  3I56 S;  4I7F B;  5DET A;  2XSF A;  4DCO B;  3GR0 A;  2BDP A;  2K7K A;  2QSF A;  2MGZ A;  5LSR A;  3JB9 k;  4OJ1 A;  2I6W A;  3T3F A;  2VKR A;  4Y28 C;  1C2P A;  1GQE A;  1NDL A;  1QSY A;  4GRS A;  4DV1 F;  3TAR A;  5L1J A;  4R8U A;  4OZ1 A;  1I6J A;  2MKS A;  4U67 Q;  2VBX A;  3D7S B;  3F56 A;  4DMZ A;  5L9X A;  3TZX A;  4ZCK A;  1RWW B;  1TKX A;  2YNG B;  2MXY A;  2C3U A;  4UTG A;  3NBP B;  4K4Y A;  2V4R A;  2EKN A;  3OUY B;  2MB0 B;  3MMC A;  1KKH A;  2HRU A;  4NE9 C;  2Z2Z A;  4Y2A A;  3HCX A;  3OXG A;  4Q8E A;  4BBY A;  3FC9 A;  2BJD A;  4RW9 B;  5D15 A;  4LF5 J;  3KLE A;  1VBX A;  2RNE A;  3JYT B;  1W7W A;  2BJE A;  2ZJP Q;  4NLW A;  3KMS A;  2Q79 A;  3THV A;  1XNQ J;  3GIJ A;  5DG8 A;  3DLJ A;  1OPZ A;  1Z2L A;  2PD1 A;  4ED5 A;  2W01 A;  1S77 D;  2ZWP A;  1HAR A;  4O23 A;  4ER8 A;  4NA1 A;  5KFT A;  2FJB B;  1EQ0 A;  4DPU A;  4X66 J;  2VDH A;  1N33 J;  1CJK B;  3LOU A;  2WVF A;  4TNO A;  2VBZ A;  4DX5 A;  3PV8 A;  1NU4 A;  3DKD A;  3HK2 A;  4K2X A;  3RB6 A;  1IBL J;  3LP0 B;  3H4D A;  1WDD A;  4KKO A;  1URN A;  3OTC A;  1KLM B;  3KHL A;  2IRU A;  4P7T A;  1GAO A;  2BZ2 A;  2CKW A;  2Z57 B;  3ZZO A;  4J9S A;  2OMO A;  3T1Y J;  5HMZ A;  4DU8 A;  2OEM A;  3MEG B;  4TYB A;  4B3S J;  1YJV A;  2MLZ A;  4ANE A;  3KG4 A;  1ZYQ A;  3ZZZ A;  3PZP A;  1Q4R A;  4LVO P;  1VIO A;  3KMQ A;  4JI8 F;  3T9Z A;  4F4K A;  2ZH9 A;  1JJ2 R;  1N0V C;  3QWU A;  1R6Y A;  2PFD A;  1IR0 A;  1TAQ A;  3WQP A;  2HNY B;  4UST A;  2D9O A;  3DCA A;  2HVH A;  3UPF A;  2BKP A;  3FSI A;  3MAA B;  3CJK A;  4B3R F;  1TK0 A;  1C4A A;  4NLY A;  4JBC A;  4PWD A;  1VQO S;  1JQG A;  3KLF A;  2KXF A;  3GON A;  4J5O A;  1YG0 A;  4XAK A;  4BS2 A;  4FXV A;  4KC5 A;  2IYI A;  4IO9 Q;  2RSQ A;  2DO8 A;  4PPZ A;  5GMK a;  2RF2 B;  1Y7P A;  3QLH A;  2IDL A;  3L9Z A;  2LU1 A;  2B6A A;  2VPY B;  4QPT A;  3TVK A;  4DCP B;  3IMQ J;  3O6Q A;  1Q5Y A;  3MEC B;  3JSM A;  1M5P C;  2IJF A;  4OX6 A;  4JI3 F;  2YNI A;  1I94 J;  2JSX A;  1C4C A;  1VRT A;  3IS9 B;  2JHE A;  3ZNJ 1;  2IPO B;  3OT9 A;  9ATC B;  2FLP A;  2YKP A;  1VIS A;  3T6B A;  4UOF