2GZSA

Enterobactin hydolase iroe complex with dfp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
265
structure length
249
Chain Sequence
PNIADKGSVFYHFSATSFDSVDGTRHYRVWTAVPNTTAPASGYPILYMLDGNAVMDRLDDELLKQLSEKTPPVIVAVGYQTNLPFDLNSRAYDYTPAAESRKTDLHRKSGGSNNFRQLLETRIAPKVEQGLNIDRQRRGLWGHSYGGLFVLDSWLSSSYFRSYYSASPSLGRGYDALLSRVTAVEPLQFCTKHLAIMEGSAGVLSKIHTTLTILKDKGVNAVFWDFPNLGHGPMFNASFRQALLDISGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IroE protein
publication title Structural Characterization of Enterobactin Hydrolase IroE.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 84
structure length 249
sequence length 265
ec nomenclature
pdb deposition date 2006-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gzsA00
2XUFA 2J4FA 2WJ4A 4EY7A 2VT7A 4LHEA 4HXFB 4HVTA 1A8UA 2WHQA 4Q82A 3WA7A 4U2DA 2Z3WA 4WY8A 2WM2A 4MYSA 1QIDA 3H2GA 3IUNA 2YYSA 4W9RA 2BUCA 4TVKA 3WKAA 3NUZA 4RGYA 1UK8A 4DMCA 3V1LA 2W6CX 4BP8A 2WTNA 5ALKA 4WFKA 2DHEA 1R9NA 5JAHA 1N1MA 4QWMA 1QO9A 4M0FA 3ICVA 5CH3A 2WQZA 1ZD5A 4U2EA 2VJBA 1CUDA 4N8EA 4B83A 5AKXA 1ZGBA 4FFWA 1XQWA 1F8UA 3VKFA 4FTWA 4ZREA 1U8EA 2YASA 3HEAA 4B82A 1R3DA 1XRLA 1UZAA 4UUQA 3ICWA 3C87A 1QFMA 4UFPA 2XMBA 5AK4A 2VJDA 1IVYA 3E1GA 4K6KA 2QXUA 5HF6A 1UKAA 3STYA 4A5SA 1QIHA 1TKRA 2RI6A 3DOHA 4ROTA 5CBKA 4DNFA 2OCLA 2VEOA 1CQZA 2XT0A 2FX5A 4G8BA 3P2MA 1Q0ZA 4KRYA 2W22A 2PU5A 4HXGA 3WZMA 3G0CA 3AIMA 5AIBA 3WWCA 4FBLA 1OILA 3DD5A 4BCDA 2XUPA 1MTZA 5AK5A 4ITVA 5FPPA 1JT2A 1YB6A 4QDTA 4E46A 4WY5A 5AM3A 1NU6A 5AP9A 5A62A 1UOPA 4B6GA 2WU4A 3DEAA 1IUNA 2AXEA 2QS9A 3VXKA 4FHZA 3AINA 1CUCA 3FWHA 3QMWA 3WWEA 4DMHA 2CKMA 3C6BA 4AXBA 5A7FA 4FFVA 4LXHA 3O4HA 5ALTA 4B9AA 3VJMA 1WHTA 3H2JA 3RLIA 1GPLA 1K6EA 2Y1KA 3DYIA 4JUIA 4DNPA 3FYTA 2ZYRA 2RAUA 4UBMA 4PSCA 4L0CA 4GHWA 4ZRDA 2DCMA 3G9TA 1ZICA 4XJVA 2ROQA 2PKYX 2WUFA 4LYEA 5SYMA 3SK0A 4V2IA 3CCCA 5E4JA 4BTVA 4KAAA 5FPQA 3DS8A 4B9EA 1EB9A 1DX4A 4G5XA 3E0XA 3QMVA 2PSHA 1B41A 5D6OA 3LS2A 3BXPA 4FLMA 5AKYA 3D2CA 1TAHA 3G0IA 4B85A 3WK5A 1EB8A 3I2IA 1KU6A 1GQRA 2QJRA 4AO7A 4DTCA 3G0BA 3DDUA 1GT6A 3TRDA 5F4ZA 2XQGA 4AZ0A 5D7BA 3D5EA 5AI4A 1UK7A 4HZGA 5KWIA 2R11A 3ED1A 1XRQA 1EVEA 2QR5A 5HCUA 3FSGA 4W1QA 4GI1A 3PFCA 5JZBA 1GKLA 1N8SA 4RE6A 3G0GA 3C6ZA 2PSDA 5I9IA 1YR2A 5K3BA 2XB6A 2EEPA 3VISA 4IH1A 1LPSA 4W1SA 2JGJA 4WDQA 1C4XA 1YB7A 3WKCA 1FJ2A 1MNQA 3FOBA 1JJFA 3R41A 5IVDA 2QZPA 2GBIA 5D3ZA 5LZ7A 3D2AA 4FLEA 2K2QB 4GDMA 4UHBA 2BCEA 4BE9A 5ALUA 5AIAA 2JGEA 3HABA 1PV1A 4AMYA 2WUEA 3BDVA 5ALWA 2XMSA 3IIIA 2VJAA 1ORWA 3GUUA 4GWLA 3F98A 1XZCA 4XIIA 1E5TA 2O7RA 4N5IX 2D5LA 1XQVA 2XQKA 3DLTA 1B6GA 1BCSA 1F6WA 4O08A 2XDWA 2RHWA 5E4TA 5T4HA 1MPXA 5LZ8A 1H23A 2HL6A 4KACA 2OPHA 3FLAA 1SOMA 4NVRA 2RHTA 2ZYSA 2OG1A 4UHHA 4FMPA 4KE7A 2XE4A 4H7EA 4OPMA 5AKHA 4JNCA 2OGTA 3R3UA 3WI7A 4X92A 4PQEA 4AZ3A 1AMNA 5A2GA 4QZVA 4X6XA 1AX9A 4MQLA 3IVMA 2VTVA 1QTRA 2CJPA 1WB6A 2Z8XA 4ZI5A 1XZAA 3DL4A 5CH5A 5FXMA 3RK4A 1VZ3A 4IH4A 3H04A 4LXIA 2XMCA 3L1HA 5T4BA 4AMZA 4X93A 1RWQA 5LZ2A 1XLUA 1PJAA 5AKKA 3BWXA 1XZBA 1G42A 4Y2TA 2BKLA 5EHZA 1VXRA 4Q3OA 3STUA 3V1MA 4AO6A 2OAGA 3IUJA 1XRRA 2AJLI 3B3QA 5AICA 3A2LA 3WZLA 1CUAA 4AQDA 5AM5A 1CUVA 3UUFA 1AQLA 3WIOA 1BROA 5E2IA 2BUAA 3AJAA 3ANTA 1FFAA 3LP5A 1ZIYA 3H0CA 5HKAA 3RKSA 3M83A 1GPKA 3TGLA 3IUQA 4K5QA 1MO2A 2DQYA 3N0TA 5AKIA 2WJ6A 1E8DA 1XRMA 4H7KA 1L7AA 3ZLTA 4KE9A 2QJWA 2PU7A 4Q3LA 1Z68A 3HSSA 1S8OA 1MAHA 1K63A 4WCVA 3I6YA 3QITA 3R3YA 2ZYIA 5HF9A 3MGAA 1VA5A 1H22A 2VATA 3A6ZA 4BE4A 3BDIA 2PVSA 2CUTA 2WG2A 5BWBA 4MQMA 5AI5A 2WSLA 1Y7HA 3ANSA 4OYLA 3K9BA 4RNCA 3T52A 4FWBA 4BP9A 4B80A 2V96A 3H2KA 1SCKA 2PUHA 5CTAA 2B20A 3FBWA 1CUBA 2XUAA 1GXSA 5ALMA 1AKNA 3W9UA 1BE0A 2XUKA 5AKLA 1LZLA 3WYNA 2WJ3A 5AH0A 2P8SA 4NZZA 1ORVA 2C5GA 3R3ZA 1YASA 3NWOA 4J3JA 3GFFA 4BRSA 1EX9A 1FFBA 4FDMA 5KWJA 3STVA 2HIHA 3WL6A 4K2AA 3D4LA 4JEIA 5A7GA 2HA5A 3AZQA 3HYSA 4FNGA 2O2HA 3ESAA 4OB8A 4DNQA 1O6FA 2JGLA 2JEYA 3C8HA 3OURA 4AB1A 2HM7A 4UHCA 5EFZA 4CFSA 1AUOA 3ZV7A 1MX5A 4DSZA 2C4HA 2Q0XA 3FVRA 4YX9A 4AO8A 4G4JA 2D0DA 4QA9A 4E11A 4B81A 3R40A 5FDFA 3LCRA 3FCYA 3DL7A 4X3CA 2XQFA 1DWOA 4UBOA 3ZPXA 1CUEA 2C7BA 3DYVA 3IB3A 1X2BA 3NOXA 5LP1A 1HQDA 4F5ZA 5J3JA 1VJ5A 4KE6A 3BE8A 4WJLA 2VAVA 4U2GA 4QDOA 1LZKA 5KBYA 3IULA 1R50A 2QT9A 1L7RA 1JJBA 5JAPA 3O9MA 2V98A 2G63A 3C6YA 1HPLA 4C87A 1J1IA 2HRQA 2XMDA 2QOEA 2XLBA 2ACKA 2JGMA 2AJBA 5LZ5A 3WWDA 4PSDA 3M3DA 4Y7DA 1LPPA 5IVHA 2CBGA 4X00A 3V1NA 2IIVA 4YK7A 4B0OA 3V48A 4FOLA 2WTMA 2DSNA 2OQIA 1ODTC 4KAFA 1W52X 3G8YA 4QWWA 2J3DA 3R3XA 1XZDA 1YSCA 3GZJA 3PF9A 1LLFA 3EBLA 2WLSA 1GZ7A 3EQ8A 2QUAA 5C81A 1YS2X 4KAJA 3H17A 2Z5GA 4MYDA 2DFPA 5JZ9A 1RP1A 2GYUA 4DIUA 1MAAA 1ACJA 2WIGA 1YS1X 3E3AA 2JGKA 1EDEA 5FV4A 4X91A 1XZJA 1CV2A 4AX4A 5ALYA 3JYHA 4I4CA 1VZ2A 3OOSA 5ALJA 3U0VA 5YASA 2QTBA 4PV7A 1G5FA 3C43A 1EK1A 1QIKA 3I2FA 3F96A 4BZWA 2J3QA 4PNZA 4J0KA 3E4DA 4J0DA 3RM3A 3D7RA 1ZI6A 3MUNA 4BTLA 1EVQA 1R9MA 1BU8A 3QM1A 3PICA 1P0PA 4BVLA 1QIGA 2DHCA 4X94A 2GZRA 4C4ZA 2CB9A 3FYUA 5CT8A 2VA9A 4G8CA 2JEZA 3M82A 5AOCA 1HDEA 3CN9A 1YAHA 3JWEA 4JYPA 4BC0A 3DKRA 3V9AA 