2GZSA

Enterobactin hydolase iroe complex with dfp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
265
structure length
249
Chain Sequence
b'PNIADKGSVFYHFSATSFDSVDGTRHYRVWTAVPNTTAPASGYPILYMLDGNAVMDRLDDELLKQLSEKTPPVIVAVGYQTNLPFDLNSRAYDYTPAAESRKTDLHRKSGGSNNFRQLLETRIAPKVEQGLNIDRQRRGLWGHSYGGLFVLDSWLSSSYFRSYYSASPSLGRGYDALLSRVTAVEPLQFCTKHLAIMEGSAGVLSKIHTTLTILKDKGVNAVFWDFPNLGHGPMFNASFRQALLDISGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IroE protein
molecule tags Hydrolase
source organism Escherichia coli
publication title Structural Characterization of Enterobactin Hydrolase IroE.
pubmed doi rcsb
total genus 84
structure length 249
sequence length 265
ec nomenclature
pdb deposition date 2006-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gzsA00
4NS4A 1HPLA 1TK3A 4PF1A 5ALLA 4WFIA 4HXGA 3X3HA 1ZD5A 1BEEA 3I1IA 5DNVA 2HDWA 4W63A 5E4JA 2I3DA 2AJLI 2R11A 4AO7A 2QKYA 2WUGA 1R88A 4G8BA 4U2CA 1VA4A 4C88A 3WWEA 4LYEA 2GYVA 2CB9A 3C45A 2G63A 4L72A 4UBKA 1XZMA 1ZD4A 2XLCA 3JWEA 1E89A 4QNNA 4QDZA 4Y2VA 3BE8A 2H7XA 2XUGA 5IVIA 3I28A 4KEAA 5K3AA 2RI6A 3O9VA 1M33A 5AOBA 1G42A 4XIIA 3WKAA 5DYWA 4KRXA 4TGLA 5FUMA 5JARA 1WB4A 2XUIA 3QPDA 3IVMA 4IH4A 4K6HA 5JAHA 2HFJA 1XZAA 1QIDA 4YK7A 3AUKA 4X97A 1UZAA 4C6HA 5ALWA 1GPLA 5HCUA 3KOOA 3GUUA 1K8QA 4MQLA 4Y2XA 5J3JA 4EB0A 2FX5A 1GQSA 2GBCA 1CUWA 1Z68A 3H18A 4FNGA 2ZVDA 3WZLA 4GEGA 4BAZA 1BEZA 1UK9A 3CCCA 3HI4A 3C5VA 1XRRA 1P0QA 2O7RA 1HBJA 2BGRA 4QLAA 5ALZA 4OPMA 5HF6A 1CUAA 3FYUC 5JIBA 1AZWA 4UHCA 3K6KA 1UFOA 2PSHA 4EBBA 2Y2VA 1CFJA 4Y2YA 5FKJA 4IHAA 4G1FA 1DWPA 2DQZA 3PICA 4Y2UA 3GFFA 1JU3A 7YASA 3WIBA 4B85A 3QPCA 3D2BA 2HA5A 4KRYA 5DWDA 1Y7HA 1MU0A 2C5GA 5AIBA 4J0CA 3WJ2A 2AXEA 4CIAA 2XE4A 3IULA 3LS2A 1CUXA 4Q3LA 4MYSA 1XRLA 3QMWA 4OYYA 1B6GA 3RARA 2ZSHA 2QVBA 3QYJA 1UXOA 5D3KA 5A7GA 2QOEA 5BWBA 2WILA 3KSRA 2CBGA 5AKXA 4HS9A 2Y1KA 2VA9A 4PNZA 1XQVA 1QOZA 2FJ0A 2HA6A 1A8SA 4PSUA 4BZZA 5ALYA 4XWGA 4Y2QA 5ALNA 1W4LA 4Y2SA 2FJPA 5AK6A 4J3JA 3W04A 3R0VA 2PUJA 5EIAA 4JH0A 3ESAA 1PV1A 1PFQA 1RYYA 4XVCA 4TPKA 1CUJA 4OCZA 1MX5A 1U2EA 4I19A 3H0CA 2X8BA 1CPYA 4YPVA 5BWCA 4UBJA 4XX1A 4KR0A 5IH7A 3ESDA 5LZ9A 4B0PA 2HRRA 1P0MA 2WU4A 1T2NA 4OSEA 3QH4A 2JGEA 3FSGD 3SWWA 1E8MA 3S2ZA 4B83A 1P0PA 1GKLA 3JYHA 4NZZA 1CR6A 2R8BA 3WK4A 1E66A 5AKJA 2Z3WA 2JEYA 4OUKX 2O2GA 4QWMA 4WFKA 3LP5A 1SOMA 4WFJA 1DQYA 4QDXA 2Q0XA 3HJUA 3LIIA 3FYTA 4BE9A 2WJ6A 3OURA 1WB5A 4AX4A 2QUBA 2JGLA 4BP8A 2XUQA 1QTIA 2JGMA 3C6XA 3HABA 4Y9SA 2Y2UA 4I3FA 3ZV7A 1XKTA 1SCKA 1CV2A 4M0MA 3VVMA 4N8DA 2X5XA 4FLMA 1LPMA 4DSZA 3I2FA 1XQWA 4JYPA 3E4DA 4EY6A 2Z8ZA 5AKZA 3ESBA 4NMWA 3HLKA 4Y2PA 2WIJA 4IH1A 1ODCA 5K3FA 2JF0A 2ORYA 4KE7A 5JAUA 3I6MA 2WFLB 5AM2A 1LPPA 4FFWA 1IVYA 4ZI5A 1DT5A 2HRQA 3WA7A 4RGYA 3IUQA 2C7BA 3I2JA 2XUJA 4DMFA 3WKBA 1J1IA 4EY5A 1X2BA 2XUPA 4CG2A 1WHSA 5CT5A 1DWQA 3V1LA 4AN1A 4MYDA 1CQWA 4QDTA 5ALGA 4MEBA 4J0GA 5DNUA 3H2HA 5A62A 2GZRA 1R9NA 3DCNA 4G9GA 4CCYA 1CEXA 1XRMA 1R9MA 2ZJ7A 2PPLA 3GROA 3AIKA 2C0QA 3D5EA 4AMYA 2I3ZA 3C87A 1CUSA 2VAVA 2QMQA 1E5TA 4BTLA 2XQIA 3K2IA 2QUAA 1ZI6A 1QIIA 5LKAA 1JMYA 1TCCA 3FCYA 2VJDA 1VXRA 1XQXA 2Z8XA 1TCAA 5JD6A 1E8DA 2WFMA 1R4ZA 4L0CA 3DLTA 3IDAA 5DNWA 4OU5A 3FAKA 3W9UA 3FLAA 1MN6A 4GI1A 3FLEA 3IB3A 2HL6A 5AOCA 2CKMA 3SX4A 5KWJA 5CT9A 4X94A 4OB7A 4FHZA 4B81A 3H19A 3T4UA 5HKAA 4FOLA 1XROA 2LIPA 5EI5A 1AMNA 1U8EA 1UKAA 4GWLA 5IVDA 3OM8A 4YX9A 3WK5A 2V96A 1IUPA 3G0GA 1VXOA 1N8SA 4MWTA 4C01A 4QE3A 4V2IA 2DSNA 3WA6A 1EB8A 5JAOA 4BC0A 2W6CX 4AO6A 1XZKA 3BJRA 3I2GA 3FCXA 4UHEA 4G4JA 4DMCA 4H7JA 1OCEA 3ESCA 4BBZA 3AZPA 5CXXA 3DQZA 3OOSA 4FLFA 5EHQA 3WKEA 