A;  4ZIT A;  1SC6 A;  2G2Z A;  4RW4 B;  1SIW B;  3DDI A;  1UVK A;  2KJV A;  3MCN A;  3DXB A;  1F9F A;  4KHM A;  2HK2 A;  1FKP B;  4OI3 A;  3GV7 B;  3OVA A;  4P2F A;  3EIC A;  1U1K A;  1HLW A;  2D1C A;  3FUY A;  2DO0 A;  3ZTP A;  5KT7 A;  2DNR A;  4JV1 A;  2X1F A;  1EB0 A;  3ETM A;  1ZM2 A;  4LMZ A;  3GCX P;  1O6X A;  1N56 A;  2CPX A;  3GU0 A;  5HMY A;  1UA1 A;  1RT5 A;  2W2M P;  2AEM A;  3DOL B;  1D9A A;  1OY9 A;  4IFV A;  3D3C J;  3Q83 A;  4EU0 A;  4RUC A;  4RKU C;  4Y00 A;  3B8H A;  2E29 A;  1B99 A;  1RBL A;  3H5Y A;  4TY8 A;  2LFV A;  5F8L A;  1T03 B;  3IRX B;  2NQP A;  2IC3 A;  2V0N A;  1N5T A;  2OSR A;  1U1L A;  3HKZ D;  1TR0 A;  1UEK A;  3CJ2 A;  3QJP A;  1UEV A;  3CME S;  1WTB A;  2RDD A;  1F6T A;  1HI1 A;  2VG6 B;  4OI6 A;  3KKF A;  4DS4 A;  3T41 A;  1BQN A;  2XS2 A;  4NRU A;  4K50 A;  4HAC A;  2XYH B;  3M6U A;  4F0M A;  2UUA F;  1LFP A;  1YX2 A;  2C2N A;  4ZVT B;  1VC6 A;  3QAT A;  1PYS B;  2MHE A;  3W2W A;  1R8P A;  2YQ0 A;  5AE2 A;  1PIL A;  1RAI B;  3HI9 A;  4X64 F;  4HHJ A;  1PIE A;  4OX8 A;  2GML A;  2G9O A;  3DYA B;  1ZBT A;  4ZPW R;  3S1T A;  1VS3 A;  2EFV A;  2YPZ A;  4PYD A;  2DK2 A;  3PX4 A;  1JLG A;  3NGU A;  1A0O B;  1PJ5 A;  2IM2 A;  4UQG A;  4C8M A;  2E1A A;  3R5C A;  1N34 F;  1NAQ A;  4BWJ A;  1ZA1 B;  1HYS A;  2P9E A;  1ZPV A;  4WFB Q;  3D6H B;  2NXJ A;  1FD2 A;  1JLC A;  3D66 A;  1YSJ A;  4L75 A;  2PA3 A;  4C8K A;  4XDD A;  2ZHB A;  1RAD B;  3RZA A;  2DGQ A;  4L3K A;  3KFW X;  1S1W A;  1RQ0 A;  1RTI B;  3NAI A;  3HZE A;  3RU0 A;  3PAC A;  3R7N B;  1Y3J A;  2C3P A;  5FDL B;  2P9C A;  4I64 A;  5AE1 A;  3CDB A;  3DOK A;  1JJH A;  4WK1 A;  4CZC A;  3QIP B;  2LEC A;  5F8I A;  1WF0 A;  2M70 A;  1W2B R;  3AOD A;  2JZ5 A;  4NLS A;  2WON A;  4ATN A;  4DUZ F;  1UWB B;  5T14 A;  3G86 A;  2YKM A;  1NK8 A;  3OFG A;  2ZJR Q;  7FD1 A;  2G2Y A;  2YWG A;  2V2Q A;  1WC3 A;  4QPX A;  1I3O B;  4LFA F;  2F9J A;  2Y8Y A;  2LCW A;  4ID8 A;  3L09 A;  2B9E A;  1P1L A;  1H74 A;  1X5S A;  2WW4 A;  1KHW A;  2R7U A;  2Q3P A;  3HHL B;  3CCL S;  3LA0 A;  3BKF A;  1IKV B;  4NLX A;  4Q43 A;  4ZOS A;  3V6D