1JMYA 2E3JA 3O4GA 5EHQA 2EDCA 2HA3A 3PF8A 5DNUA 3HLKA 1F0NA 5JD5A 1SCQA 2WHRA 3A2NA 3A2MA 4W1PA 2I3DA 2ORYA 1LPNA 1W4LA 1XZGA 2RIPA 1CRLA 3H2IA 5ALRA 2XUIA 4HRYA 3SX4A 3PI6A 5AOAA 2V97A 1CEXA 3OM8A 1XZLA 5K3AA 2PL5A 1C7JA 4IHAA 4MXDA 3T4UA 1Q0RA 3FLEA 3PUHA 5AI6A 4BVKA 1E66A 5DYYA 1YA4A 4UBKA 3WL5A 3OG9A 3QPAA 4G8DA 2RGUA 1HBJA 1A88A 1XKLA 1JU3A 2I3ZA 2RONA 3O4IA 4UHEA 4Y2XA 4F21A 2VT6A 4FKBA 2HA4A 5A6VA 2XQJA 4GECA 1T4MA 5AK3A 2BUBA 1OXMA 4EUSA 3AIKA 2IITA 1YA8A 4UPDA 1BS9A 4RPCA 4Y2SA 3Q0TA 2QVBA 1XZMA 3QYJA 3I6MA 3EIOA 3BF8A 1QONA 1XZHA 1CUHA 1A8SA 2PSEA 1WCYA 3KXPA 2HFKA 4MWTA 2HDWA 3Q8WA 3KWJA 4ARBA 3KD2A 1LPAB 4L3WA 4BB0A 4Q34A 5AI8A 3R3WA 5ALSA 5FOQA 1BN6A 4M0MA 4W1RA 5AI0A 2QMQA 1XLWA 4BDSA 3WL8A 1JKMA 1CUGA 2HA2A 3I2HA 4A16A 1Y7IA 2H7CA 1SCIA 3CXUA 2YXPX 1ISPA 1O6GA 1QZ3A 1XZIA 3H1BA 4QDXA 3FCXA 1HLGA 3C5WP 1W76A 1JJIA 1M33A 3QVMA 1HKHA 2NW6A 1FFDA 2LIPA 3AZPA 3QH4A 3GA7A 3WK4A 3HZOA 3KSRA 2QXTA 3GELA 1EXWA 1G66A 3JW8A 3KOOA 1PFQA 4P08A 3N2ZB 3MVEA 4P9NA 4PSUA 4C88A 4IO0A 4RE5A 2CZQA 5C8VA 4BVJA 2HHAA 2G4LA 4H7IA 6YASA 2R8BA 1CFJA 4J0GA 5T4EA 2ZYHA 3CCBA 3D3NA 1AURA 5JALA 4Y2VA 4G4IA 2V9ZA 4LIPD 4EY4A 5DTJA 5AKGA 4KR0A 2XUDA 3W2TA 4DSAA 5DYTA 2OCGA 4QE3A 1IUOA 1OCEA 1THTA 2H7YA 3FSGD 1L7QA 3S2ZA 4MJ3A 1DWQA 4GLBA 2UZ0A 5AKZA 3AILA 2WIKA 4GXNA 3VDXA 1CUJA 5JARA 1CR6A 3F67A 4LYDA 1CUZA 1JU4A 4LKOA 1X70A 3STXA 2DHDA 4UHFA 5JASA 1C7IA 4EB0A 4EA6A 3I6ZA 2JF0A 3C45A 2VQ6A 2G5PA 1VLQA 5AM1A 5DYWA 3AFIA 7YASA 3SWWA 4OYYA 1CUXA 5ALEA 1XKTA 3H18A 4KE8A 3X3HA 4WFJA 1T2NA 1DT5A 1TQHA 3R3VA 4C6HA 3PE6A 3L1IA 4EBBA 2WIJA 3TJMA 4EY6A 3WK6A 1U4NA 2ES4A 4X6YA 3BJRA 2YH2A 2WUGA 1EA5A 5ALLA 1DT3A 1R1DA 1AZWA 3I1YA 4ZGBA 4UBIA 5DNWA 1CUUA 1XROA 3ESDA 2PSFA 5LZ4A 3I2GA 1EK2A 4J0CA 5D3KA 4ARAA 1GPNA 5LYYA 4Y2QA 4H7FA 1EH5A 1HL7A 4KYVA 3I2KA 4NS4A 1TCAA 5ALDA 3ZWQA 1QGED 1MNAA 1LPMA 3HI4A 5CT5A 4H77A 4XX1A 2WG0A 2ZJ6A 5AM4A 1E8MA 4J0HA 3NGMA 1A8QA 1EDDA 2GYWA 3QBJA 1BN7A 5K3EA 1W6RA 4F0JA 4OB7A 5I8PA 5ALPA 1VKHA 2WUDA 2PBLA 2BGRA 5FKJA 1G4HA 1VA4A 4UBJA 1DQYA 4KJXA 5HF5A 4M0EA 3STWA 1MX9A 4N5HX 1WOMA 2Z8ZA 1ZIXA 1QE3A 4ZWNA 2WHPA 4DM7A 3PFBA 5HFNA 5JATA 5I7UA 4CG2A 4HS9A 1GKKA 4HRXA 3DOIA 3QZUA 4PW0A 1VOTA 3AZOA 4Y9SA 2G5TA 5ALOA 3EF3A 1J2EA 1E89A 3FAKA 3OTQA 1Q83A 1XQYA 4IQ4A 4MEBA 4AN0A 2XI4A 1VXOA 3WA6A 4D9JA 4CIAA 5CW2A 5K3FA 4L9AA 1RYYA 3I2JA 4UBLA 1ACLA 4P93A 3DQZA 2B4KA 3OPMA 4GBGA 5HFAA 4Y2UA 1BCRA 4E14A 2PM8A 4BAZA 5BV7A 1WPRA 1QOZA 4UFOA 1CLEA 4J0JA 3WWOA 3ESBA 2QRUA 2X8BA 2OCKA 3O0DA 5ALQA 4DGQA 4EZIA 3R0VA 3WJ2A 3WL7A 3O95A 1WM1A 4LXGA 5KREA 1DU4A 1TIBA 3WKEA 5AKJA 3DNMA 2FJPA 4ETWA 4Z49A 2Y6UA 1LBSA 4I19A 2PSJA 1ZI8A 5CT6A 2EDAA 2C5FA 4XWGA 3BL8A 1IUPA 3C8DA 4DNOA 4CCYB 1IZ7A 2WILA 4CIBA 3STTA 5ALIA 1IMJA 1IZ8A 2FJ0A 5FRDA 4BZZA 5ALHA 4OUKX 2OCIA 4X97A 3ZI7A 4CCYA 3G0DA 5EIEA 2XMQA 4NMWA 4Q1VA 1TK3A 4FBMA 1CUSA 3L1JA 3EQ7A 1EINA 4BCBA 4H35A 4HTAA 2QUBA 3WWPA 2J4CA 1XZEA 3CN7A 4UFNA 1YAJA 3B12A 2BFNA 5E4YA 1ETHA 1JI3A 2JGIA 1LNSA 3U1TA 4BAUA 5HZGA 5K3DA 3HXKA 3QMMA 2HU8A 1K4YA 3C70A 5LIPA 5EHXA 2XMGA 1DX6A 3IURA 1X2EA 2GBCA 1ZD4A 4ZV9A 4Y2YA 4BC1A 1GQSA 3I28A 4U2FA 4F60A 3GBSA 1AGYA 2WFMA 1Y37A 5T4FA 3C5VA 3LIPA 1DTEA 2OXEA 3WYDA 2OGZA 3EQ9A 4AN1A 3DKKA 4KRXA 3FYUB 3K2IA 3IA2A 1ZOIA 2Y2VA 1TCBA 4MEAA 5H3HA 5JYCA 1I6WA 3SC2A 4X6UA 4S0XA 1NX9A 4H0CA 4ZXFA 5SYNA 3VJKA 2ECFA 4INZA 1CQWA 5CH8A 5ALZA 3WKBA 1ZD2P 4DMKA 1CVLA 1YCDA 1VE6A 1UT6A 1Q84A 5K5EA 3VVLA 3D59A 5JIBA 4EHBA 1JFRA 1CUIA 5AHXA 1SC9A 2HA0A 4OU5A 4U2BA 1SFRA 2HRRA 1FFEA 2OAEA 1R4ZA 3WMRA 5AK6A 4C4XA 2IX9A 4FNMA 3DJYA 2ZVDA 1XFDA 5CRIA 2OGSA 5DNVA 2XMZA 4K6GA 3UMJA 4Q05A 5BWCA 1H2ZA 5DJ5A 3BIWA 5LKAA 3WK8A 1CUFA 1WB5A 2PUJA 3FNBA 1P0MA 1TRHA 1XRPA 5AI9A 3D2BA 4BRZA 2O2IA 2JIDA 1ZD3A 2CMFA 4G1FA 1P0QA 2VJCA 4H18A 1MT3A 5JADA 1CPYA 2HU7A 4YASA 3HC7A 5FLKA 4J7AA 3VVMA 2C0QA 3AIOA 2WIFA 2B61A 2WFZA 4ZV7A 4C4YA 3FLBA 2I78A 4OD0A 5AKEA 1ODSA 4CI9A 3PUIA 1JMKC 1UKBA 1DINA 2O7VA 4G4GA 1BRTA 5AM0A 2DQZA 5IVIA 5HK8A 3HRHA 5EI5A 1N5RA 1KU0A 4N8SA 1FSSA 5DLPA 2X5XA 1XQXA 3G9ZA 2WKWA 1QO7A 4DLNA 1QIEA 4TPKA 4Q3KA 3BF7A 3WK9A 2I03A 1W75A 1BEEA 3WK7A 1USWA 5AM2A 5JAOA 2XUGA 3M81A 4I3FA 2XUQA 4Y2PA 3IBTA 3H19A 1QIFA 3QPCA 3DCNA 2WG1A 5ALNA 2AJ8A 5HF8A 5CT4A 2VAXA 4B0PA 4H7JA 2JBWA 1CUWA 2HA6A 4OSEA 4DMFA 2AJCA 2QKYA 2DR0A 4EY5A 1J06A 1WPXA 5CXXA 3WLAA 4PO3X 3KDAA 4W63A 4H7HA 5EHNA 2VF2A 5LKRA 5IVKA 1F0PA 5DTIA 1LBTA 1ZI9A 1QIJA 3WIBA 3LIIA 1EDBA 4QLOA 2WFLB 4X90A 4UBNA 5DWDA 3FYUC 5AJHA 3F8SA 1DWPA 4CG1A 1NU8A 3OC0A 5JD6A 1LPOA 4G9GA 1EHYA 2ZJFA 2WFLA 4OB6A 4DYHA 1H2WA 1P0IA 3C6XA 3G9XA 1BEZA 1EI9A 4HAIA 1W1IA 4CCWA 4K6HA 1MX1A 2X76A 4E15A 4FLFA 2GBFA 4EY8A 5A71A 5C8ZA 1KEZA 2XUHA 4QDUA 2FUKA 1WB4A 5K3CA 3ZLUA 1UOQA 2H7XA 2XMRA 2BAGA 1UK6A 3WJ1A 1UK9A 2GZSA 2VSQA 1U2EA 3H2HA 3HJUA 3V1KA 3UUEA 1ODCA 1J07A 4WDRA 1LPBB 4H7DA 1K5PA 4QEKA 4Y2RA 3VJLA 2QM0A 1A7UA 1XZKA 4X71A 4QNNA 1THGA 4YPVA 2O2GA 1UOOA 5C8XA 2C58A 4B7ZA 4BATA 5ISMA 3ZLVA 5FP0A 3W9BA 4OU4A 4Y2JA 1QJ4A 1VE7A 5EGNA 2BJHA 2HADA 2HFJA 4B84A 2Z3ZA 3ILSA 