3VJMA 3D2CA 2B20A 4Q34A 2VTVA 1ZIYA 1AQLA 5AKGA 2XDWA 1XRNA 3OG9A 3HYSA 2ROQA 2XMZA 3VDXA 1YASA 4CG1A 3WL6A 1JJIA 1PJAA 5DYYA 5D6OA 4E15A 4X6UA 1ZIXA 5ALKA 5LZ7A 5JALA 3UUFA 2XMQA 1XKLA 4P92A 5AJHA 4JUIA 3L1HA 2B9VA 4W1RA 1GKKA 4W9RA 1U4NA 4P93A 4UFOA 5CT4A 4QDUA 1QIFA 3H1BA 1WCYA 3RKSA 5AKLA 5HFAA 4MWSA 2VJBA 3QMMA 2YASA 1NX9A 1DX4A 5BV7A 3BDVA 3BL8A 5JYCA 5HKBA 3FSGA 2BKLA 1GQRA 4UUQA 1XLUA 1YSCA 2ZSIA 1CUCA 3DOIA 4U2EA 4B9AA 3EQ9A 1THGA 3UMJA 5ALUA 1LBSA 4HRYA 3IBTA 1H2YA 1QZ3A 1A88A 5AM5A 1RP1A 1LPAB 3W05A 4ZXFA 1XZLA 1AX9A 5A7FA 1E3QA 2WSLA 4FNMA 3D59A 4Y2RA 1TKRA 2NW6A 1ETHA 3VISA 4ETWA 3RK4A 1VZ2A 2I03A 1TIBA 5LKRA 4H18A 3YASA 2GYUA 4DMKA 1YAHA 6YASA 4FDMA 4AB1A 4ARBA 4KAJA 1A8QA 1YS1X 5DLPA 3H2JA 4H7IA 4UBLA 5K3BA 4X95A 5LIPA 2PU5A 3L1IA 2PX6A 5D3ZA 4J0KA 3QPAA 1EA5A 3HACA 4U2DA 1Q0RA 4PV7A 4BP9A 3PFBA 5C81A 3STVA 1GXSA 3AINA 1L7RA 4B6GA 3FYUB 2RHTA 3H2IA 5EHZA 5DTIA 4WJLA 1MNQA 4WY8A 4J0DA 2WQZA 4J03A 2JGIA 5AM0A 4QDOA 1EVQA 3PDCA 4Y7DA 4QZVA 5AHXA 4BAUA 3G7NA 1WB6A 1WPRA 3AFIA 1XZDA 3ZLTA 4B7ZA 4I4CA 4A5SA 1AGYA 3Q0TA 4DGQA 1N5RA 4K6GA 5ALDA 2WG0A 3O4HA 1W75A 3PUHA 1GGVA 4EA6A 1XZHA 2WJ3A 3MVEA 1LZLA 5A7HA 2EEPA 1EDDA 3EQ7A 1EINA 4PSDA 3QZUA 4W1SA 2HA7A 2VJCA 5DTJA 1ZJ5A 4XJVA 4UHBA 5HFNA 4RPCA 4IO0A 1YCDA 4CI9A 3WLAA 4ITVA 3A2LA 1WOMA 3C6ZA 2C4HA 5JZBA 1B41A 4BAGA 4UPDA 1QO7A 1U65A 5AKYA 1XZBA 1ZD3A 3HEAA 2PU7A 3WWDA 4AZ0A 4X6XA 1LLFA 4Q3KA 5FLKA 1CUEA 1EX9A 1SCIA 2JEZA 2OQVA 4CG3A 1CUBA 4GXNA 4C89A 3B12A 3QM1A 3GA7A 3R3ZA 3ANSA 2CZQA 4RNCA 4N8EA 5ALHA 5HQ3A 2WJ4A 5EIEA 1E8NA 4DNFA 3EIOA 3AZOA 3A2MA 1ODSA 4J7AA 3DKKA 1VA5A 3IUJA 3ICVA 1YB7A 4UBOA 4BCDA 1AURA 5CMLA 2XMSA 5T4BA 2UZ0A 3VJKA 4X71A 3QVMA 4K6KA 3QMVA 1XZGA 4X6YA 5CT8A 5EFZA 1LPBB 3FLBA 5CXUA 1EDBA 3Q8WA 4CCWA 1AUOA 1W1IA 4C4ZA 1QO9A 4M0FA 4BE4A 3WQHA 4BDSA 4EY7A 1H2XA 3I2HA 1ZJ4A 4BRSA 5SYNA 3FWHA 3M3DA 3R3VA 2ZYRA 2DR0A 2OLEA 2XQJA 4EY4A 1BN6A 3VJLA 3KD2A 3WZMA 5AI9A 3DL7A 4BB0A 3AILA 4INZA 3WKCA 1YR2A 2DQYA 5CTAA 4FKBA 4A16A 5JADA 1VLQA 1JKMA 3D2AA 4G9EA 3PF8A 2PSEA 2HM7A 2XUHA 2WFLA 2VQ6A 4RE6A 4C4XA 2AJ8A 4KE8A 1DTEA 1QTRA 4ROTA 4G5XA 1XRPA 3DYIA 1R1DA 4D9JA 3C8HA 4BVLA 2QXUA 1UK7A 4ZWNA 2OXEA 2RGUA 5ESRA 3ZLUA 4BCCA 1F8UA 3AIMA 2HA4A 1HDEA 4Z49A 4H0CA 4HXEB 1WPXA 4BZWA 1UK8A 5FPQA 1BE0A 2YYSA 3WL7A 2DHEA 2QJWA 1L7QA 3FVRA 4AXBA 1IUNA 2B61A 5H3HA 4LXIA 3DYVA 1Y37A 5EGNA 2K2QB 1MNAA 3O4JA 4UHFA 5E4YA 5CT6A 3G02A 4X91A 1O6GA 4OU4A 3ED1A 3B5EA 2WIGA 1EK1A 2GYWA 4QA9A 3E1GA 3H17A 4L9AA 1UKCA 4BC1A 5AM3A 2XT0A 5C8XA 2BGNA 2HU7A 4RE5A 1C7JA 1QIEA 3KWFA 4G8CA 3V9AA 2H7CA 3ILSA 3W2TA 3HXKA 3ANTA 4PSCA 4KYVA 3RLIA 5CH8A 4BTVA 3BXPA 4F21A 4F5ZA 2J3DA 2OQIA 3WK9A 1K6EA 2BUBA 3I6ZA 4OB6A 1ISPA 4EHBA 5AK5A 3K9BA 4W1PA 4WY5A 3D7RA 5HF5A 5EHNA 3DKRA 4Q1VA 2OGTA 3DNMA 4PW0A 2WKWA 4LYDA 2WUFA 1CLEA 4DMHA 1EXWA 4AO8A 4J0JA 4PO3X 3NWOA 5YASA 4P9NA 2H7YA 1MAAA 4KE9A 1JI3A 1O6FA 1LZKA 3D3NA 2V9ZA 2W22A 4G8DA 1OILA 3C70A 1QGED 3W9BA 1MAHA 3C8DA 3F8SA 5T4EA 3QBJA 4B0OA 5C8VA 1FFDA 1WHTA 3UUEA 5LP1A 1H2ZA 2H9YA 3N2ZB 3G9XA 5AH0A 3CXUA 4Q82A 1FFCA 2BUAA 2PBLA 5K3FB 5JD5A 2HU5A 4OD0A 4H7KA 1VJ5A 3WWCA 2OGSA 4HTAA 2VJAA 2AJDA 3WYNA 4BVKA 3ZLVA 4UFPA 2G5TA 3O95A 1HL7A 3MGAA 5FV4A 1EI9A 1BCSA 1BN7A 2BUCA 3R3UA 3KXPA 5ALRA 4UHDA 4IH9A 1ORWA 5LZ4A 2IX9A 2AJBA 3PUIA 3DOHA 3V1NA 3BDIA 4FFVA 3IUNA 1QE3A 3FBWA 4U2GA 1VE7A 5FPPA 3OTQA 3H2KA 4H35A 1ZGBA 2OCKA 4J0IA 2E3JA 3FOBA 3EBLA 5AOAA 4JNCA 1DX6A 3HC7A 3FVTA 2QM0A 2ZJFA 4QEKA 1IZ7A 1SC9A 1NU8A 2JBWA 1QIMA 5EHXA 4LIPD 5ALFA 1QJ4A 1G5FA 4Y2JA 2OAGA 3QITA 3WKDA 4S0XA 1LPNA 4B82A 2WHRA 2ECFA 1OXMA 2V98A 