A;  4U8V A;  3FDS A;  2JFK A;  3HSJ A;  3JSB A;  4BC9 A;  3GII A;  4DSJ A;  2LQ8 A;  2YNH A;  3H4B A;  2AGP A;  2DRA A;  1L3U A;  4B3T F;  3DM2 B;  2RU3 A;  4IFY B;  5EGY A;  1UVI A;  3R5B A;  3OL7 A;  3UDL A;  2GFF A;  2KT5 A;  4G1Q B;  1RT1 A;  4NEY A;  4LRC A;  4B08 A;  2D74 B;  2FQQ B;  4EK2 A;  5IT9 Y;  1T94 A;  1S4E A;  3PW5 A;  3ENW A;  4C9D A;  3G71 S;  4DSL A;  4L72 B;  2V4J B;  1DTT B;  1K0V A;  4I69 A;  5B0D A;  2HEK A;  2E44 A;  1LK7 A;  5KFE A;  1P6T A;  2W8L A;  4KV8 A;  2Z30 B;  2M3D A;  3W7B A;  2OAU A;  1FWK A;  4Z2X A;  2QFJ A;  2MYF A;  1RZM A;  1NPR A;  5FD1 A;  5J2P A;  1U8W A;  3CDW A;  3R1H A;  3K58 A;  3M2V A;  2HLT A;  1NUE A;  1RU2 A;  3ENA A;  3A8J A;  2YWW A;  4DL3 A;  2GA7 A;  2DHX A;  3OD2 A;  5HBM B;  1TUG B;  3QPI A;  1PBA A;  3FQL A;  3NMR A;  3MPU B;  5LJ3 Y;  3H25 A;  2MKC A;  5M2R A;  3EWG A;  3RW6 A;  1NZ8 A;  4YEA A;  2AU0 A;  2HWI A;  4IUF A;  2GO8 A;  4ZMM A;  5KFK A;  4C0H A;  1YBT A;  5AJ3 F;  5KFQ A;  1Y0H A;  1OYE A;  4DJB A;  2YH1 A;  2QEX S;  1LWF B;  4B02 A;  5DJB A;  3NGS A;  5K8O A;  5KFR A;  1PC5 A;  1H6K X;  2BE2 A;  5KG5 A;  2KVI A;  4A46 A;  4ECT A;  2BAC A;  5CD4 H;  1NB7 A;  1XNR F;  4L76 A;  1WF2 A;  2YPY A;  3JSR A;  1VQK S;  1X5T A;  2W1B A;  2IVY A;  4HTJ A;  2POK A;  1G6B A;  4PAB A;  1M1G A;  2IJR A;  4NZ7 A;  5L1K A;  3VAI A;  1S4F A;  4RW7 A;  3EZ5 A;  3AOB A;  3SV4 A;  4HKQ A;  1UW4 A;  2H3E B;  3GIM A;  3K5P A;  2VQF F;  3BDE A;  3Q86 A;  3I6P A;  5C25 B;  4CLW A;  2APO A;  3GLJ A;  2J0S D;  3Q89 A;  4HT7 A;  4NEZ A;  4FBT A;  3BSC A;  3TVY A;  1HBN A;  3UN5 A;  3R1L A;  2CPD A;  3OXF A;  2RHQ B;  2QYC A;  3NOC A;  1MWZ A;  2BJ1 A;  1B0P A;  2DCL A;  3TR5 A;  4L74 A;  3D3B J;  3GJR B;  4FXW A;  5EWE A;  1RAE B;  2DIT A;  4FP9 A;  3SSR A;  3MMJ A;  3DC2 A;  2AT1 B;  4UZB A;  4JI7 F;  2P8I A;  3GPA A;  1PCA A;  2CQG A;  3QYY A;  1HL6 A;  1RWP B;  3Q8Q B;  2ZE2 B;  2NUH A;  2FZC B;  4K4U A;  3J81 U;  2KH9 A;  5KT3 A;  2ACY A;  2VAS A;  1N5V A;  3ITH A;  1OO0 B;  1UTA A;  2HNZ B;  2GVZ B;  5H9F J;  4YP3 A;  3M8R A;  2F40 A;  1HFE L;  4E8U