3O9VA 5JZSA 4J0IA 5CXUA 4HXEB 3WKDA 3BJMA 4N8DA 1H2XA 5CMLA 3QPDA 5C7YA 4P92A 2AJDA 2CEKA 1ZJ4A 3A70A 3B5EA 3GROA 4PF1A 5ALVA 2Y2UA 5EIAA 3I1IA 5ESRA 4OCZA 3WQHA 4MWSA 2Y6VA 4BCCA 1AC5A 2OLEA 3KWFA 4CG3A 2B9VA 1CUYA 3F97A 4X95A 1MU0A 3G02A 4XVCA 3G7NA 4L72A 1CIJA 5IH7A 1QLWA 1LGYA 2HU5A 4WFIA 3YASA 2WHPB 5HK9A 5ALFA 2PX6A 2XQIA 4BDTA 2JGFA 5A7HA 5HQ3B 4JH0A 1UXOA 2HA7A 4QDZA 3PDCA 5JAUA 1XRNA 1DQZA 4UHDA 1R88A 3H1AA 2OQVA 3RARA 1UFOA 5HQ3A 5JD4A 1MN6A 3TEJA 5BOVA 1UWCA 1FFCA 5IKXA 3LLCA 1XLVA 4C01A 5FUMA 3AUKA 3W05A 4QLAA 5ALXA 1H2YA 2GYVA 5LLSA 2XLCA 4C89A 3F9CA 1WHSA 5CT9A 2ZSHA 3BIXA 5AOBA 5K3FB 4BBZA 1E8NA 3FVTA 5HKBA 2XUJA 2C0PA 1K8QA 2ONCA 3O4JA 4G9EA 1XZFA 4J03A 2XUOA 5EIHA 3D0KA 3W04A 1QIMA 2H9YA 1D07A 1E3QA 2WU3A 1UKCA 4A23A 5CURA 1N5MA 4X85A 4GW3A 2ZJ7A 2ZSIA 4IH9A 3S8YA 2H1IA 1QIIA 4GEGA 3W06A 4BAGA 2GBGA 3K6KA 4KEAA 4TGLA 1QFSA 5AO9A 1ZJ5A 3ESCA 2WIDA 4JYMA 1ZGCA 3MUOA 2PPLA 4X7BA 1QTIA 1GGVA 1MJ5A 2BGNA 3HACA 4BYMA 3IUMA 1U65A 5ALGA 5JANA 1TCCA 5LZ9A 4U2CA 3IDAA 2ACEA 3G9UA
chains in the Genus database with same CATH superfamily
3NNSA 3EXHA 3MJDA 3UFBA 2BKEA 1GOTA 4RUKA 3D4NA 2VT7A 5E2BA 4F2WA 1KQGA 1QYWA 1D4OA 3HXMA 3L49A 4C7VA 1P8JA 1SCNE 5JYDA 2R68A 4NK5A 4Q82A 3TR6A 2P35A 4ZQEA 1RXSA 1L3IA 2H2IA 3VYSB 4JP3A 4BIMA 1EX1A 5CVTA 4U2DA 4MROA 3DA8A 1HE3A 5ENDA 5FA5A 4DM4A 3EA5A 4WY8A 4EMTA 3C6MA 1JSZA 1JDNA 1SKBA 1IOZA 3HI6A 1QIDA 3ANNA 3H2GA 3HGQA 3SI7A 4N7JA 3RIEA 4ZK6A 1LLDA 4LFAB 4AXXA 4ZK2A 3KSMA 2BUCA 1QAQA 3O1JC 4TSFA 2VL7A 3UMFA 3L7JA 4KWEA 5JAMA 3WKAA 2H4XA 4OXXA 4KR7A 1HDYA 3OMWA 4RGYA 4YP7A 1ZHOA 2TMKA 1M2OB 2J9FA 3ZHOA 3ETEA 5ECYA 3V1LA 5CB8A 4UPEA 3W7BA 1I51A 2YOGA 2BH9A 4LGVA 4OP3A 1E79A 2CXTA 2YVAA 2CT8A 1LLQA 2QTTA 3DZBA 1HYHA 2NYVA 1OZFA 2UVDA 4LF6B 4G9BA 5JAHA 3FI9A 2ORED 3H9BA 3CGWA 2Q5JA 2WYVA 5SZIA 3HA7A 4F06A 3ECSA 1XC7A 2WZDA 3U4AA 5IVPA 2BMAA 4AP5A 4RD6A 1SZPA 4AFNA 2FRDA 3DEZA 3PV0A 2XYPA 3D6AA 3NC4A 1D8TA 3H8VA 3TOZA 4DS3A 1ZW1A 4EO7A 5IJAA 4EG5A 3PPWA 4H31A 1N2GA 1NGSA 2XB8A 1YQTA 1SCBA 1KH1A 4DW8A 4B83A 3AHIA 1H65A 1P6XA 2YZGA 3KAPA 1JG3A 2JKZA 1XZPA 3KKZA 3TQHA 3A0UA 5CA0A 5JJCA 4Y0AA 4UNSA 8MHTA 1K6MA 3CLUD 3E23A 2FW0A 3MS7A 1F8UA 2YNMD 2L42A 1H85A 1KH2A 3MK31 1M5RA 1KQOA 3PRKE 1WCIA 2HNKA 4A8PA 4FTWA 4EW2A 3MOGA 4DXDA 1GAJA 1MA3A 2DHQA 2RHLA 4Z3KA 4ZI2A 1W5AA 4AS1A 2R8RA 2TMGA 3LW8A 5C1OA 2Z3VA 4FYJA 1XTUA 3JQ7A 1QFMA 2G9UA 1VKZA 2D1RA 2EEZA 4WKOA 4TXMA 5BMVA 2XMBA 5AK4A 3TOVA 4PS0A 3DWGA 5CVDA 5HZKA 3E1GA 4QFCA 4ZAZA 5ADHA 1X1SA 2QXUA 4HDNA 3GLFE 4O4JB 3KZNA 3O03A 4A5SA 1X1RA 1NKVA 1NNSA 3BWCA 1DXOA 1RXYA 3KYJB 2QW1A 1HO3A 4IFBA 4RKQA 5EYPB 4CIWA 1SUCA 3TMAA 1BJKA 2RI6A 3GPBA 2REXB 3LKZA 5CBKA 3RG2A 2OCLA 2PMDA 4JBIA 1EG7A 3LRPA 3V8VA 3QY9A 3I62A 2XT0A 4PEVA 1Y6RA 4TLMB 2QP4A 2BFDB 4J3NA 3VNAA 5F77A 2DFTA 3EC7A 4Q02A 1OWNA 2C20A 1C7EA 3CWCA 1LY1A 4HXGA 2OKCA 4BFWA 4DLSA 1FIUA 2Z30A 1B0PA 1QR6A 4H6XA 1OILA 3NHUA 4J4HA 5E1BA 1L5RA 3KQWA 4E33A 4BCDA 3KB2A 2PEZA 1L1QA 3PFFA 1PJ8A 1ECGA 5JBQA 4RVUA 3ZVKA 4BMVA 4ARIA 1HEYA 1REQB 2PUTA 3VR2A 2WD7A 4CPDA 1L6RA 4H4DA 3OE7D 3USCS 4OIMA 1N6IA 4KQ1A 5GMOA 5CJ2A 1W96A 2PWZA 1K8XB 5JJ5A 1YB6A 1YXMA 3EMBA 3GLHB 4GXQA 3GNQA 3OPYB 1TKCA 2WWXA 1HWYA 3EQ6A 3VOBA 1C0EA 2Z4SA 4WY5A 3GP3A 4I1OA 1XFAA 4QT0A 1NU6A 2E82A 4C7BA 5AM3A 3HPQA 5F3WB 3Q2KA 3DOOA 3W4KA 3PJRA 2QZSA 2D1FA 5KX5A 2YYAA 4M83A 4N0EA 3BDAA 4U5QA 1O7JA 4B6GA 3GY0A 5L3SB 4EEZA 4C7JA 3BCRA 4O2AA 1HE4A 2QS9A 1GNLA 1E18A 4R31A 4FZ3A 3VV3A 1DAPA 2CLEB 2QORA 2CJXA 4D2IA 4OX9B 2E6UX 1DKMA 1EM8B 4RTQA 1C7RA 1UMBA 1Y3AA 1JHAA 2IKQA 4HJRA 4HQ6A 1L7VC 1YO6A 2L2QA 2YJ4A 4N01A 4CT5A 1NW5A 1NG1A 3JTEA 4L73A 2CKMA 4ZEWA 4DMHA 1IWOA 1HQCA 3HY6A 1P81A 3EEBA 3LHIA 3JWIA 5KOJB 5ALTA 5MF6A 4YAFA 5DW0A 5BV8A 5CA1B 2Z58A 4DA8A 2F1RA 3E9QA 4FYMA 3UK7A 2WE8A 3VDQA 2FDRA 3QVSA 5CLJA 4D02A 4DNPA 3WISA 1YKGA 1VHTA 2ZT7A 1HEIA 1J99A 1NOKA 2GSDA 2EATA 1R16A 2RAUA 3DUWA 3NALA 3QKSB 1SZDA 4NULA 4U2KA 3P8ZA 4EGJA 2DCMA 1LA2A 3CPEA 3SQMA 1F20A 3G9QA 1E94E 5E2AA 3OZUA 2BTQA 1R4NA 3BMOB 5DPMA 3ABQB 3HZRA 1W9HA 2XNHA 1WMDA 2C4TA 3DV2A 4LYEA 1DXQA 4YUYA 1OFHA 1DIGA 2F1JA 1Z22A 5EUMA 1YVDA 3ZIAD 2A5DA 4V2IA 4CLRA 3GJTA 3N6RA 3NVAA 3OHSX 2QU8A 1KYVA 2QLMA 4J16A 2C31A 1L7BA 2CDAA 4BTVA 1E7SA 4N65A 1B2RA 1S4MA 3UMCA 5ES4B 1P5RA 1KFJB 2WJYA 4RHUA 4B9EA 5AQEA 5G2OA 1KWGA 5LNK1 2MSLA 4E2XA 1ZP6A 3QMVA 2JZOA 3OQOA 3U61B 1EXMA 2QU7A 3BXPA 2J9XB 5AK0A 1KSFX 1SG9A 3CLSC 2XEXA 4HNSA 2I6TA 3HY3A 1TAHA 1JR4A 5LQJA 1RMYA 2ODQA 2P1ZA 2Q62A 2VVTA 1KU6A 3OCXA 4JLVA 4DLRA 2D3WA 2QJRA 4JLUA 4LRUA 5IW8A 1I10A 4MUHA 4TX1A 2REOA 3GC6A 3GUVA 1TW3A 3DBLB 1XTPA 4IHKA 2ZB8A 5F4ZA 3L93A 5HKKD 1ABFA 1VHDA 4XRGA 2EZTA 4HDKA 3D1VA 2G5CA 1W0KA 3IUYA 3D5EA 1O8BA 2EF1A 4M38A 3OI7A 1ZUD1 4XKJA 5ED4A 3VI3B 5FPSA 1Q92A 2X2EA 1Q21A 2NV2B 4GX2A 4HH1A 1X7WB 3DDOA 4I14A 3QI7A 4IV0A 1TJ5A 2WYUA 1G20B 1U0SY 3GLVA 5D5HA 5COAA 3ED1A 2AS0A 2IJGX 2LKCA 2XT6A 2VQEB 5F23A 4DAEA 2HWWA 2Z4RA 2WT4A 4BNKA 4D9FA 3OLQA 3QVLA 4IPTA 2ZM5A 4GI1A 2RJ3A 3KJXA 2Q2NA 1TM5E 3PTLA 1N2CE 3I8XA 3ZWDA 4F38A 1GKLA 4EKIA 