3PFCA 1CUFA 3TGLA 1N5MA 3WI7A 2YH2A 3WK6A 3G8YA 4NVRA 2HA2A 1MPXA 2OPHA 3STTA 1QIHA 5ALQA 2EDAA 2QR5A 3WYDA 5D7BA 1YA8A 1YB6A 3C5WP 1CVLA 5CRIA 1EDEA 1C7IA 5T4FA 1BU8A 4WDRA 2FUKA 1G66A 1GT6A 2HADA 1CIJA 4AN0A 1XLWA 1BROA 1F6WA 4AZ3A 1J06A 4GECA 1QIJA 3W06A 5I9IA 5AI8A 4W1QA 3TJMA 4G4GA 1ZI9A 2B4KA 5HF9A 3G0IA 4O08A 1X70A 2XMRA 4MJ3A 4H7EA 3BIXA 1ZOIA 2J4FA 1MTZA 5FRDA 4DTCA 1TQHA 2WTMA 1QIKA 1CUGA 2XUFA 3HZOA 1LGYA 2DHDA 1H22A 4BYMA 4BATA 1FSSA 2HFKA 2RAUA 5AICA 1SCQA 4C87A 5ISMA 1CUVA 1N1MA 5ALMA 4N5IX 2CEKA 2XMDA 5AK4A 1D07A 4GHWA 4A23A 5I8PA 4U2FA 2DCMA 4E11A 1RWQA 2HA0A 2Z5GA 5ALOA 5AO9A 1K63A 1T4MA 5AIAA 2HIHA 1Q84A 3NUZA 1JMKC 2PUHA 1UOPA 3CN9A 5HK8A 5BOVA 2QS9A 5AM1A 1A7UA 2O7VA 1F0PA 2VT7A 3ICWA 2PM8A 1G4HA 4BRZA 2VT6A 3VVLA 2BAGA 3D4LA 4UBNA 5K3CA 3STYA 2O2IA 4BVJA 1ACLA 2WUDA 4JYMA 1BCRA 2OCIA 4B80A 3DS8A 3R3XA 1UK6A 1W76A 2Y6VA 1GZ7A 5CH3A 3LCRA 2OCGA 4TVKA 1LPSA 2CUTA 5KREA 5K5EA 1EB9A 3H1AA 1VOTA 2XQFA 4HXFB 3TEJA 5LZ2A 2WHPB 1J2EA 3G0CA 4MXDA 3G0BA 2HHAA 5HK9A 2OCLA 3G9UA 5AI6A 4H7HA 2WG2A 1XFDA 3STUA 3C6BA 3GZJA 4H7DA 3LLCA 1EK2A 1NU6A 1XQYA 4ZV9A 3I2KA 2ACKA 2C0PA 1VZ3A 5CW2A 1AC5A 5AKEA 4KAFA 2I78A 2WUEA 2QXTA 5KWIA 1CRLA 2XUAA 1ODTC 2J4CA 5CURA 3R41A 1Q0ZA 1J07A 1QLWA 2GBGA 5KBYA 1XZJA 5HQ3B 4GBGA 5AKKA 2WIFA 3DEAA 4BCBA 3NOXA 2GBIA 1CUIA 2J3QA 5LLSA 3WMRA 2RHWA 3M81A 3BWXA 3IURA 2ZYIA 3N0TA 4X00A 1XZIA 1CUHA 3MUNA 5ALPA 2JIDA 5HF8A 1SFRA 5JASA 5C8ZA 1A8UA 5AM4A 5A6VA 3I2IA 4FMPA 1EH5A 4J0HA 4DM7A 3CN7A 2XUDA 5AI4A 2IIVA 2P8SA 2QTBA 5EIHA 1JJFA 4EY8A 3B3QA 4DLNA 3R3WA 4ZREA 3AZQA 1HQDA 4Q3OA 5AP9A 4UFNA 4KACA 3E3AA 3I1YA 1MX1A 4LXGA 4QLOA 2XUOA 3H2GA 3ZI7A 4G4IA 3A70A 1QFSA 4HZGA 3G0DA 1BRTA 4DNQA 4DYHA 1JFRA 2X76A 5CH5A 1H23A 2JGFA 3M82A 4ZV7A 1UT6A 2VSQA 2XMBA 3CCBA 1QIGA 3AJAA 5HZGA 1QFMA 3A2NA 4FLEA 1YAJA 1GPNA 2OGZA 1IMJA 4X90A 2VAXA 4KE6A 4UHHA 1FFAA 3H04A 3WL5A 1MJ5A 2JGJA 2VEOA 3C6YA 5IKXA 2PVSA 4H77A 3STWA 5AK3A 2WLSA 3F97A 2ACEA 3MUOA 1USWA 1EHYA 2Z3ZA 1XZFA 1DT3A 1TRHA 2WM2A 1YA4A 1ZI8A 4B84A 3RM3A 2ES4A 5ALIA 2V97A 1XLVA 1H2WA 4GLBA 4K5QA 5DJ5A 1MT3A 4E14A 1FFEA 2ONCA 4B9EA 2ZJ6A 4PQEA 4DNPA 2XUKA 1HLGA 4WCVA 3HRHA 2PL5A 1K4YA 4MEAA 1LPOA 4HAIA 5JD4A 5LYYA 3C43A 1FFBA 4P08A 2VF2A 1GPKA 4FBMA 1XZEA 3WWOA 5A71A 2VATA 3FNBA 2YXPX 3I6YA 3F67A 3L1JA 5JAPA 2OAEA 3PE6A 2C5FA 2RONA 3AIOA 1Q83A 2CJPA 4LHEA 4UBMA 5T4HA 1F0NA 1P0IA 3BJMA 2XQKA 2PKYX 2QJRA 5ALXA 4MQMA 2D0DA 5K3DA 3ZWQA 5AI0A 1YS2X 3EF3A 2AJCA 5LZ5A 3DD5A 5ALJA 1DQZA 1UOOA 1MO2A 1R50A 3R3YA 3O4IA 1FJ2A 2JGKA 1ACJA 1TAHA 4N5HX 3G9ZA 5ALSA 1IUOA 3IIIA 3FYUA 3DL4A 5FP0A 4QWWA 4CIBA 4UBIA 3F98A 3BIWA 3V1MA 2EDCA 1TCBA 2G5PA 3F96A 1ZGCA 2OG1A 3SK0A 4F60A 5FXMA 4K2AA 4EUSA 5JZSA 5JZ9A 1UOQA 5E2IA 2BFNA 3BF7A 3PI6A 4X85A 5ALEA 2D5LA 4FBLA 4AMZA 5AKHA 3PF9A 5ALVA 4HVTA 3G9TA 5IVKA 5A2GA 4EZIA 3V1KA 1UWCA 5E4TA 3TRDA 3O9MA 2CMFA 2QT9A 1JT2A 1KU0A 4BDTA 1W52X 4C4YA 3WL8A 5JATA 3U1TA 1HKHA 1JU4A 1ZD2P 2H1IA 1VKHA 4CCYB 1CUYA 1CUUA 3LIPA 5K3EA 3O4GA 1UKBA 4X92A 2XB6A 3R40A 4KAAA 2WHPA 3ZPXA 5FDFA 1KU6A 5I7UA 3VKFA 3U0VA 3IUMA 2HU8A 3STXA 3WK8A 2WFZA 4DIUA 2XLBA 1L7AA 4H7FA 1MX9A 3P2MA 4F0JA 2WIDA 5AI5A 1XZCA 2DHCA 3A6ZA 5ALTA 2QZPA 1AKNA 2WG1A 4L3WA 4FWBA 3VXKA 3IA2A 5DYTA 3WIOA 2C58A 1CQZA 1DU4A 4HRXA 3WK7A 1KEZA 1LNSA 3GELA 5C7YA 4YASA 3SC2A 1JJBA 1ORVA 1S8OA 4ZRDA 2GZSA 1W6RA 1K5PA 2ZYSA 2PSJA 2XMGA 2WIKA 2Y6UA 4Q05A 2HA3A 2XI4A 1R3DA 3S8YA 2RIPA 5JANA 3M83A 2IITA 1CUZA 2BJHA 2WU3A 3OC0A 4X7BA 3WWPA 1DINA 4LKOA 3BF8A 3V48A 4X93A 3HSSA 2O2HA 4U2BA 5LZ8A 1EVEA 3DDUA 5AKIA 3D0KA 3KDAA 1QONA 2DFPA 4OYLA 1C4XA 4AQDA 2PSFA 3JW8A 3T52A 3KWJA 1DWOA 4GW3A 4X3CA 1I6WA 4KJXA 2XMCA 4FTWA 4JEIA 1WM1A 2XQGA 1XRQA 2GBFA 3OPMA 3GBSA 4M0EA 4CFSA 2PSDA 2QRUA 5IVHA 3NGMA 4N8SA 1Y7IA 2BCEA 3O0DA 2WHQA 3WJ1A 1ZICA 5FOQA 1LBTA 4LXHA 5CBKA 3E0XA 1CUDA 4ZGBA 4WDQA 4Y2TA 1VE6A 3DJYA 1IZ8A 4E46A 4ARAA 3EQ8A 4GDMA 2WTNA 1X2EA 2G4LA 5F4ZA 2ZYHA 4DSAA 4OB8A 4DNOA 5SYMA 4IQ4A 1BS9A 1THTA 3F9CA