A;  5A2Q U;  1Q5V A;  4ES2 A;  3T5J A;  3HFV A;  4AD6 A;  2HFU A;  3C8Y A;  2ILZ A;  2AGQ A;  2DHG A;  2M5Y A;  4CLS A;  3UN2 A;  4B3M F;  1MMN A;  5D78 A;  4RO0 A;  8RUC A;  2MKH A;  2HHV A;  4OZ0 A;  1SJ1 A;  1CUL B;  1IUJ A;  1BGX T;  2ZH6 A;  2MQ8 A;  5KFI A;  5BR8 J;  5IM0 B;  4F2S A;  1WF1 A;  2ZZN A;  2ZNZ A;  2UUC F;  4EO6 A;  2XI3 A;  3F73 A;  3MOZ A;  2VF3 A;  2ZH8 A;  4C4W A;  5H1S V;  2D3O R;  4X62 F;  1CPZ A;  1Q7L B;  5CAA A;  3SEO A;  1F3F A;  4ED7 A;  5C5J A;  3DNC A;  1F9H A;  1FT8 A;  4KO0 A;  3MI7 X;  2CRL A;  1KBR A;  1U2C A;  5GAG U;  3J7Y I;  1AZS A;  2F4V F;  1K0T A;  1QSS A;  1XMO F;  3QAE A;  4ETZ A;  4I7F A;  5DM7 Q;  1K8A T;  2A2D A;  3M4X A;  1NXI A;  4PXE A;  3N9U C;  2L9N A;  2YQ1 A;  1OSC A;  3VGS A;  1GT8 A;  3V2U C;  4RUA A;  1U0H B;  3TWZ A;  4PCQ A;  4QIV A;  3GIR A;  2CVI A;  2MZ1 A;  5J2Q B;  1U25 A;  3RBZ A;  4JI5 J;  3RGI A;  3BH6 B;  4DX6 A;  4TVA B;  2X7I A;  2YNG A;  3CGI A;  1U26 A;  3NBP A;  5HL7 Q;  1TKD A;  3OUY A;  3BBC A;  1S6P B;  2GS8 A;  3K8V A;  1BWV A;  2CNK B;  2V50 A;  4JB8 B;  1FCA A;  2JLF A;  4TY9 A;  3FRZ A;  3LW5 C;  4RW9 A;  3CCS S;  4LRF A;  4C11 B;  4K0K F;  2V8H A;  2CZ9 A;  5MLC V;  5KFV A;  2F4F A;  3MM8 B;  3JYT A;  2VL1 A;  2YBV A;  1FJ7 A;  3M8Y A;  3PEJ A;  2NLW A;  1SC4 B;  1RAF B;  2XO7 A;  3PHT A;  4NA3 A;  3DI6 B;  2JNJ A;  4AL6 A;  1W25 A;  1K1S A;  1RAC B;  1FVQ A;  2GGP B;  2HHU A;  1NSA A;  1JK9 B;  2GIR A;  3PY8 A;  2IDE A;  2PMZ D;  4YME A;  1RAA B;  1S49 A;  3KK2 A;  3K17 A;  1HI0 P;  3BKU A;  4P2X A;  2L3M A;  1XMQ J;  1HD0 A;  1XR6 A;  4B3O B;  3D54 A;  1JKH B;  4DR4 J;  3LP0 A;  2ZVS A;  2FB0 A;  1RU1 A;  3J7A 1;  4HH1 A;  1KLM A;  2XZW A;  4G6V B;  3MEG A;  1CJT B;  3I5A A;  4F4W A;  4N77 A;  1BWE A;  1RP5 A;  2C2Z B;  1JLF B;  1NND A;  2OPP B;  2J9E A;  3HT0 A;  1UAW A;  2UV8 A;  1JXL A;  4NXM F;  4H4K C;  2E1R A;  4UF4 A;  2JH3 A;  4WKY A;  3R6G B;  1YDL A;  2H5J B;  4DR5 F;  2HNY A;  1S9E B;  2VOP A;  4U7C A;  4WP9 A;  1LWC B;  2V8V A;  4PQU B;  2GMH A;  1SI9 A;  3MAA A;  5IQQ A;  2I2Y A;  4IOC Q;  2D3Z A;  1VQS