1C4OA 4QQ8A 3P4UA 4Y1GA 1H05A 2GTHA 4L5YA 1U11A 3AM1A 3BXEA 3OQ6A 4RE6A 5K0NA 1Q1AA 3G0GA 3LSTA 3C6ZA 3RCBA 1GFZA 2BW0A 3WXBA 1W49A 1DBWA 3LFTA 1P3DA 1YUNA 4DV0B 4M9CA 5F9FA 1TUBB 4UM9B 2REQA 1XR3A 2IYSA 2B4TO 3DFMA 4EQ6A 7AT1A 5FBHA 3MILA 1VIDA 3AXSA 5I45A 2ZYVX 5BV0A 2FRVA 2P7IA 2XB6A 3HFSA 1V16B 3GNTA 4NY1A 3WC4A 3BYZA 4V0QA 4KREA 2J7PD 2FPPB 1LPSA 3PX2A 3G2QA 5E1OA 3ZHCA 1NNLA 3MTGA 2MSEB 3BA6A 1L5LA 3ZDBA 4J90A 5IWAB 2IOQA 4MHSA 2BONA 1HT2E 2WUVA 4BFXA 1E32A 1XNGA 1V6SA 4G0XA 3K5IA 4CKBB 1J00A 1H2FA 3B8HA 1FJ2A 1JJFA 1GCIA 1ULBA 2VYVD 3Q87B 3DW1X 1Z45A 3Q7EA 2O3TA 2PZKA 2P2SA 4ADSG 2ZBDA 4XGIA 1SOWA 2C2MA 3NANA 4BNDA 1N75A 2O1XA 1IAVA 2POQX 3AR6A 4EYOA 2XADA 3KEOA 3TQIA 4V1CI 1SVMA 2VI5A 4MVJM 3EGOA 4ZN6A 2IVFA 2K2QB 1Z4LA 2H1LA 5IN4A 5CDGA 4JBXA 2O2SA 2PZBA 2ARKA 2Z2XA 4ZOAA 5IM5A 2ZJ4A 1CZLA 1N0UA 3V8MA 2PK3A 5JNSA 3ESZA 2JGEA 3B6EA 3W6UA 3LHSA 4QX6A 1XZ8A 2W2TA 2F48A 1UFKA 3KYBA 4P7JA 2VUTA 3WY9A 1YB4A 1FUIA 4BO0A 5IPFA 2XMSA 4BZXA 1OAKA 2GBPA 4OSOA 3A1TA 3SEQA 1QG2A 2HGSA 5JEEA 2R25B 4HP8A 2GAFA 3GUUA 4GWLA 3T0FA 1W36B 1K7SN 2DUNA 5JYBA 1AK2A 1E4YA 4NBRA 1HR0B 3Q98A 4XIIA 1JZSA 2D5LA 2OXFA 2JBAB 4ZOBA 2BM1A 2WWIA 4YMTA 2GRJA 4OX9Y 1W88B 1V96A 1WULS 2VLBA 4MVJG 4XWTA 5FOXA 2E4AA 3QOWA 4X20A 1AKVA 4O08A 2XDWA 2RHWA 4PAGA 2V4ZA 4UZEA 2VJMA 4KXMA 4ZOLB 3NHLA 3TMYA 4QM7A 4WNAA 2HREA 2L17A 4OI1A 2FQ1A 5LZ8A 3E35A 4ZODA 3DXZA 1H23A 1K0FA 1Q7CA 2Y8EA 3M6IA 4RHXA 3WRWA 1Z5PA 1VL6A 5LU9A 2ODEA 4GLFA 4NF2A 4OQFA 3EISA 3NHBA 5BYBA 2F90A 1NF3A 4ATNA 5JZOA 2MSDB 3FLAA 1Q0TA 4I50A 1SOMA 1NUAA 1SBNE 1WD7A 1FDOA 2RHTA 2WR8A 3DTVB 4KRGA 5DHRA 5DIFA 5EIBC 4ZTBA 2YY6A 1XKQA 4HKTA 4KE7A 4H7EA 3SQNA 1O4WA 3IVXA 3WV5A 1OHHD 4FGSA 1DCKA 2QM3A 4A26A 4JNCA 2E18A 1HNXB 4J8PA 1J21A 5B57C 3GUYA 1ZJWA 4BNMA 5CK5A 1Y1LA 4JI0B 1RMTA 2WT9A 4U39A 4H3KB 5IFKA 4IHJF 1XEXA 4L8GA 2JLCA 2GA9A 2ZT8A 3AB3A 3IQEA 4LJKA 3WI7A 4BKRA 3G2KA 5B1SA 4JEHA 4K1XA 2SCUB 2VTKA 2J5RA 2XYVA 2FE4A 3DV0B 3IDSA 5H83A 1B0AA 2UYOA 4LSWA 2IV2X 4HT3B 3PPYA 2O8VA 2DQKA 5EHIA 4G5HA 3L7CA 4O5OA 4OGKA 1YR1A 2WOOA 4OQMA 2AFIB 4PYMA 1TEZA 1E0AA 4KVZA 3AH8A 2XUZA 3H84A 1AE1A 5EJ6A 3E9NA 3RVMA 3V8NA 3HADA 4YONB 2RJOA 3BFKA 4PGAA 4IWNA 4K26A 4IV8A 4M3NA 4PGFA 2OMEA 4ZI5A 1LTHR 1X1CA 3RFFA 1SY7A 1S8FA 5E7JA 2YV5A 5LIRA 1GQYA 4JHLA 4JWTA 4OF4A 2H57A 3H04A 4LXIA 2DH6A 2VDRB 1GRVA 2KI5A 4KN5A 3ZWMA 5A4MS 2YJZA 4M7PA 4X93A 5T4BA 1QRUA 3KD3A 1F38A 5K0BA 4P5EA 1U5BA 2JHFA 2W2OA 3I2YX 1GA1A 4R69A 4O4LF 1GRQA 3M2TA 5BSEA 3RC9A 3EF1A 3BWXA 3HMQA 2V1UA 3SHOA 4CM8A 3OZWA 5TE9A 3LYUA 1Y82A 1NLZA 1KS9A 5L45A 4OM7A 3L82B 1VXRA 3QRWA 3UWOA 4CM1A 4JYBA 4D3DA 4EG0A 2FMTA 1J23A 1UPCA 2N1BA 2A5LA 4MS3A 3V1MA 5K2OA 3AVTA 3UHAA 1NF2A 2X8JA 4GRAA 1K97A 4FP9A 3ET4A 3SNKA 1XRRA 4CR8A 2AJLI 4IY1A 4FFDA 4AJ1A 1N1DA 3HB7A 3NAZA 1CUAA 3EXG1 1DIHA 3LKDA 2X7XA 5MGBA 5F2OA 1U0FA 2BEVB 1XLTA 2KE5A 2QR3A 2W43A 1MB4A 4EVRA 1GGFA 2NTNA 3BMQB 4JHXA 4Q3DA 1QP7A 2HQBA 1CUVA 3KTOA 1AQLA 2O8NA 4P0TA 4JENA 4BO3A 1Q17A 1DUVG 1W1UA 4WXRA 5GZ6A 1DJMA 5JSUA 5JRJA 1G38A 1E9RA 2N9UA 2ZIUB 4PZEA 5E2IA 5I3CA 5JY1A 3FSJX 2KLBA 2CNLA 3ISTA 3ANTA 3SBXA 3SC3A 4Z4HA 2JGRA 4MO2A 2QN3A 3D8NA 3LRTA 3ICEA 2BKUA 1T9ZA 4IX1A 4NPAA 1EQ2A 3USZA 1Y4AE 2O1EA 3C48A 5HKAA 3ZUPA 4L95C 3RKSA 4BO1A 5K0FA 3M83A 3Q5DA 3TGLA 5DHFA 4QYIA 1MO2A 4IL5A 1YGYA 1OXUA 3QKTA 1U98A 2FWMX 1LI7A 5B58C 5L4NA 2D2IA 1XRMA 1IXYA 4H7KA 3PT5A 3VAYA 3OMXA 4EGCB 4PZAA 2EHDA 2IELA 3RWMB 4CM3A 1VC2A 2EZ8A 2Y1FA 2YJNA 4P4SB 4AKTA 4AECA 2CE7A 4DY4A 5C3MA 5BSGA 3FTDA 2QNIA 5THQA 4Q4HA 1P4GA 1KS2A 1ZM2A 1MAHA 1PL0A 3O82A 4KUHA 1G3MA 3AUFA 4WCVA 1KKUA 1BX0A 4RM2A 2ZVQX 3I6YA 2HCBA 2R85A 1T4CB 1X80A 3I3SR 3OKAA 5F9MA 2D00A 4WCFB 1VHJA 1RJGA 5IMBA 4YGYA 4K8RB 1VLVA 5GQSA 2QRMA 5DM4A 4UHKA 4RIHA 3PUZA 4AN4A 5EP1A 5AXDA 1UXGA 4EJ0A 4RDHA 1MIOA 3VYWA 4BE4A 4UDYX 3NASA 1KY4A 3JD2A 2CUTA 3MB5A 5DP1A 2PLWA 5DB4A 3W8NA 2HD4A 5CYOA 4C2BA 1N8TA 3ZH9B 2RGYA 4G56A 1KQFA 1DP4A 1R5JA 2WSLA 1VGQA 4JQOA 5EZ6B 5IK2A 1CS4C 1RXUA 3TZKA 4F9EA 3WFIA 3U09A 1ATZA 3B6IA 2AT1A 5J59A 3ZD6A 1LS6A 2R87A 3MHPA 3BC1A 4LMPA 4OYLA 3THXA 3D6HA 4JJEA 1PYGA 2VA8A 2GM4A 4CEHB 5JPIA 2GO1A 3D6TB 4RTNA 3DSRA 4H17A 2BF4A 2ZBVA 4AD8A 2QBYB 2K7ZA 2IDKA 2NLOA 3CW9A 1XTKA 1RYFA 2Q1TA 4DWWA 3FBWA 5FFNA 1BW9A 1INLA 3B7PA 4OLHA 3LPNA 2G71A 3CTPA 4EF5A 1KR2A 5ALMA 3T9FA 1Y3HA 3W5JA 3IQXA 1U1IA 3J80A 1RYNA 2OCBA 4PTLA 1D9ZA 3JYPA 1Y8QA 5JQWA 5UKDA 3H2BA 1SUWA 4KB5A 5FL7D 3H1TA 2I54A 4GL4A 3PDWA 1QDEA 2BR3A 2F7SA 2VSXA 3WO0A 3GJXC 4EB8A 1CQPA 4TTJA 4WESA 4YMIA 1SQ0A 3I9V6 2EF0A 4M1EA 2XZDA 1V8PA 2WJ3A 4R8LA 4TL6A 4D3ZA 4CKZA 3GA5A 1X1BA 3PWSA 4GS5A 1M1NB 4JIGA 1QDLB 4L4RA 4PG5A 3INGA 1WZEA 3JQAA 5FWYA 1N77A 1GL6A 2PR7A 4EX7A 2JS7A 4LN1A 4OQEA 5HUHA 3GFFA 3B5IA 3MIIA 5DWQA 2VWPA 4X6YA 1O95D 2G40A 3GLIA 1T9GS 1SU4A 1RKUA 1NQ5A 3OX1A 1MKYA 2R84A 2G82A 3E7WA 2O8DA 1TGVA 4OQNA 4HDAA 3E53A 3WBBA 2XTZA 2GLXA 2HIHA 3WL6A 5B7GA 3MJEA 1P9LA 1WSAA 2GJ9A 1MQSA 3OCWA 5FI3A 5BN4A 4UUPA 1SCAA 5IAGA 1FFWA 3NQ41 4KJZA 4KLRA 5I7FA 3N0WA 3TYXA 3ESAA 1HEUA 3GR6A 3PC8A 4JT8A 4M1WA 1GARA 