chains in the Genus database with same CATH superfamily
3P0IA 2B6NA 1PG0A 1WF6A 2XVAA 3DTNA 3RFFA 2I9KA 2OP0A 1C4KA 4AG6A 2FKNA 4PF1A 3K0HA 3PSHA 3I1JA 2R1TA 3SYMA 4WFIA 2A9PA 4HNTA 1K5GA 2WU8A 1ZD5A 1RI3A 2YHIB 1KVQA 4RKYA 1BEEA 3I1IA 1H3NA 3RABA 2YWXA 2XDYA 4YQYA 1AK9A 3TFWA 4NAUA 2AJLI 2YNMC 3O8DA 4S1VA 1CYDA 1PWYE 2R11A 3RRYA 1N2CA 2WUGA 1JTFA 1GR1A 1R88A 3KHSA 5A3SA 1U8ZA 3ROMA 3WDLA 3OZVA 1VA4A 3ANMA 5C80A 1IG3A 1T1GA 1K9SA 3K9QO 3Q1KA 3GJQA 2GYVA 4H16A 4LYEA 3X2SA 2Q5OA 3ZE6A 5KDLA 4FDAA 5CDFE 4UBKA 4Q9JA 3VDMA 1XZMA 4EPRA 4K87A 3MAGA 2VDQB 5DPMA 2R8XA 3CY6A 3H42B 4P3XA 2G83A 3VMFA 1ZAYA 1AHNA 1Q7EA 5CM9C 4LQ4A 4ODIA 4PNPA 4AIRA 4WGFA 1ENZA 4NFSA 4X65B 4C6SA 4Y2VA 2ATXA 3GUZA 3QNWA 2R1VA 2QPAA 3R3JA 5M2QA 2H7XA 2XUGA 3C85A 5EIBD 5TQ2A 1WBDA 5EQDA 5IAOA 3IHLA 4JJEA 4LJKA 1CNFA 3SEQA 1G21E 5K3AA 1TOAA 1N9GA 5I9BA 2FP4A 3O9VA 1SCDA 2O8DB 2ZS7A 2IOHA 2BHNA 3V4LA 1RXCA 3H8VA 5DYWA 3ZXYA 5LQDA 2DUMA 3AF1A 1YONA 3FKSA 4MS1A 2X0DA 3D54D 2MDTA 1NJSA 2PR7A 3R9XB 4AY2A 2IS2A 1S3IA 4MLCA 4L15A 1Y42X 3VPXA 4MIKA 2ZPUA 1Q5PA 4K6HA 4I4TB 3NFYA 3CMMA 3RC8A 1XZAA 3H1FA 1RXWA 1TUIA 2DJ5A 1VLJA 3BTSA 2H4ZA 4GPAA 2HV9A 1A50B 3AUKA 1SU8A 4OATA 5BUSA 4C6HA 2JK0A 2Q45A 2VHTA 1EUDB 5BQFA 3KOOA 1DDOA 1YS9A 2JD0A 3UXYA 5CFZA 1LF5A 3M4YA 4FDTA 4BNXA 3PNYA 3V7UA 3NWJA 4MP3A 2E18A 4HXYA 1NQUA 5E3HA 2OSVA 5G0TA 1PBNA 4H15A 4TRRA 1ZM2A 2GN4A 4TSKA 4I66A 2A0FA 1K2VN 2GBCA 2C1XA 2OILA 1JXAA 1SRQA 4ENWA 1AUQA 3RT1A 3EGDA 3D8RA 1G17A 4QPNA 3OKCA 4XH9B 5EP3A 2PTGA 4L85A 3RS4A 4FNGA 3RAEC 3AETB 2ZVDA 4PCAA 3DMTC 3O7MA 4J2TA 2YHSA 5IBQA 1BEZA 4BAZA 4EMSA 3C5VA 1N6IA 2J3KA 2FWAA 2O7RA 2BGRA 3IMCA 2JLAA 1JQ5A 1JG1A 4TQAA 3CT4A 1Z0ZA 3CX7A 4HAZA 1M2OA 3GJYA 2YS6A 3KFVA 1ZN8A 4HNRA 1C7RA 1U8UA 2ZB3A 2ZBFA 4Z5XA 4EATA 2RE8A 3QKSA 4HYQA 3ZUPA 5ELLA 1UFOA 3CNQS 1UT8A 3GBPA 1RKUA 3N8KA 2GF2A 5PNTA 3D5QA 1CFJA 1SKYE 4PTYA 5FKJA 4ZZ2A 4RL6A 4AT1A 5IZCC 4KW7A 1Z4KA 2HLHA 2OZLB 4B40A 3INGA 2DQZA 1UPBA 4U00A 1PX2A 1FB5A 1PVOA 4S3MA 3GFFA 2F1JA 4Z9AA 7YASA 2PUBA 4R1MA 3VU9B 2YRXA 4YRIA 4QFMA 4LJ6A 1O5TA 1RJGA 4B85A 5AK0A 3D2BA 3L7CA 3KKOA 1XDUA 2Q5EA 2CFIA 2HA5A 3LGSA 4F3KA 4CIVA 3WB9A 5LUAA 1Z34A 3TLMA 1P1FA 1BD3A 5DWDA 5HCNA 3ZW7A 1MU0A 1EK5A 1JE1A 3QBDA 1YZTA 5DOVA 3ZY6A 2VEDA 1R0XA 1I1QB 1ZCZA 3VYTB 3DUFA 3PA8A 5AHRA 4A27A 5EWMB 1T8RA 2RKBA 3EZ6A 1MA3A 3LVQE 3I09A 3IULA 3CZPA 3Q7IA 2PGJA 4L3OA 1TM5E 4LJAA 3L4SO 4MKZA 4Q3LA 3KQPA 1G7RA 1DJPA 1SUEA 2DH6A 2GHTA 1NVVR 3NWBA 3DZBA 4LX8A 5ELXA 1EESA 1E4YA 1ZSNA 3QMWA 3F6YA 4OYYA 4HWTA 2PLAA 1XDGA 2QVBA 3IS3A 3MQFA 5CVEA 1LB1B 3MYRA 1E6LA 2GKSA 1LDMA 2FWIA 4LI3X 3U60B 3TG2A 4M6WB 4PC3A 1USVA 5BWBA 2PJRA 2NZXA 2CBGA 2IKSA 3W3AA 4YJFA 3TEMA 2P1ZA 3EZLA 1PTJC 1XVLA 1Z6GA 4UUAA 4BRUA 3ZQ4A 2VA9A 3F7OA 2IYZA 3JD2A 2C9YA 2IL1A 3IT3A 2JHCA 3TTWA 3WGGA 4QXAA 5KQPA 2CDBA 2FJ0A 4GOND 2IT1A 3BN3A 3B82A 1OFTA 4WZ6A 2KQUA 4RAQA 4UTZA 4R1QA 4RS3A 3PEFA 4ZGGA 1NUHA 2V5AA 2P9JA 2CFCA 4ZOLA 5EQFA 1R3UA 4Y2QA 4EX7A 3DQPA 2I6SA 4XQ0A 5AW4A 1PJ2A 3KLNA 3ERCA 3LWZA 2AI3A 2NZVG 2FJPA 3AEUA 3P0EA 1W4CA 4Q16A 1JFFB 3W04A 2PUCA 1Z4NA 5C37A 2PUJA 4C3UA 5CP8A 4HG2A 1EVYA 3IAUA 3VVCA 1EBFA 3RRBA 2V4UA 2WJVA 3PIRA 3OTWA 4OGFA 1SBHA 2X0JA 5AT1A 1KE2A 4UDNA 3LCUA 3M6WA 4YP7A 