A;  2DGV A;  4USM A;  2QN6 B;  1T95 A;  3RAM A;  2Z4P A;  3H8Y A;  5B0A A;  5K14 B;  1NLK L;  3DXS X;  1ZH5 A;  5IWA F;  3TUP A;  2HHS A;  1EJ7 L;  2J0W A;  2JEG A;  4DR7 F;  2C3Y A;  1IBM J;  4Y34 A;  1IKX B;  4DG1 B;  2XYG B;  4FKY A;  1TFY A;  2RF2 A;  2Y0B B;  5MAO A;  3NXZ A;  4U9R A;  4ZCL A;  1KTV A;  2R8I A;  3CCM S;  5DDO C;  1X9S A;  1ROF A;  1WI6 A;  2O3D A;  3CD0 A;  3MEC A;  2OUG A;  1NM2 A;  3ZZP A;  1KS2 A;  4A8Q A;  4W90 B;  1TZ0 A;  1JNZ B;  4YY3 J;  3IS9 A;  3AA8 A;  1X4G A;  4IH5 A;  3HVT B;  5IFM A;  2IY5 B;  4NLQ A;  3DOM B;  5HAT A;  1SJ3 P;  3HHL C;  4UUX A;  1QSL A;  1V3S A;  1RHU B;  1HA1 A;  4FPR A;  4RW4 A;  1NJI T;  2EFN A;  3CJ8 A;  4F26 A;  2JFD A;  2XZD B;  5GMD A;  3GFY A;  3RG6 A;  1FKP A;  1M5H A;  5D3G B;  1ZTT A;  2RML A;  2X1G A;  2CQH A;  3ZTR A;  4KQZ A;  5T7L B;  4OX9 F;  2PEH A;  1RYS A;  1YJW S;  1V3Z A;  2IMW P;  2KYX A;  4A8M P;  5ETS A;  1SL2 A;  2I0X A;  1O8B A;  3SFU A;  1HR0 J;  2HVE A;  3BQ2 A;  2OPQ B;  4HR2 A;  2AJ4 A;  4V19 J;  5EHH A;  1R6V A;  1HKA A;  3G4S S;  1Q0N A;  1RAB B;  4NLD A;  3DOL A;  1YJ7 A;  4CLL A;  1JMT A;  4DV6 F;  4LR7 A;  1DTQ B;  4XO0 A;  5I42 B;  3UNY A;  3ILJ A;  1QTM A;  4C3L A;  2UUB J;  1J27 A;  4YR3 A;  1T03 A;  3IRX A;  2L08 A;  3ZC4 A;  1FEE A;  2B3T B;  3AHP A;  2XI2 A;  2HGM A;  4RJV A;  2HK3 A;  1RWK B;  1WHV A;  2VG6 A;  2B43 A;  3TEG A;  1FKO B;  4A4J A;  3JQK A;  1KQG B;  3ZZU A;  4KRW A;  1EX8 A;  4GC7 A;  4LF6 F;  4LF4 J;  4NCB A;  1KOH A;  4P10 A;  1PKU A;  2NUU G;  2QA4 G;  3HX9 A;  1WEY A;  5IV3 A;  3W5Z A;  4M5N A;  4USU A;  2MKK A;  2RT3 A;  5K8N A;  3AB2 B;  1LK5 A;  1Q8B A;  2UUT A;  3T5L A;  2OML A;  4OHW A;  4ZJO A;  4Q2M A;  5AT1 B;  2AYG A;  2C3O A;  3FVY A;  3HF5 A;  5KFM A;  5EUH A;  3UNG C;  5HVG A;  1D9D A;  2KKH A;  3PEH A;  2FZK B;  2B51 A;  4DUY F;  1MU2 B;  3AB4 B;  4DLG A;  2BOP A;  4WBF A;  1RHJ B;  1U1Q A;  4JI1 J; 
#chains in the Genus database with same CATH homology
 2HRX A;  2EW0 A;  2MUI A;  2DO8 A;  2AJ2 A;  2GZO A;  2GS5 A;  2HAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...