1L7XA 1NRJB 2LXNA 2ZQYA 3BUSA 3K53A 1E2PA 3QVVA 1S01A 3X43A 3OURA 2YWJA 5EKSA 1JG7A 5JO0A 2GKOA 4AB1A 2BOVA 2HM7A 3OEEA 4UHCA 1C2TA 4QFMA 5B12A 1XXHB 3D0QA 4EDHA 5B53A 3CO5A 4KO1S 2GCIA 4YRSA 5KTSA 3IMCA 1MX5A 1GZ3A 3Q7RA 3T94A 4D99A 4C4AA 3RS5A 3FVRA 3GFTA 1G98A 2W6JA 1DKRA 3OT1B 1L8QA 3IQFA 2YVQA 4CM9A 3QPVA 2DERA 5I8WA 4DM3A 4QA9A 4TWZA 1KYTA 1H4QA 5CJPA 2I6GA 2ZBUA 3ML1A 4J1TC 4PSVA 1C9JA 4KH1A 1QVWA 4WASA 5IC5A 2CZCA 3EIUA 2QYSA 2R00A 3B20A 5NULA 3UJCA 3AFNA 4N48A 3FCYA 1ZONA 4B73A 3DL7A 2CFTA 3LA8A 2BFBA 3MT8A 3OJ0A 4LGMA 2C9CA 4X3CA 3JD0A 4YCJA 3U7QA 5C5IA 1KDYA 2AWNA 2Q6VA 1T43A 4GOND 4EY5A 2ZUDA 3BGDA 2GD1O 3NTUA 4LZOA 5CCBA 1L4KA 3TTSA 1SVIA 2XD9A 3HQ4O 3MWEA 3V8QA 3KV1A 4FX5A 3ZPXA 3WLPA 4BIIA 4YXFA 3EOAI 2C7BA 1A5BB 2ODPA 4NOMA 1R8SA 2JFPA 2ZRPA 3CINA 3M7IA 4IDOA 5EESA 2JIMA 1AUQA 3CRNA 1MEOA 3ACBA 3NOXA 3RIXA 2VNAA 4DBZA 4F11A 4ND1A 5CEJA 5C53B 4FYHA 1VECA 2A9JA 1HQDA 1ZK2A 2CY0A 4LKRA 4A0HA 1KDVA 3L0YA 3V55A 2YMLA 2QL7A 4C21A 4Q1FA 2DPHA 4DEYA 2FW7A 3BE8A 3H1EA 4TN1A 1G17A 2VN8A 3UOAB 3UXMA 3BXXA 4U2GA 2P2DA 5KYNA 3Q8XB 4N0PA 2OBFA 3MN1A 4ZCTA 1P75A 1LZKA 3I6QA 4KPUA 3G17A 1ZXLA 3IULA 1KRWA 2PGJA 1QRTA 3IELA 2V7GA 5KQSA 1EFCA 4PQRA 1CRPA 2PIAA 5KCZA 1L7RA 1DJOA 2PO7A 4AUNA 5TF4A 1I6MA 2QRHA 2PKCA 4R3UC 1UBFA 5ITSA 5F1OA 1AA6A 3KJFA 1CIPA 1SOUA 5FF9A 2WF7A 3OP1A 2P5TB 5GV8A 2V98A 4LRYA 4Q7KA 4H2DA 3ISJA 4RK1A 5JCJD 4DDWA 2M6RA 3ONFA 2JH8A 1JG6A 3AP1A 5AXCA 4C78A 1U94A 2OOSA 5DBEX 4MVJA 4ZT6A 3CJRA 2ICAA 2QOEA 3OZCA 1VSTA 1ZK3A 1LDMA 2ZCVA 1BGXT 4ZVSA 5CA0B 5LP6A 4PYQA 2WTBA 3BWVA 4XD7A 1D4ZA 1TPZA 4EK9A 5BWNA 3M9WA 1KMCA 3MBIA 1WCIB 2P0YA 4KZKA 4MP3A 3M3DA 3UHFA 1VMDA 1LPPA 3NTVA 1HXHA 3ETLA 5LDDC 4AKIA 3PG5A 2CBGA 3DBIA 3ITDA 4CMBA 3DZKA 3DMDA 3EARA 5KYYA 3JQ7B 5KNLA 1XTJA 2WC1A 4FSDA 4X00A 5EOVA 1RZRD 1L4LA 1K9SA 1KY5A 4EKNB 3C4QA 1CY0A 2ONYA 3PNQA 3R20A 3ZIAA 1U1GA 2W2VA 1MF7A 1IQPA 2WSYB 2GEUA 3BH7A 4HDNB 4JVNA 2ZIZA 4B0OA 1GPMA 4X8HA 1VG0B 2VLIA 4HUTA 4TWIA 2IU6A 2DSNA 2F64A 2OQIA 3ZE6A 4GYYA 4EUNA 1SVSA 1PR4A 2OLKA 3G6KA 1MV8A 4QWWA 2J3DA 5JXIA 3R3XA 3JR7A 1XZDA 4OA8A 3VPCA 1JHDA 3GZJA 5EEHA 4CXMA 1QZXA 1G1MA 2HPAA 3KQVA 1Y9EA 1WSBA 1GQQA 1LLFA 1SBIA 1GZ7A 2WLSA 1MO5A 3EBLA 3PQCA 4MQ4A 4QPJC 5C81A 4Z4FA 3HCAA 3BSYA 3NEJA 5FA8A 4LFCB 3IPAA 2BY4A 5G1NA 1WKVA 4YRPA 2Q7OE 1J0CA 1OBFO 4DGSA 2GN0A 2DFPA 2JLVA 5IBQA 1YT5A 3ADKA 2HRBA 3D7NA 1N36B 2WD7B 3BSSA 1E64A 3HCDA 2KPOA 4Z9BA 4Q7JB 3MWGA 4AS3A 3EWSA 4HAYA 2SBTA 3M1AA 1S02A 2HLDD 2QRNA 2VK2A 3ZI0A 2FCRA 3HCBA 1GRNA 2ZWIA 3ZGXA 2WSBA 3E3MA 1IB0A 3MTQA 5F51A 2KS6A 4O2RA 5LQCA 1XNJA 5G02A 4HMOA 3PLNA 3IEXA 5REQB 1EG2A 3FOWA 3HB4X 4XYBA 4N0QA 5K0CA 1KYZA 5ALJA 1JAIA 3O26A 2VT2A 1FDVA 4DMMA 4BFCA 5C4MA 2QTBA 1N25A 3RNOA 4AAYA 3RT1A 3IL2A 4F3RA 3GRUA 1LRJA 1M6HA 1G5FA 1HM5A 3C43A 5JBNA 3WTCA 1I3LA 4ZCRA 3GLFA 4I5GA 2COEA 1KO1A 1TC1A 3F96A 4N5LA 2J3QA 3ZY3A 1UMBB 4KAXA 1BYIA 3V4PB 1XJWA 3PQDA 5KPJA 3ZX4A 3CG4A 3ZV3A 3GQBA 4MS4B 1TZCA 3PQFA 4B7UA 5JNLA 5EXTA 3CBGA 1JSXA 5ILGA 1BU8A 4UOZA 4F1JA 1RR6A 3EZNA 2JIOA 2YN4A 1V41E 4EFLA 4IIHA 2DQ4A 4LSMA 3R77A 1XT6A 4G36A 4NYJQ 4LXUA 1Z4NA 2OHOA 4KLCA 3TUIC 2BIFA 4IR7A 1DC5A 1VE9A 2A9KA 5HKOA 1FPQA 3ICOA 5CT8A 1VRVA 2RK4A 1YIDA 2AFHE 2PKQP 2ZSAA 5CDSA 4JODA 2JEZA 1L5QA 1TFUA 4I1RA 1KWKA 1G9XA 3QFSA 4NCBA 4RK0A 1R4NB 1T4BA 4J2HA 3K1TA 1YAHA 1EE2A 3K94A 4BMSA 3CU5A 1D5WA 3V9AA 4PM4A 3IODA 3QQ5A 2W7TA 2FEMA 1RLUA 1VCOA 1YK0A 1QH8A 4RMNA 3A4VA 4JGIA 4CLRB 3LYAA 3K20A 2G9NA 1JMYA 2E3JA 1G9SA 1UM9B 2N42A 2YIMA 1YI1A 2EKZA 2ZUVA 3EZGA 3PF8A 4R01A 4BO4A 1AS2A 2B1RA 1L5NA 3ZGYA 4DLXA 4EI7A 4EYEA 2WHRA 1D8AA 3WLIA 3C6QA 3CF6R 3SXPA 4CEJB 4R41A 4YAUA 4BJ3A 3LK7A 3RKUA 3V34A 4YCAA 2GNPA 4XW2A 4ACAA 3E05A 1C9DB 2G80A 2Y0DA 4AJPA 1FS6A 1NURA 1PGJA 2BP7A 4YAWA 3DNFA 5BN3B 4LOJA 1S2GA 5IJ0A 3PI6A 4NCIA 4FT2A 4RBNA 1N3BA 2IU0A 5DGTA 1G5TA 4BNYA 4JGGA 3AJEA 1NPDA 5K3AA 4L78A 2DECA 1E3TA 3W5SA 1JZTA 4RD1A 1JHVA 2AQKA 4FT4A 3W34A 3IQGX 2WWVD 2YV3A 4BX9A 3ACCA 1JMVA 1O94D 1SHKA 2I4MA 4RTKA 3NP9A 3I04M 4HDKB 2V9CA 1I5EA 1ZGGA 1E58A 1SUDA 4YJFB 3VSAA 5BWLA 4RJ2A 2H18A 2OAQ1 1CY1A 2G04A 1B76A 5HIMA 2F8MA 3OG9A 5DISB 2GCGA 2R8OA 2ZJAA 3EPPA 4G8DA 1HBJA 1I30A 4EPRA 1A88A 4UVIA 4ZVKA 2R6JA 2VP6A 1ZVJA 3DZFA 3EXHC 4PXAA 4WXYB 1TAUA 2ONJA 5CIQA 1CR4A 2HJRA 3MWDA 1QGAA 1XDBA 1CY7A 1JQKA 2TRSB 1UJNA 1BA2A 2QI9C 2YRFA 4KYIB 4YECA 4UHEA 1A9XB 1V7PC 1SKUA 1RQ7A 5BNFA 5KHAA 1Z15A 5ENZA 2Z83A 4N0DA 1NNEA 2HA4A 4OK6A 4JLBA 1WP4A 2QN2A 3IXLA 3F8TA 4QQRA 1SB8A 4GECA 4QBHA 1YVRA 2J30A 5AK3A 1R27A 4CR6A 3HEMA 1OXMA 1JDJA 1MQ9A 4N1AA 3BA1A 4EUSA 1UAGA 2F3RA 3I4CA 1W7AA 1UBEA 2REQB 3HDGA 4JJKA 2ZCUA 3LUGA 5ER9A 4FILA 4QUJA 1NUSA 5AR1A 1OFVA 2IITA 2FF7A 2GGSA 1SZJG 3JQDA 4GGOA 3CNHA 1U1EA 1U5CA 3ULKA 2DLCX 4UPDA 1Z38A 1BO6A 1F1JA 4RJJA 4MQEA 1LU9A 2CXUA 2J4DA 4K7JA 3MJ4A 3U48A 4ZXPA 1QE5A 2CYCA 2ZVJA 1K7EB 1TKAA 1E1CA 2QVBA 2FMKA 3NTOA 4QGAA 5COBA 4KV9A 5KNCD 5LPNA 3G1TA 3MCAA 1F3LA 3GGPA 3QYJA 2BH2A 4LV8B 621PA 1KO8A 4CU5A 2C2KA 4D4IA 2FRDC 1QGOA 5ILOA 1RXCA 3AHDA 4MUYA 1DAKA 1ZL2A 1HL3A 3BE6A 