3D43A 3GNTA 2MWMA 3L43A 3WP0A 4ZI7F 4Z4HA 3FE2A 5K99A 1HMYA 1TT7A 1NG1A 3DV0B 1X1CA 2O1WA 3F46A 1N2IA 1HY3A 2FG5A 4HAWA 4MIYA 2GAAA 2L18A 2CNKA 4G5RA 3AH8A 1IY1A 1U2EA 1MA0A 2REOA 1CPYA 3EBPA 1DXYA 1GL7A 2RI1A 2XSZA 1TC1A 3BAZA 4YPVA 5CB8A 5K8LA 1HUQA 1QGYA 2WLTA 4O2AB 4LJ8A 1UIMA 4GPEA 4LHWA 2QE7D 1B23P 1ND5A 4MVWA 4P7KA 2NVOA 2Q99A 5E4FA 3AI7A 2IPAB 1RRPA 2PS3A 3G89A 2XE7A 4FOSA 4L95C 1EWKA 1J0BA 3PXGA 5IVPA 3SHVA 2ZETA 3EDOA 4RZQA 3DTVB 1B14A 3H13A 3HFRA 4EM6A 5SZJA 4UE3S 4F38A 5HKKA 3S8EA 1O54A 3KV1A 3SY8A 1P0MA 2WU4A 4FR2A 3AO0B 3NAQA 1EZ4A 4UMDA 3ZJTA 2OV3A 5JH7B 4DIFA 4O63O 4OTZA 2VRCA 1UBRS 3FSGD 2P69A 4HGNA 3VTFA 3ZY3A 3RUCA 1P0PA 2IP4A 1OI7A 3B6MA 3ESZA 5JO0A 4HWKA 1SBYA 4P5DA 1C9NA 2Y1EA 2CXUA 4TUYB 2TECE 2D13A 2FZVA 3ZDBA 2BEVA 3JQAD 4OHYA 3JQ7B 2IU0A 2YRWA 4ER7A 1ITZA 2J7PA 2BI4A 3ZK7A 1JWBB 1H65A 1NDUA 3DLIA 5T64A 3DP7A 1L7PA 3VR3D 4X0EA 4YMSA 2O2GA 1VQ1A 3NV9A 1KVRA 1H85A 4YRFA 3LP5A 2VWPA 1K7XB 1SOMA 2ZR7A 3A6LA 3C3JA 4FWIB 4LS3A 4XGKA 4DEXA 3PBKA 4FMBB 3LY9A 1T1EA 4N03A 2G6TA 4QDXA 1EXMA 1FLDA 4BJ1A 2LTAA 5BV1A 4BNLA 4LDRA 1KI2A 4AN4A 5H68A 4BWFB 2H31A 4E13A 1FNNA 2OGUA 4B46A 2WJ6A 3GJ0A 2BF4A 2LCFA 4ML3A 1JS1X 3DVLA 4A2CA 2DCUA 2QZ4A 4D80A 4PRLA 3ROZA 1V16A 2JJYA 4KX3A 4Y9RA 1W36C 4M7WA 2C1ZA 1RBQA 2IPXA 5EFOA 3GN2A 3ECAA 2CLEB 1KY2A 3H9EO 3SS9X 4GIBA 1RR6A 2ZRBA 4R41A 2XBUA 3M6UA 2YQ5A 3NIGB 1WRBA 3I0NA 2WJJA 4I3FA 2V59A 1KDPA 4ADSG 1U7TA 3WB0A 5JSQA 5L7YA 5D2CA 1G291 1XKTA 2WPDA 3VPGA 4D9KA 1IXKA 4MGIR 4M0MA 4PYRA 5I7AA 3P2YA 2G6BA 5E6SB 4JC8A 2IIPA 5TPZA 4DB4A 2X5XA 4UUPA 5HIJA 2WWTA 1CRPA 1LPMA 5E9QA 3UVEA 3I2FA 4DSZA 1AS0A 4M7RA 3GG2A 3UXHA 2DBZA 3K4QA 1A7KA 1RYMA 1C4OA 3I8SA 4BNHA 5AKZA 1YK1A 3ZIDA 3F3SA 4PLZA 1K0UA 5IDQA 4QGFA 1RKVA 4Y2PA 3OMLA 4YAOA 5C8YF 2IODA 2WIJA 3JQQA 4HRVA 1OB5A 4TTRA 2QG6A 3IERA 3ZHZA 3RS9A 5JRZA 5K3FA 1WABA 2QRVA 3IJPA 3SS8A 4ARIA 1J0XO 2WFLB 2ZSDA 3K72B 3OX3A 4X24A 1ZNZA 4NICA 2XWBF 1OAKA 3CIFA 4DVGA 2NYRA 3GDFA 4FFWA 2Q6TA 1YJ5A 4UNRA 1ABBA 1X3SA 3IEKA 2PFKA 1VKOA 4JBGA 4YDSA 5C7LO 3MSXA 5HUQA 1NBMA 3A9TA 2ON6A 3I2JA 3KAJA 3N8NA 1L4FA 4KWTA 3UMBA 3BGIA 1H1LA 3G2MA 1VHJA 2RG7A 2C2OA 3MIZA 3PC7A 2PGAA 4FW9A 3SHQA 4E5UA 4KYTA 4A3SA 3B6KA 4OQZA 4ZVVA 4A6DA 2F90A 1OZGA 2ZT5A 1XNJA 1S4QA 1ZUWA 3PU6A 5FI1B 1JEOA 4ZP1A 5KHAA 3ROTA 1DWQA 3JQBC 2PE5A 2DB3A 2QPTA 1MOZA 2PGXA 4OMUA 2Q2VA 3UHJA 2G9UA 3KL4A 4FJ1A 4OK5A 4F3YA 1HLFA 3A06A 2Z4TA 2FZGA 3LQKA 4L9SA 5C5CA 3HJFA 2IPLA 1NW7A 2HRZA 2G1UA 1CQWA 3GGJA 2B7BA 2NTEA 1KEEA 1EG2A 3UA3A 2ZFUA 4F1JA 4EGSA 3VNVA 2J9XB 5DNUA 3CLVA 1VIVA 2C57A 5L3QB 1DJOA 1GRNA 1VYTA 2QTVB 1SCAA 3UJ3X 3TTVA 3USZA 5JNRA 4QQFA 3C98A 1C7FA 1SB9A 1I7QB 4J4BA 2C0CA 2IQ5A 5F2NA 3N74A 2PKXA 4S35A 1X0XA 3ZZNA 2GEVA 3H16A 1KSGA 1YB5A 3WRXA 3T34A 4F71A 2ZM5A 2HBRA 4PGMA 4C0HA 3AIKA 3D1LA 1VJ1A 5K8UA 2ADMA 5FR1A 1B3RA 1H69A 2YL2A 3MMNA 3GCDA 2I3ZA 1CQJB 1CUSA 2A59A 1D5CA 2CJYA 1JG6A 1EVLA 1E5TA 2VAVA 1R8XA 1AZTA 1J22A 2X5JO 3GF4A 5H70A 3U1VA 3DULA 1Y1QA 5FWYB 4GR9A 5LP6C 4A9AA 4DLZA 2C7OA 2R97A 4RV5A 3S5UA 2D59A 2CFRA 2O2YA 1JLLB 1H4TA 3ZD8A 2F1IA 3MMSA 3W5BA 1JMYA 4F1KA 5JNWA 4O1IA 1T9BA 5G4KA 1L5HA 2QG4A 2ZI4A 4Z99A 5T8KC 4EKGA 1AO0A 4GRDA 4GQAA 2ATIA 2JK1A 1D1QA 3NMUF 2AA3A 1TECE 2R6R1 3ZIAD 5C32A 2G06A 2JHGA 1IHPA 3PV0A 4BV9A 2FN9A 2ZVQX 3PNLA 4UAJA 3UWPA 1WMSA 3AHJA 4PPGA 1JDSA 3LQFA 4IQFA 2GN2A 4PZDA 1C7ZA 3PKZA 1U0RA 4HQOA 1UJ4A 1Q57A 2BYTA 2BMJA 4L0CA 2K5UA 3JYPA 3IDAA 4OU5A 5ERYA 1FS6A 4O2AF 4Q1AA 2NADA 2H1RA 4I55B 3B2QA 1DARA 2QYHA 3EVDA 1S2NA 4ZVUA 4Y0NA 4GI1A 4RIEA 3FLEA 4MR7B 1YOBA 3IEIA 2HL6A 3N6RA 3LOQA 1W5EA 4M0DA 4PZEA 