3PFGA 1UQTA 4H4EA 4URWR 4DMGA 1KYQA 1YQWA 1EUZA 1UAYA 4BNDB 1IXKA 1Q0UA 5B4UA 3QKWA 1T6BY 1I13A 4Y9UA 3D31A 2C03A 5FWXA 4ARBA 1T8PA 3ZHSA 3KD2A 1IUKA 2CL7X 3DDZX 1F6DA 1YQQA 2B5VA 2QLJA 3Q9SA 4L3WA 1F17A 1W34A 1Y34E 3NYWA 3WGGA 3SY8A 4D9EA 4H1WA 2NSLA 3VU3A 5E8RA 4ZIRA 4M60A 4NJMA 5F76A 4RU1A 4BVBA 1BN6A 5FOQA 2CJWB 4AJ9A 1JAZA 2QMQA 3NOVA 1BXRB 1DTWB 2BHTA 1F8FA 1EM6A 4KMOA 2KJQA 4CMAA 4KQ6A 5K8IA 3GJQA 3WL8A 1TVMA 3H2ZA 2D4HA 1YFLA 1PLLA 1MW8X 4YCLA 3IDQA 1MC4A 1VM6A 4A16A 4YMGA 2IYXA 4U9HS 5ULLA 4RD2A 1I3NA 4KN6A 4UM5A 4KQXA 4XIFA 3W1VA 2C5HA 1ISPA 2Z2ZA 1T3ZA 1WSDA 4X20B 2BGMA 3SE0A 1ZNZA 2ISCA 5T3YA 421PA 5I01A 4XUCA 1O6GA 1QZ3A 3H1BA 4KIGA 3DLAA 5EGSA 1JA1A 2H2GA 1NMSA 2AD5A 2VFAA 3EIFA 3PD7A 1Q19A 1NXOA 4BKUA 4F93B 1F14A 1W76A 5DVZA 1ADCA 5CG1A 3JY6A 4A3SA 3ADPA 2C00A 1HKHA 3CRRA 3LH5A 3N2NA 3DFFA 2XSZD 3E9YA 2NZYA 3BVPA 3N3AC 5E6SA 3SEZA 4HNTA 5I7OA 3QH4A 4I50B 2JJMA 1NLYA 2Q4OA 3UEOA 1TUGA 1HETA 3K8OE 2J5XA 4G89A 4P34A 3HZOA 3BD6A 3KSRA 3FPEA 1TQ8A 1EXWA 4ZZ0A 1ZRSA 2A7QA 2KLHA 3A04A 3LY5A 4GC9A 3S0JA 4JKIA 4P08A 4JI2B 1SA0A 3G23A 3N2ZB 4QU9A 2ZE6A 5J40A 2P5SA 2LD4A 3IAFA 1YNOA 5TV2A 2CE2X 4BUZA 4FUQA 2JJ2D 3VDNB 2I3BA 1JDTA 4WUVA 4UZSA 5D5PA 1VKOA 5I7VA 4DV1B 1M76A 5KSWB 4NCAA 1Z5UA 4GXTA 1JPVA 3C3WA 2PA0A 5C8VA 1AV6A 4RPJA 4MKRA 3NXSA 1YBFA 2A5FA 2HWXA 3KJNA 4H7IA 3VC1A 2LUOA 2R8BA 2WJWA 1EFTA 1A97A 4I3GA 3DLHA 1EKXA 4ID9A 1PN3A 4G0VA 4XPZA 1WY5A 3GI1A 2UYQA 1XX6A 1P2DA 1XMJA 2I87A 3V7WA 3PRYA 2JAXA 4B8YA 3D3NA 2FF5A 3KXIA 4GOOD 1BH6A 4O8ZA 2A1TS 2P40A 4LRQA 2ZXUA 4QELA 1EK0A 3VYRB 3TUZC 5GGXA 2B8JA 3QFFA 2V6IA 2V9ZA 3S4YA 4GKJB 2UZ1B 3H13A 2FG7C 4EY4A 4H0FA 1NT4A 2Z56A 2ESRA 4XOIA 3CVUA 2IYZA 2MHCA 2ZRCA 3RSZA 4KR0A 3UGJA 3GPDG 5JFGA 3W3AD 1KA9H 2NZJA 1U0JA 3EEQA 4ODIA 3EVCA 4M8NE 1BKYA 1K89A 1UBTS 1TADA 4ZQBA 1IUOA 3A25A 1G55A 1Z7BA 1ZH0A 1KOFA 4OGFA 1U5BB 4KTVE 2G67A 4ESVA 4WLNA 1R18A 4Y6LA 3IAS6 2CJYA 1TQDA 2QRLA 4CM8B 5DN6A 1PVOA 3WL3A 1Y4DE 5ARDA 3AOEA 3L1KA 4XJSA 1VLLA 2DT8A 5KTKA 1KMHA 1WZCA 2AGVA 3IVAA 5HIKA 4BO7A 5K4GA 2WIKA 1UBKS 4GXNA 4MS3B 4RTMA 2BEUB 3MJVA 4A27A 1MB0A 1CUJA 3C74A 1HMYA 1H1TA 3CZ4A 5TEVA 4AG3A 3F67A 5JARA 4J43A 2Z4TA 2HR1A 3PHGA 5J4YA 2FLVA 3N8GA 4UE6A 1U8XX 1FYEA 2GM5A 4E0BA 3L07A 4J16C 3S5JA 4LYDA 4D3XA 1R7RA 2VBIA 3HM2A 4J0FA 2G76A 3PR1A 4R9NA 5EWMB 4CQMB 5DZSA 3D8HA 4YUXA 4X62B 3NHRA 3CUVA 2AH5A 2HWUA 1YJ8A 5EP2A 1CYEA 1YMVA 1MGPA 1RTKA 2A0YA 2D7JA 2GZMA 1G7CA 2VHWA 5CX1A 4BQRA 4D82A 1GPH1 4O2LA 1K86A 1C7IA 4AZTA 1ZNWA 1FLAA 2FN4A 2QQEA 3UTDA 5TS2A 3EDQA 4MCAA 4C22A 2RI1A 3FCSB 4L9SA 2HDOA 3BBPA 1G8KA 3OQ1A 4LWOA 4X66B 1YQEA 4K9QA 3H1PA 4TM8A 2ZUTA 8LDHA 3LL4A 1WCXA 4AZWA 3O84A 1NY5A 1TM7E 4LJYA 2R6HA 4XGKA 3S8EA 2Q1XA 4OYYA 3VV2A 1OSNA 1BMDA 1UH5A 3Q3GE 4B4WA 4EUEA 1RQ2A 5L3VA 4QOSA 3OQNA 4QYIB 1I2DA 3H18A 2VR1A 4IXNA 2X9QA 4AJEA 2O0KA 3OPXA 1XCPA 4OREX 2WKQA 1TQHA 3QEKA 1N0IA 1ZC4A 2Y0PA 3DOCA 1U0NA 2Q5HA 1CVRA 4PR3A 4JY7A 5JE8A 4ICIA 3ZJ5A 3TJMA 4ZANA 3E9ZA 5MHTA 1U4NA 1KORA 4GP9A 2ES4A 2J67A 2VRNA 1QHFA 2JATA 3EYAA 4UNNA 1EU1A 4Y6OA 3W3AH 5T3UA 2VYQA 3R5JA 1A77A 4HH0A 4F4UA 3ZEAA 1FMCA 4LNHA 1P18A 4N49A 2BGIA 1JEJA 1MZVA 1X80B 1TMKA 2FR1A 3P9PA 4LZLA 1LI4A 3W1EA 1GAWA 2Q2WA 1JSLA 3K4HA 1R6VA 4LBYA 4BGIA 1P1RA 3PPVA 2FXIA 1OLXA 3DO8A 4ARZA 1JHUA 5LZ4A 1EK2A 2CF5A 5D3KA 1ZSVA 3K1JA 3Q40A 4ZVQA 2NUBA 2Y0EA 3AP3A 5K4AA 1OX4A 3RFCA 4Z9YA 4H7FA 3MRVA 3F5SA 5B1DA 4WK6A 5HMMA 2D0OB 3BKWA 4NS4A 3I1FA 3UFXA 1IVSA 3AY0A 4WNIA 1EHIA 2HK8A 3UV3A 3X2EA 3IRVA 4PRZA 1CE8B 2MMGA 3TSAA 2IS1A 1CJUC 2UV8A 1WY7A 5HEKA 1PFKA 1ZCBA 2RGXA 3KQNA 3THXB 4C2UA 3C3BA 4R5MA 4K3VA 4WZBE 3SR3A 2UUBB 1W4BA 1UDXA 1E96A 2V7QD 1HE2A 4UCFA 4I4TF 5CB4A 1N2BA 4A0QA 3CUTA 3A9CA 4QUHA 3TL6A 3ZHQA 3PNBA 5JROA 1BW9B 1I2ZA 2BFFA 5EWJA 4EFKA 2EERA 2ZULA 5TY0A 2BMJA 2VP4A 5BSFA 4LI0A 4NPHA 4TTVA 4V3BA 1MQAA 2GD6A 1AOXA 1BN7A 1XI2A 4IICA 4PLFA 1Y8QB 4B34A 1ACMA 3B1VA 4OB7A 3KZ1E 3A27A 3K09C 2FN7A 4RY2A 4XIYA 5ALPA 3JAMA 2PBLA 2AKYA 3EIHA 2EQBA 1Q14A 3GN1A 3KQHA 1BH2A 3OZIA 3RYFA 4WESB 1TW2A 1VA4A 1UBSB 1GTVA 2FOLA 2WICA 2ZUCA 4LXYA 4Q21A 3RYTC 1DC3A 2IX3A 1K1EA 2DFNA 2W6OA 4MMXB 3TLEA 4OBXA 5ABPA 5HXAA 4R8RA 3KG2A 5IBCA 2N3ZA 4B46A 1ZO8A 5C5EA 2QVXX 3B1XA 1U04A 3MMZA 3PP8A 4ZWNA 2WHPA 1RWKA 2DBZA 2B3DA 3UGKA 1E3WB 4J6FA 3WMWA 1KSGA 2GZ1A 3C7TA 1SVWA 2O8DB 2XRYA 4DCSA 3SXUB 3T1YB 4HCJA 5HBRA 3F7MA 3V97A 1V35A 3GJ4A 4MQFA 2HZ7A 4JR1A 3ENNA 2A9OA 3VR6D 3WLMA 1JP7A 3HR7A 4DM7A 1YBAA 4YCMA 1UDBA 1WUHS 5I7UA 2CVHA 4PGMA 2IYLD 3ED5A 4AMBA 2WVJA 1L9XA 1Y5IA 4RV5A 1XU9A 5ESWA 2ZRMA 5P8WA 4CG2A 1BDHA 4MGKR 2H5IA 1M2VB 5BV1A 1KFKB 1V8OA 2UYGA 3NRJA 4HS9A 1GU0A 1NUTA 1GKKA 1NOIA 1Y4UA 1MJNA 1T8UA 5D3MA 4PSAA 2DFLA 1W93A 5G41A 3SJBA 4DIDA 5KCMA 3HXQA 1AQYA 3MSXA 3KTFA 3OWXA 2QUJA 3BWYA 4F2PA 1IHPA 4PW0A 4OI0A 1VOTA 2RHOA 2XCQA 1JR3D 1E5QA 2G5TA 3MCZA 3E3LA 3RSOA 4AF7A 2K4MA 1E89A 3TNYA 5H4GA 3NOQA 3D0OA 1XQYA 3V42A 3A0RB 4A92A 4ETMA 1MBZA 5A1JA 1LVUA 2XKAA 4MAAA 4JLPA 3DKVA 4I9GA 3SAJA 3D3EA 1E60A 1G8PA 1PSZA 2BE7A 1PEDA 3ENZA 3GH1A 3I04A 4N5NA 3WA6A 3W3ZB 3EVAA 4RWEA 1SCUB 1NFFA 2VXYA 3UKOA 2PUBA 2XF8A 2KMLA 2PY6A 3GRFA 3H42B 4YQFA 3P5SA 2X9VA 3I5YA 1IY1A 4HWOA 3IPYA 3ESRA 1PO7A 1TVKA 2ZRIA 4YNBA 1XMPA 1I7NA 3FYDA 4KVGA 3REGA 2ENWA 4P36A 4D9GA 3MWEB 4CLEA 1PJ3A 1GPBA 3EA0A 1WX1A 5H0IA 1NN3A 3MUEA 3BZWA 4P3YA 2PM8A 4ER6A 3FH0A 1FXSA 3M2PA 2EJBA 3CJTA 4L5AA 1ZH6A 4EB6A 3COWA 4KXYA 2EC5A 3L7MA 3U80A 1BGWA 3B9QA 3IEUA 5BNZA 4TVSA 4RMIA 2VP2A 3B2NA 3DLIA 3K0CC 1RACA 4LG1A 2ET6A 4XIJA 4WOJA 2JG3A 1PK7A 4PG7A 2W0MA 2PZ8A 3RC7A 3NX4A 3WWOA 3M6WA 1CB7A 3ESBA 1X7ZA 3GMSA 2QRUA 3OF3A 2GDJA 2OCKA 3O0DA 3ZTTA 2R6ZA 4V1CA 3CX6A 1BU5A 4YV2A 5JNTA 3R0VA 4IDDA 3OSUA 2P62A 1E9VA 3WJ2A 3A26A 4EI8A 1TB4A 4Y3UA 3O95A 2ZE5A 1Y8RA 2JAOA 3QYAA 1SH7A 1JWBB 1M3SA 3T5DA 1DU4A 5KREA 2NU7B 4J7CA 3A3YA 4M9UA 3PB3A 4TWJA 4ZO7A 3WKEA 4QDKA 3DNMA 3MGGA 4NZYA 5IAOA 1AQNA 4K87A 1II0A 4Z49A 5JVDF 2I8AA 3BMCA 5GONA 1XLTC 2VZEA 1LBSA 3JVDA 2PMFA 2ZRGA 2I2BA 4I19A 1PP4A 3O75A 1ZI8A 4UREA 4CW7A 2PUCA 2EDAA 1FQOA 2C5FA 5DK4A 2VNIA 1WZIA 3I92A 1NMQA 5HM6A 1JEDA 1IWBB 2YIDA 1QV7A 4XWGA 2V45A 1Z9BA 3DUFB 1EJ2A 1CB0A 1WVIA 3PSHA 4RPIA 3BSFA 5DCWA 5LP6B 3PNSA 2YMMA 3QY0A 4BB5A 2IYUA 5EZYA 5HE9A 2ZJOA 2JLQA 2FSVA 1DS6A 4PN3A 3UKJA 2VP3A 4R4JA 5IT5A 5FJJA 1LTQA 1M67A 3G5AA 4PZPA 1YL6A 2VF8A 3W8FA 2FWBA 1O03A 3REOA 2A35A 2B7CA 5KYYB 3QOXA 3L79A 1XHFA 4BQIA 1NXXA 5FPYA 2NZWA 1PR9A 4BZZA 1KIFA 3A2KA 1T3GA 3KPJA 5ALHA 2ABWA 3RBAA 1PJTA 4IRUB 4D4GA 4BEWA 1JHQA 1FK8A 1OXTA 3N1UA 4HB3A 4WBNA 4QYTA 2R44A 1TM1E 4NMWA 3EC2A 5FTWA 3LBIA 1BWPA 2TMDA 4LNAA 4MMYB 1DZ3A 1CUSA 2MCFA 3TG8A 3BD7A 4ZO6A 1IJBA 2OENG 3HBAA 3EQ7A 4LYHA 3IDZA 3W90A 1EINA 1BG6A 2PWBA 3TFQA 4E7PA 1YE5A 4BNIA 4BCBA 2O2CA 3CZAA 4HTAA 4HWRA 4A1FA 2E1RA 3WWPA 1QPBA 4I08A 5IAKA 2J4CA 3UIEA 2H00A 4AX8A 1PWHA 3ZOZA 5EN4A 4IZ6A 1G3RA 4ZEMA 2CHEA 3RSHA 2K6GA 7REQA 1QH9A 4DMUB 1YAJA 3B12A 1X38A 2C2OA 2FTKE 1HDGO 1ETHA 5E4YA 5KHLB 1Q7BA 3VPDA 4FEAA 5LNK6 4U7DA 1X3LA 3O7MA 1R6XA 2JGIA 4N6OA 4NEQA 3SMVA 4DLVA 4AKHA 4A03A 3TVDA 4BAUA 1J4AA 1HZJA 4LRXA 5HZGA 2HZBA 3C1OA 2YWFA 2Z09A 1T5HX 1XDWA 4BRUA 2PQ0A 2K87A 1YZTA 1TNDA 2HU8A 2IYWA 4PC2A 5IU6A 2BR5A 2P68A 2O2EA 4Z6KA 4MRMB 3MIZA 2XMGA 3MGBA 1VJTA 1FF9A 2IXDA 1R00A 3WLEA 5KJ1A 1IPFA 3IURA 3LVBA 2O48X 4HGYA 4PIPA 1E9DA 4IQ0A 2AL7A 4YAEA 4Z0TA 4FFPA 3DLBA 3OCYA 2V6BA 2X2OA 1K6IA 3OM1A 4IXDA 1PIWA 2C59A 3L5OA 4B71A 4YRBA 5FO1A 4BC1A 2YZ7A 1TQ6A 2TMYA 3W4JA 4KDFA 2Q3FA 4BLRA 1C3JA 3GBSA 1QP8A 4BY9E 5H81A 1FZQA 3W9YA 2XB2A 1ICIA 1JEYB 1QS0A 1Y37A 2EJCA 2GJ8A 2HJVA 3U4HA 1T29A 4U0JA 5EZQA 3IPCA 1W87A 2OXEA 3LWNA 2W8BB 2ZEJA 3HCCA 5AHKA 4FOOA 4BB6A 1SZCA 3TNFA 5J63A 4BU1A 4C0QC 3DKKA 1IC6A 4N39A 3OEHD 1Q74A 3HVUA 4KI7A 4P3NA 4EFMA 5KKNB 4C6TA 1JFSA 2X3UA 4YAGA 1NYLA 3JYLA 4GRDA 5LB2A 1XALA 1HC7A 1QYDA 3K2IA 4P4TA 2PLFA 3B38A 1ZOIA 5A3JA 5KNCA 2ID8A 2VS1A 4AYWA 1OJ7A 4G2TA 4MEAA 1EQUA 1U5AA 4QJ4A 2I5PO 2WJAA 5JYCA 4RW0A 5AVKA 4RKEA 2A92A 1Z83A 5FBRB 2O2JA 3VU0A 4L6CA 3FZGA 4QPNA 5DBOA 1I6WA 2R5WA 3L6RA 4S0XA 2VYNA 1NX9A 4WXMA 2DTDA 2VJPA 5FOWA 1Y48E 5B3JA 5CPBA 5IRCD 3VJKA 2BT4A 2GNAA 3EUFA 3G3EA 4ACBA 2ECQA 3CXRA 3EBOA 4CF3A 1MV5A 4JVSB 5E0OA 3VSEA 4A2QA 4E6PA 5DM2A 4KIJA 5JI2E 3BWBA 1DEXA 1U99A 4FM9A 2PUAA 4XB2A 2QX7A 2IW1A 3GEDA 4QXAA 1JQAA 3UANA 4REOA 4B7XA 2PV7A 3C98A 4HDCA 3J81k 4DLWA 1CVLA 3PS9A 2VOJA 2OBNA 3FMPB 2BP7B 2CXSA 5L3ZA 2IE0A 4Z9AA 5IJ0B 3FMFA 5K5EA 4ENQA 1XZNA 2G70A 4PNEA 4W9MC 3VVLA 3UBTA 1ZCAA 1K7CA 2ATIA 4RNDB 3UMGA 5H9WA 2CUZA 4XSHA 4DR3B 4BGDA 5FEUA 1RXVA 3QG1A 4UEWA 4EHBA 2PGXA 5DULA 4MOWA 1UP7A 4O2BA 5B2ZA 1E3DA 4Q4JB 1VSVA 1NAHA 1AHHA 4KC0A 4OU5A 4U2BA 2R00C 3O3NB 2HRRA 1OE0A 3GLSA 1IJEA 5SZKB 4DXHA 4RJTA 4DIOA 3FNRA 4X1YA 1CR0A 4JMPA 4XFJA 1ONBA 4MIOA 6ABPA 2XSZA 4OFWA 4HZIA 1Y3DE 5DGHA 2AFHA 5E6RB 3WMRA 1EHCA 1KGSA 3BS4A 3D5TA 3DJYA 4FNMA 1F51E 1D6JA 1NBMD 1T0BA 1VCIA 3C1AA 3QKIA 4TS1A 1SVNA 2NXWA 4TV9A 1WEKA 4CHTA 1T8YA 4IMPA 4MS1A 1U7XA 2ZI7A 2P2LA 1SUIA 2QTLA 1UUFA 1GTRA 1IQ0A 3NS7A 1YDFA 3LQ4A 2B7BA 4YO7A 4IDCA 4AJLA 4EUKA 4ZALA 3AGQA 4NZOA 2KYRA 1G4UR 4HTFA 3ZCSA 1ESDA 4NH4A 3C8ZA 5JD3A 1EEHA 3CZ9A 3HFRA 2GN1A 2WHXA 5BWCA 4D6XA 1H2ZA 3RS4A 3BIWA 3L8ZA 3WGLA 4F12A 5LKAA 2XZLA 3VVCA 5HIIA 1QOPB 3DMRA 4ZYLA 2IP2A 3PD1A 1WB5A 5GWXA 4DE5A 3T4PA 3ID6C 2P9CA 4RACA 5FI1B 1H6AA 2WDPA 3O3CA 4KQFA 4QODA 2WZBA 4ENWA 5CA1F 3ETGA 4ZKEA 4MQEB 1FUKA 1PJSA 3FBGA 3WDLA 3D2BA 5IBRA 4BRZA 2HPHA 4RIEA 4S1WA 4RSMA 4XTRA 4C0AC 1Z0FA 1E1CB 2M32A 3IUBA 2NSJA 3RTBA 3L7DA 4G1FA 2NIPA 1V47A 2IIBA 4IYJA 5IH3A 3ZW9A 3SSNA 1THMA 3IUPA 4ZO9A 5D1HA 5J5AA 3NH9A 5CU7A 3UJHA 5JRDS 5LMCA 4HYEA 3TZEA 1SEPA 3HC7A 3QU5A 3LCUA 2B4YA 1E9CA 3NWBA 3LUBA 5FLKA 3M0EA 1Z2PX 4GVLA 1C3OB 2NP6A 3AF6A 2IRWA 3FROA 1A27A 3DE6X 4FCTA 3ZH2A 4L22A 4WNCA 4BX8A 1PTJA 1ADYA 3C8UA 3O83A 1C7QA 1D2CA 4GM0A 4QD3A 4BO6A 5JSZB 5LP6C 2WIFA 2KQUA 5I5GA 4K6MA 1RI2A 1XBTA 2J6HA 1M6VB 2P7HA 3GFOA 4OXKA 3HRKA 3SF8B 3ZHXA 1QH0A 4EA7A 1NJ2A 4D4LA 1ZSNA 4ZIRB 3B1WA 4NJMB 3RF6A 1K4MA 3IOMA 4A9AA 3DHWC 4PQFA 1ODSA 4KLNA 3G1UA 4NAHA 3A9WA 3I64A 4ZAXA 1OV6A 2A94A 3WMFA 4CIDA 2OSVA 1AKUA 2XYRA 3PUIA 1DKOA 5DYGA 1UR5A 