4Q19A 2JAPA 4DADA 4NV1A 4OAQA 4GI5A 4FP9A 5AOCA 5ECDA 2PX4A 4GPZA 3VBCA 1P5RA 1SXGA 3QKRB 1U9JA 4OB7A 4OFZA 5I8ZA 4A8JC 4B81A 4BMVA 2C00A 3T4UA 3AKEA 1UCFA 4FOLA 2F67A 4Y9DA 5AESA 5DM70 3EUWA 4R4JA 2GM4A 2OOKA 2AI2A 1W5TA 4IKPA 3QVGB 4OGLA 1RRGA 5L4LA 4R1UA 4GWLA 5G3YA 5IVDA 2QD4A 1G5QA 3OM8A 4HB4A 1HETA 4QOSA 4D3SA 2VCEA 2ECKA 3IV6A 3WK5A 1Q2XA 1FDSA 1H6DA 3H5LA 5K2MA 4OLJA 2ORWA 2J9YB 1NHWA 1H5NA 1IUPA 3O73A 4GZ6A 3FNEA 3IVXA 1FVOA 2DWOA 1DJMA 5EJ9A 3G0GA 2GUGA 4FFPA 4TUYA 2H51A 8ADHA 6PFKA 4RHCA 5TF0A 2ZBUA 1FFSA 2GAOA 3CNLA 3DPIA 2HT6A 3FKJA 1M1ZA 4K1XA 2MINB 5I3ZA 5KWEA 3G79A 3HGMA 1UJMA 1E79A 3LQ2A 1XEWY 2DSNA 4TLDA 3S55A 3QQPA 2Q3HA 3WA6A 1JBKA 1EB8A 2O2DA 2X6QA 3R7AA 4WACA 4C7JA 3HCWA 3OF3A 4B74A 4BC0A 1ZVVA 1P3Y1 2YIVX 4DRZA 3IAFA 1XZKA 3TLGB 3BJRA 1KZ1A 1ZGHA 2CL7X 2PYIA 1C0EA 4G4JA 1BXKA 1OI4A 3OQ6A 4ND6A 4BBZA 2B34A 4M3NA 4EELA 1GNSA 4FLFA 1VL0A 3L49A 4ZYUA 3PFGA 4E0BA 4CT4B 3EIQA 1KYWA 1J8FA 2GKOA 4PYQA 2NUTA 3VJMA 3D2CA 5LSAA 3ILXA 2B20A 3PENA 4D7AA 1OC4A 1W59A 3T41A 3HCOA 4KP7A 4DR4B 1E0JA 3I9V6 4EJ2A 2FSVA 3KQSA 2HI0A 2X7XA 4KH1A 2MR5A 1T0BA 1CR1A 1RM4A 4F4DA 5K01A 2Z8YM 3KS9A 3OG9A 4G07A 4D0SA 1RLTA 1Q22A 3LUCA 4OAPA 3SFTA 1YKFA 4JCOA 2ODQA 1M2OB 3PQEA 3NI2A 1G1AA 1FDIA 2FW8A 4FYVA 3F0TA 5KNCA 1KK3A 3VO2A 2ZPTX 4URFA 4E15A 3AKDA 5ALKA 3KJZA 2EX4A 5DYNA 5LZ7A 1U1FA 5P8WA 4BGEA 3DBVO 3AY7A 2XMQA 1ZM7A 2ANBA 3SJBA 4GXTA 3OT4A 5BXQC 1NFQA 3T0IA 1NR5A 2B5WA 4A0FA 3FN4A 3MQ4A 2WP0A 1GKKA 1LEHA 1UBEA 4W9RA 2ZYAA 3WX0A 3KVVA 2OYSA 4P82A 4KWHA 3R44A 3VNRA 4WUTA 3KZ1E 3QUAA 3WLHA 5F3RA 5B1DA 1QOQB 2MU1A 1BWSA 1KZ7B 2AFIB 3S70A 1Q7TA 1IG0A 3H1BA 3U49A 3UMSA 4CKYA 1LNQA 2F1RA 3PT9A 1LSOA 3I01A 4RSGA 4B3CA 1WCYA 4CV1A 3VNUA 1O08A 5I7VA 2GSWA 1BE1A 3K0SA 1EGQA 4WECA 1NF2A 3EG5A 4MWSA 1T0UA 2VJBA 3FZNA 5IYZB 3ETDA 5K0ZA 1FU4A 1M6HA 4EFNA 4EPWA 4JQZA 1T8YA 3MAAC 5JJLA 1FQKA 1F2TB 2JIRA 4MI9A 5BSHA 3ELWA 4L2IA 4Z7JA 4YPOA 5L95A 4DCNA 5JS2A 4GKKB 2BKLA 4BVBA 3PNBA 3R5KA 4BN4A 3R09A 1V2HE 2P6OA 4PFKA 3IR6A 3HP7A 4FS3A 2CJXA 1YNOA 3EGXA 1CUCA 2NU7B 3OECA 4TVBA 5REQA 4WI1A 2VFAA 2EZTA 4FKMA 1G8GA 3UNXA 4B6PA 2NUBA 2O2EA 4H17A 4X41A 5MN5A 4IY1A 4NENA 1VDZA 1YQEA 5TQ0A 1BJRE 3LRXA 2ZE8A 2QR3A 2CXPA 1BVHA 3OHMA 2PX5A 5CX4A 1WV1A 2B4RO 5C5EA 3AY6A 4LW8A 1PJZA 2A4KA 4NDZA 2DRIA 2XDAA 1OIVA 1ZKMA 1RP1A 4BX9A 1DHTA 3MWDA 4GZ3A 4I4TF 3S68A 2AFHE 3CLTC 5BUQA 3Q2IA 5JE8A 1TZKA 1GD1O 1FP6A 1LPAB 1NP6A 4RZIA 1E3QA 2DM6A 4DUPA 1DLIA 3X44A 4DR3B 3VR5H 3NQ41 1T24A 4XSVA 5BSKA 3QFFA 3FPKA 4GAEA 4XGRA 2IA5A 3G6WA 1KQGA 1ETHA 1E7SA 3V2GA 1GVHA 3VISA 3PDHA 3Q9LA 1YVRA 3ENQA 2OZKA 1I3LA 1VZ2A 3AVUA 3AFNA 3IAXA 4GX2A 1WCXA 2GJKA 5BWOA 3A31A 3YASA 1HOTA 3W5UA 1J8DA 1Q7CA 2I6TA 2GYUA 2E89A 4ZRMA 1X42A 3TSWA 2IH5A 4A82A 4MUHA 4EH1A 4IGAA 3ROKA 4DQDA 4CFYA 3ICCA 5I9SA 2RI0A 1ULSA 3KQQA 1U0HC 1W5SA 4MRMA 3SIXA 1YAHA 3ADOA 4QEZA 4RZ3A 3QNMA 1DX9A 1Z6QA 4UUBA 4OXKA 3TIFA 4OMFG 3FFBA 1N9ZA 4OQEA 4AB1A 3EXEB 5LB4A 4ARBA 1VJGA 3T3EA 1JXQA 3N8DA 4YRLA 5CX1A 1YS1X 3UUWA 3BJIC 5DLPA 4CKCA 3Q8LA 4MHTA 1W0JD 1NQVA 1Q3HA 3D1JA 3BA1A 4AZ3B 1UC5B 3CZQA 4FNOA 1N6KA 5CIWA 4OVKA 1UJNA 5IDWA 4JLDA 2UYQA 2FH5B 2JLQA 2W6PA 1SY7A 4XARA 7GPBA 3EX7C 2ZXUA 1OAOC 3HACA 4U2DA 4V0SA 5J47A 4BP9A 3CPEA 1UFKA 1TYBE 1OFHA 3CWZA 3RR2A 4IJ5A 4DMRA 3R4VA 5C81A 2F43B 1E9DA 1T8SA 2YWBA 2O6HA 1T29A 1KMQA 1U0NA 1JAZA 2Z2XA 1CJTC 3V8PA 3AINA 1L7RA 2ZQZA 1LQUA 3CWCA 4R16A 2W58A 1P33A 1YQQA 2Z8YA 3FYUB 2BEVB 1V6SA 4R2XA 4L4SA 3DE0X 4FJ2A 4GBJA 2C2YA 4LGMA 1L5FA 5JDIA 4I6GA 4HVLA 3IKTA 4FZRA 1BIFA 1M2VB 1UPCA 2A5GA 4HL6A 5J58A 1J7KA 2GD6A 2GRAA 2OWDA 3LUKA 4HNGA 1BXZA 