3V1TC 1IYZA 3K0FA 4RDIA 1DBIA 4MJ7A 5DLEA 2Q1WA 3DOJA 5LVAA 5HBGA 1LFAA 2HIGA 1N7HA 2YXEA 2CLIB 3CA8A 1XQ1A 4OV6B 3L1UA 2BEWB 1FL9A 1RE1A 3RFXA 1JQDA 2RHDA 5E7IA 2BMDA 2QZ9A 4OP2A 4ZQFA 1NZDA 3PL5A 4BUCA 1IY0A 2DPLA 4BVHA 4PBRA 3KJEA 3PCTA 1D03A 4KK3A 1N5RA 3L0IB 5L7WA 1VCNA 2YW2A 3QVXA 1X9IA 4HMQA 3DF9A 2R7MA 1P5FA 4Y1FA 3SP1A 3ZKWB 4ER5A 5E6SB 3CYFA 3O8BA 5H7XA 3K4QA 4PPGA 4I2VA 4I4NA 3T7SA 1YZFA 1NG9A 1QIEA 4OYRA 3JWGA 4TPKA 5TRTA 4NBLA 3WK9A 4C43A 5IJXA 4IKOA 1OIVA 3ZC3A 1SD5A 1KO7A 1C4WA 1XF1A 1BEEA 1GY8A 1ODFA 1SA0B 4N03A 4OJNA 3EYWA 4XASA 5AM2A 2OC4A 4R1NA 5DTMA 2O3UA 3ZE0B 1NVVQ 3KM0A 4LVOA 2WVGA 5A3SA 4DIMA 2H92A 3M81A 5TMBA 3CB4A 5J4HA 2BI7A 4D4MA 1XYGA 3ITEA 3TLKA 2GBLA 2IXTA 4Y2PA 4EUHA 3C0KA 4UULA 5B37A 1T2EA 1QIFA 5LA6B 2ZJ0A 4KMMA 4RMGA 4GQIA 4UASA 4AMUA 4NFSA 1LI5A 5B6IA 2YR0A 3BGIA 1K5HA 5IP5A 4ROSA 4CE6A 1O4VA 1KHHA 2OB1A 3HN2A 3DZDA 5FTKA 4E03A 1Q7GA 2P6PA 2X1MA 2CLDX 3FGZA 1CF4A 4GMHA 5EKDA 5CT4A 5KQGA 3R7BA 4D8WA 1MRZA 4H7JA 4JOSA 3TW4A 4PN7A 2GX6A 1LK7A 1JIKA 2JBWA 1VIAA 2Y1OA 3HDYA 3K0EA 1N5DA 3OLWA 5HRCA 4N3CA 3DDWA 4OSEA 3IBSA 1Q57A 4N7MA 4W9NC 1Z5OA 2HQSA 4C2AA 3IDFA 1XVUA 1QUFA 3OBBA 1YRYE 1PVDA 3WLAA 4D4HA 4PO3X 1DB3A 4MLZA 1KJ8A 4QOIA 1A7KA 3SHVA 3R3HA 4GMGA 3VZRA 4X6LA 1DHRA 3GOQA 3CHYA 2BEJA 5IVKA 1F0PA 1K3FA 4ARCA 3P32A 2ZT5A 3WRXA 2GERA 5FOSA 2ZI6A 3DTNA 3ASVA 3VAZA 5JJLA 5HWSA 1R0YA 3ZZ0A 2QNRA 1EDBA 3QEAZ 4WLOA 2WFLB 4NZNA 4X90A 1R15A 3T12A 3UGQA 2ANCA 2B30A 3PT9A 1PYOA 1DG3A 1WS6A 2H2HA 2QENA 5JXHA 1UAAA 3CUYA 3WBJA 4L76A 1NUHA 1BWRA 5KJCA 2FRXA 4ENSA 4CG1A 5H80A 1NU8A 4ZDJA 5A5FA 3AF5A 4WQMA 1KMHB 3DB1A 5JD6A 1LPOA 2GZAA 2C9OA 1NW3A 4G9GA 4Z5XA 2ZM6B 2QY9A 4Q9KA 2YZ2A 3B53X 3BIFA 3PKIA 4KXXA 2DH5A 4IOKA 4OB6A 5TEWA 1BSVA 1L5YA 3NIDB 3C6XA 3COZA 3G9XA 1J7KA 2AC7A 3GGGA 4XDYA 5TGDA 5BW4A 3AF4A 1JHOA 1DEKA 3H4IA 2O0LA 4CV1A 4AMVA 4ZAFA 4F4CA 4TMTA 2X0DA 4FWTA 2JFFA 2PLRA 2V03A 1Z6AA 4JAVC 4JOQA 2R7NA 4DHEA 2X58A 2V5VA 3GBVA 4D0NA 3RAFC 2F1HA 2W8ZA 2ZYUX 3R5HA 4YRDA 4EJ6A 1AH2A 3OIFA 3R0QA 1FNDA 4L8WB 4MRAA 4OMCA 2G6BA 4J1NA 4ZOLF 5CX1B 1Z73A 2C04A 2FSUA 3LF1A 2FUKA 1WB4A 2O8CA 4BVEA 4JCCA 1KRXA 4ZT4A 1E7MA 4KUGA 2JVIA 1B6RA 2IF0A 1A3CA 3A1NA 3L8MA 4HYYA 1FU8A 1I3KA 4GPBA 4WK2B 1FMFA 2JB9A 3IKLA 3MMSA 2FQYA 1G6HA 2QD5A 3IEPA 2PRZA 3WJ1A 1UK9A 3AVYA 1RAHA 2GZSA 3RYHA 2VSFA 2H5JA 2G77B 1U2EA 4N76A 4MX8A 4Q3CA 4A91A 2ZTUA 4HBGA 3PGXA 2Z5LA 4RVFA 1O58A 4RF3A 4TTAA 2JLYA 2LWIA 3AR3A 5E3HA 4IG4A 3FPSA 3ND9A 3MTBA 3QE3A 4O3MA 3DMPA 3VJLA 2QM0A 5TLSA 1AGPA 5HJ2A 4PG8A 4X71A 4PVDA 3NHYA 4ZAYA 1I7PA 1THGA 4X84A 4YPVA 4FHEA 3C3JA 1QRSA 2D7DA 3OHPA 1ZN9A 1BS2A 1J90A 1AK1A 2C58A 2DWOA 3BE4A 4MA0A 4IJ6A 2C92A 2JFNA 2Q1UA 3DOFA 3A9UA 4DUGA 4PPQA 3ZLVA 5FP0A 2PS1A 3PEYA 1W94A 4FNAA 2Q27A 4JSRA 3I12A 4MKZA 5AUOB 1Q6YA 2PA3A 3IQWA 3T1TA 1LSUA 1ZN8A 3RD5A 3ROXA 1DRJA 3P5BA 5LQDA 1I80A 3ER9A 1Z0DA 3QYFA 4FONA 4F71A 1GFWA 1MCZA 4ZTZB 3Q7SA 3UB2A 3L1VA 3C3DA 2M1XA 2Z3ZA 2PZGA 4B87A 1J42A 1NW6A 2OM6A 2PQ6A 1T6XA 4BMDA 3GJRA 2WJIA 1NSTA 2GUWA 5LL6P 1ULAA 2R5NA 3BREA 3UFXB 1Z4PX 2QUKA 4J0IA 2WKSA 3EGWA 4O0MA 4DG9A 4E88A 2C4UA 2COUA 4UTXA 5JH7A 2B8TA 4N8DA 4QXPA 4UHJA 4POOA 1GJRA 3GG9A 4C2TA 3ONWA 4PAMA 4PY2A 3EN0A 3IT2A 1GUYA 4E5DA 2QIPA 4W5HA 5CB4B 1G0NA 2FSIA 1IVNA 5FBVB 1QB7A 1XMSA 3UAXA 5IS2A 2VTBB 2UVPA 2LNDA 2FX3A 4ID3A 4QU5A 1VRWA 1QTNA 5LD2B 3FI0A 1H5NA 3DBRB 3U17A 4PF1A 2BFFB 5EWJB 2HWKA 2AW5A 3F3KA 3AVXA 3UENA 4PE5B 4EOGA 3OFVA 3WQHA 2NOAA 3QV1A 4MLPA 2VXOA 4LA4A 1E7QA 1PKXA 1RXEA 2G0AA 2R62A 3CE6A 3PJGA 1PX0A 1FLDA 5EE0A 3EZ6A 4DIBA 1B7GO 3NUGA 5ED0A 1L1FA 4O1HA 4RAOA 4CMKA 1KZ1A 3F97A 3S1SA 2YWGA 1VI5A 5KVCA 1EBUA 3RFUA 4BE7B 3GP5A 2F3QA 3CISA 3FNGA 3RYFB 5L6MB 1WVMA 1DLJA 1PG2A 1X0XA 3EY4A 3LC7O 4TQUS 1EFAA 3A11A 2BBWA 3G7NA 2XVMA 5IUJC 1Z3IX 2QUHA 2J9GA 3Q7IA 4ITUA 2D5AA 2GXAA 1W44A 3AEZA 2QG4A 3HXOA 1FQJA 1TM4E 2WHPB 2Y0BA 1Y1QA 2WTEA 3R8CA 4ZU6X 5HK9A 3KTAB 1PZHA 2QRZA 3KT0A 2XQIA 5ANRB 2GPNA 3U7HB 2QJFA 4Y6RA 4JDUA 8AT1A 4F91B 3FOEC 1FDSA 2JGFA 4HDOB 1WDMA 3VO2A 5JZMA 4QEDA 4K3UA 5TQ0A 2ZUWA 2HA7A 3K1AB 2XVYA 4JH0A 3VYVA 1N1EA 3ZGVA 3U3RA 5JAUA 2R2GA 1ZYUA 2BMEA 4TSRA 1QG0A 4MW4A 4UHDA 1R88A 1PZNA 2JCBA 1JDUA 1G8FA 1GDDA 2JLAA 2QE7D 3HKCA 1I3MA 3WXMA 1ZD9A 1D0SA 2GLUA 3N9IA 3RODA 4M4SA 1ZR2A 2RB5A 3H5NA 1UWVA 3T0GA 5LLDA 3D6NB 2CXQA 3NH6A 1DJNA 2XF2A 2X6QA 4TTRA 1UFOA 4B3JA 2WWFA 4XLLA 1GNQA 1RRPA 3RREA 2GF2A 5PGMA 5BOVA 1SXJD 4L16A 3T3HA 1M75A 1FFCA 3L7BA 4R5HA 1FXWF 3LRXA 2GMWA 1L5GB 1GCUA 1F06A 4X65B 3W0LB 4EGAA 3OFNA 4QLAA 3AR9A 1H2YA 2GYVA 2RBGA 2VJKA 1DQNA 5I51A 3LQKA 4NECA 1VJRA 4KOAA 2XBUA 1SIBE 4C89A 5FTMA 3V7UA 4HEA1 3CJQA 3FE2A 1JHZA 5E3JA 1OU0A 3O2JA 3HWWA 5AOBA 1D0VA 1ONSA 2JJYA 2NU8B 1UBCA 2CKDA 3R0ZA 4OHPA 3N8HA 3LQYA 3IS3A 3LHFA 4JU9A 1BC5A 1XK7A 5AJXA 2EU8A 2XUJA 3P20A 5FUXA 3BXFA 2PS9A 2C0PA 1TVKB 3KVOA 1SEVA 4O4HA 4OQPA 2NU9B 1L9KA 2XTNA 1NJ1A 3WAGA 5HOEA 5BNTA 2WV9A 1A2QA 2AMLA 2OBYA 1A9OA 1AA9A 1CHNA 1C1DA 2C96A 2MT9A 3NBAA 4JT4A 4IVNA 4TTIA 5FA6A 2I3GA 2OV3A 4EB6B 2GN9A 3D0KA 5LQRA 1MD9A 4L8VA 3H4MA 1D07A