1Q50A 3K31A 4NU6A 3VUEA 4DMGA 4WJLA 3MTQA 1HOXA 2YVLA 3LO5A 3NKLA 4B7CA 3HN2A 2FE4A 2XNDD 3M6LA 5AW9A 5KC9A 2A3NA 5KTRA 1Q7GA 3V2UA 3QVOA 4J0DA 3VNQA 2VHQA 3OTHA 4EUEA 1Q1EA 1RPNA 2O3TA 2BH9A 2BMFA 4J03A 3GGSA 3EGCA 2XBLA 5JYEA 2XIQA 4Y7DA 3HZZA 4CUKA 2IS1A 5DZSA 2GYYA 1OV6A 4BAUA 1SXJD 5BSGA 4R7ZA 1WPRA 3VR2A 1G60A 3K6SB 3FI0A 4IINA 1FFXB 3ZD7A 2W70A 4MLDA 2Z04A 4R69A 2X7HA 1FNSA 1X0VA 4TL8A 1JQKA 3MTGA 1OIWA 4OSPA 2EBHX 3NIDB 4P34A 1LRJA 2EJWA 1H9AA 2VTKA 2BIFA 3Q40A 5BW4A 1IVNA 1TJPB 1SUCA 2C84A 3PXBA 4CQMD 3KR1A 2JD2A 1H2BA 4GX5A 5HGJA 4D98A 2QTTA 1W75A 1RVV1 2V6IA 1JZTA 4YFVA 4EA6A 1DJLA 1C8KA 1EDDA 1OHHA 1UWKA 3E2MA 3EQ7A 1RAIA 3DLAA 3IV7A 4KDFA 4UVEA 2PCLA 4WEQA 4XCXA 5FPSA 3RSCA 4C2AA 5J2TB 1QPZA 4MUGA 5DGXA 3NORA 4ENRA 4MPTA 2ZQ5A 3BD6A 4O5AA 3NALA 3GCGA 5FHQA 3RK1A 3Q1LA 3L18A 2C61A 4JX9A 1O9HA 1ZJ5A 1NVDA 3WR5A 3PC2A 4BXOB 4QOJA 5HFNA 1SIUA 3B6IA 2IBMA 1CXZA 4YUXA 1G6Q1 1GN8A 2JFQA 3WNZA 3TUJC 4DZZA 3FF1A 4U6SA 1O95C 1YCDA 4CI9A 1QR2A 1YDWA 1ZRHA 3N07A 3BXFA 3DO8A 3EH1A 4M9RA 1UXHA 3A2LA 1CY1A 1AVTA 1R0BA 1R6XA 2J0UA 2O2JA 3C6ZA 3N2LA 5KWSA 1PS0A 2A94A 4HAOA 3SD7A 3CURA 1I2BA 1W0CA 5FBLB 5FTJA 1YIDA 4UPDA 3KHTA 5AKYA 4QBTA 4U2KA 4S1OA 1A72A 1ZD3A 1S7CA 2DLNA 3HEAA 3X1YA 1E77A 1ML4A 5IKPA 3FNFA 4ID9A 4N7JA 4OYRA 1DJQA 2I1VB 4KJZA 1SHJA 3FDZA 4RY2A 1BGXT 1PW5A 1DAIA 1XNHA 2DQKA 2NZJA 3COJA 1CUEA 3C1AA 4CR8A 2V3CC 1PL8A 1QG4A 2A1TS 5FPKA 1XDDA 3MPOA 2G36A 1SVIA 2QGZA 4CG3A 4YALA 1FNBA 1OXVA 5DX8A 5ECYA 2JCBA 1HRDA 4MW5A 4C89A 2DULA 2OHJA 4GSLA 3SCZA 1XN4A 3AFOA 3DFKA 4Q15A 5BNZA 1NHGA 3UMMA 3G7UA 1BCSB 1EK0A 4WLNA 2X86A 5AVJA 1H2HA 5E8RA 3U3XA 2ZWOA 4Q5IA 3P0FA 3IPLA 2WJ4A 2B2NA 5EIEA 1UBFA 2CYCA 3TIGA 3OQJA 3WGIA 3MJEA 4MYCA 3R74A 1VFPA 2QLTA 3TGWA 4FM9A 2NU7A 3B8HA 3GLKA 1MQAA 4OQQA 1I3CA 4F6RA 2RGRA 1JA9A 3Q3EA 4OHFA 4BB6A 3ZY4A 1LH0A 1MH9A 2HK9A 2V7TA 4XCQA 2WKSA 4UBOA 1AURA 3CUEF 4RD4A 4ZHQA 1D2AA 2VH5R 2VVTA 2EFYA 2WE7A 2DHQA 1CQJA 4WW0A 3UK7A 4WBNF 1JIVA 3HMKA 2IWRA 1L1EA 4HK4A 5TVGA 2IHBA 1C9YA 3IQDB 3FUCA 2PZEA 3LC1O 4TTJA 1T1IA 2L69A 3QMVA 3S1SA 2B7CA 5EFZA 3MF4A 4U9IS 4CIYA 4PC1A 3PR2B 3D7LA 3U39A 1U1DA 5ILOA 3ZZUA 4JYCA 2CVQA 3AFMA 3T1HB 4ZOBA 3ZOZA 1F7UA 2AHOA 3C14C 4WIAA 3MSCA 5KQGA 3TTTA 1QVVA 3EIXA 3HL0A 4LY9A 4NYIR 3GBVA 2JD1A 4P7JA 2C94A 2F9FA 1W1IA 5KO2A 2C4MA 3C0KA 3CX4A 2PAAA 3L4EA 4OO3A 2PMBA 1GO2A 3TKLA 2JVIA 1QDEA 1V3UA 4C4ZA 4F4HA 4BE4A 1XZNA 3KB8A 4LY3A 4BDSA 2JA1A 2E5WA 4Q1BA 4EY7A 3OY2A 1ZJ4A 1DFHA 1FF9A 2H4HA 3GI1A 1G3RA 3D8NA 3WLLA 4C14A 1PK7A 4XFJA 3R3VA 1R9GA 1N1EA 1TA9A 3MOGA 3FRHA 4X1KB 3BGVA 4XDZA 4IGKA 4EFKA 3PQ6A 1GCAA 3VJLA 4ALKA 2BM8A 3ABIA 4PRZA 3DC7A 5A4KA 1OF1A 1AZSC 1DIBA 4KXXA 4PHGA 1IE3A 3T0GA 3WZMA 3ZZ0A 5HXAA 3A3OA 3DL7A 1Y7LA 1RFLA 2FB9A 4BLVA 1M1YE 2NQTA 3HCNA 3R5XA 3WKCA 1V8PA 1YVUA 4ID3A 3ETEA 3TAXA 1QRRA 2DQYA 3E1SA 4CL8A 5JCZA 4FKBA 2JCYA 5ICGA 3CLKA 5K4GA 2DUWA 1MJNA 1CY7A 1Z12A 2O2CA 3CE6A 1VLQA 3H9GA 2O0MA 4GOXA 4RIFA 1ZVMA 3EXAA 3GIDA 4UM7A 2IE8A 2WIBA 2WWRA 5BT8A 3DHVA 3U37A 4BTLA 1KAMA 2QY9A 3FYDA 2V6JA 2FP4B 1M2WA 2EX0A 2IHKA 2OVBA 2R4TA 3IAM6 3QJ5A 4HOYA 1K4KA 4OK3A 5H5JA 1Y5RA 3GLHA 5J4YA 5EIWA 2HXSA 1M0EA 3NEYA 3HB9A 5L6MB 4CI0B 4YA6A 1XCBA 3I9LA 2G4CA 3RIEA 3VDQA 2O8BA 1P31A 2FEXA 2VAWA 4G6ZA 2FDCA 3P32A 3HHPA 2PLWA 1KEVA 3KOZA 4RX1A 3VNAA 4O25A 4G5XA 3DYIA 4WT7A 1XXLA 1ZJJA 2VJMA 3KVYA 2YXEA 4U5QA 5GTDA 1PUIA 1Z0DA 2RHOA 4AURA 5A3QA 4O2BF 5JVDB 3BQ9A 3E35A 5B1HA 4HLUC 3QFSA 2ETVA 5CFLA 1CG6A 1NSYA 2WK1A 2QXUA 3ITKA 4XASA 3AKZA 1PT8A 4L8WB 1NULA 3HCAA 4QVGA 1KVSA 1OAAA 3AEKB 4RF3A 4CV2A 2OC4A 2BFEA 2HA4A 1HDEA 4XM2A 3AR4A 3FFWA 3LV8A 4H0CA 4O59O 3CXRA 5EAIA 1CVRA 2Z0MA 3AX6A 4DILA 5JXWA 4HFMA 1PBTA 1U7PA 2IYAA 2O8FA 3WWYA 1C8LA 4AJJA 4P5PA 4ZVSA 4YAUA 1P6QA 1VL2A 1TZMA 3SMVA 4RPIA 2JFVA 4BNGA 4EIWA 1Z2NX 4R6XA 2PH3A 2G09A 1PL6A 1TM7E 3ZI0A 4D4GA 4S1PA 5COQA 1WOYA 2FRDC 3RU7A 4EI7A 5DV9A 2ZGVA 2W5UA 3SHTA 1UXJA 4Q1EA 1WW2A 2GPNA 1L7QA 3D4NA 1E4EB 4AK9A 3L2OB 4NF2A 4YAIA 1A4IA 1WEKA 4DMMA 3NTUA 2E5FA 2ECQA 5EGNA 3FBTA 2K2QB 5H8WA 5H4GA 3NVKI 1PU2A 1MNAA 3Q4GA 4UHFA 5H81A 2ZI7A 5CYOA 4E6PA 4J2OA 4FXOA 3M49A 5CT6A 1MKYA 2RARA 2W2QA 2AQ8A 1XMXA 2CF6A 3UW3A 3M2PA 1E6CA 3ED1A 5KKAA 3L1UA 1NFRA 2ZB2A 1E2HA 4B17A 3U44A 1U63A 5MN6A 5FFNA 3AV0B 3E1GA 4Q6WA 4YO8A 5BYKA 3TVTA 1MORA 3RSGA 1FBTA 3TYXA 3KYDB 1HQKA 1PP4A 4DC0A 4Z9XA 2G72A 4X1IA 4BQNA 1DZ3A 4KV9A 4XM0A 2MYNA 2RB4A 1DAKA 2W6ID 1R37A 4H6XA 4PNHA 3KLOA 1XSEA 3SZOA 5C8XA 5JROA 1NQWA 3HO1A 2BGNA 3NHSA 2OZLA 3WLQA 4HY3A 2IYWA 3BB1A 1K5DA 3C3XA 2G8NA 2CHQA 3L41A 5FT9A 4CMJA 1JB9A 3KWFA 3QBTA 1DQNA 2AFIA 1JG4A 1Y5MA 2C59A 3UW1A 5GONA 4ZZIA 3W4JA 3PQ7A 1M75A 1AXRA 3ELYA 4BQRA 3T06B 5A5DA 5DGCA 4H4DA 4C4OA 1ORTA 2CHVA 2LRHA 2QROA 3VAYA 2QJTA 4F97A 4WKOA 5BSEA 2F7SA 3DCIA 3KP1A 4CIDA 3MGGA 3LZCA 3VVBA 3UO8B 4DRYA 5SV2A 1RABA 1U80A 4XQ9A 1J2UA 4Z9YA 3UCFA 2VQFB 1C2YA 4G4SP 3K30A 4RQAA 3FDZB 1PJLA 2AKYA 1PVDA 2CNWA 4QREA 2FZLA 5IWCA 1BQEA 4BZPA 3RAGA 3WBJA 1K6EA 4EITA 1TPYA 1WXDA 5EWJA 2EQAA 2BUBA 3QUSA 1VPWA 5ED0A 1NJ1A 2ISCA 1ISPA 1DEKA 1U3FA 3RYTC 2JJ8A 1I8TA 2KSQA 2NWQA 1C0IA 1OLOA 1C3OB 3P4UA 3VQTA 5ES4B 5AVKA 1Y4UA 4FZVA 1MLDA 3W8FA 3LRTA 1EXVA 1FFWA 5EHNA 3BIFA 3LXMA 3PUZA 1XAIA 2EYQA 1R8SA 3IGFA 1J2TA 2V5VA 2A0XA 1U6JA 2FPOA 5BN1A 5IWAB 2JAUA 3KJNA 3RUEA 2C8LA 4Q66C 4EGJA 4PE5B 2Q5QA 1CLEA 4IF4A 5F12A 3X1ZA 1EXWA 2A86A 1F14A 2OYCA 4AO8A 1G9TA 4PO3X 3QG5A 1XPUA 5YASA 1DL5A 2GBLC 2NO4A 1CTQA 1QZUA 1UQTA 3SEFA 4B45A 7REQA 3TR0A 1U0GA 4QAQA 1J8MF 3D3NA 4ETNA 5I9NA 2WKQA 3C70A 3W9BA 2H92A 2WF6A 4F5EA 5A5VA 1MAHA 1SA0B 4DLTA 4TKVA 3F8SA 5K20A 1J2JA 2H08A 1O0CA 4MDYA 3S81A 2PO7A 5IU6A 4FYMA 4JENA 2B7LA 1KI3A 5L51A 5FEMA 1ZOOA 4DJJA 2HQ1A 3A1WA 1JDTA 3FETA 4NZYA 4Y6PA 1AXGA 1D7AA 2V55B 2IOFK 1DE0A 3FB1A 3KRTA 3LVBA 5CBPA 5IFKA 3B70A 2H06A 2EF0A 1JHAA 2VT2A 5LBIA 4KXWA 1UBOS 2VSNA 4RMNA 3IP6A 1HG0A 1OHHD 1QK5A 4Y6GB 1Z22A 5JXHA 2CFTA 4POAA 1VHWA 2P6UA 2QQ0A 4FHDA 4BN0A 4BUJA 3I61A 3Q7RA 1WXXA 3BMOA 4ARUA 1JQDA 4PAOA 1Q0LA 2D8MA 3HKBA 1RLIA 1P75A 3NWPA 5AH0A 4Z3OA 4KR7A 3I0MA 1PZEA 1FFCA 1RWNA 4XTRA 1NN1A 4K9LA 3V5NA 3LCVB 3TCKA 4DIEA 3I01M 2CKDA 1HQCA 1Q0UA 5JD5A 2HU5A 3P45A 2GVDC 5FF9A 1U2GC 3ON5A 1EHCA 3DE1X 3NLLA 1FDUA 4RKRA 3VR4D 5IJ9A 2J3EA 4B44A 4H7KA 4MV5A 1XTTA 5K1ZA 3WWCA 3BA6A 1Y6ZA 2OGSA 4OP2A 4INAA 3V4FA 1KYXA 4HTAA 2GI4A 3K9LA 3LK7A 3EMKA 3MWEB 5IKEA 5LQUA 3OKAA 1N36B 1L4YA 2ACVA 3H3XA 3HJAA 1B8UA 4AYTA 4A8PA 4RS4A 1V71A 4MV9A 2R1ZA 2AOUB 4HWSA 5EQTA 4J6FA 3WGMA 2XTJA 1BCSA 4NJEB 1BN7A 1V96A 2P5YA 5DHFA 3VZDA 2DPGA 5EQJB 4K0KB 1D0VA 4TV9F 5DASA 2X8AA 5DT2A 1KR5A 3A9WA 1YDGA 1U7OA 1ZVJA 3VX4A 1Q44A 3JXEA 3CEMA 3U16A 4DAEA 4G0WA 3LI2A 1EFAA 1JSCA 2JBHA 3HGTA 4K9RA 3IUNA 3KO8A 4R40A 2NU9B 3S99A 1Y8QA 4DM4A 1QTQA 2PIDA 3R3HA 1RPZA 4J0QA 3IBYA 1PT5A 4EVQA 1OA1A 3ZHXA 5T57A 4YJFB 5LXTF 5FPPA 4AULA 1JDBC 2QMZA 3H2KA 3HBMA 4MB2A 4OQFA 3TRKA 3ISJA 1B4DA 1MB0A 1D7OA 3SNHA 4FFRA 2W6QA 3PWKA 3OIFA 5FX2A 2AVDA 5KNBD 1FFXA 3EBLA 3QI2A 5KINB 4YY3B 2BR3A 3SQLA 3ADPA 2BFMA 2Y1DA 1DX6A 4O1HA 4M9XA 1OXBB 3UFBA 1JYSA 3ET5A 4UEQA 1ONOA 1K8RA 4NOKA 2QRQA 3A04A 3KBOA 4F4JA 1N75A 4RACA 1KAQA 4OJYA 1E59A 4OHMA 3GRUA 5BRNA 2UU9B 2PUEA 4LECA 4ZYZA 4MYRA 1NU8A 1VYUA 2GZ2A 4PPYA 2Z83A 1G9XA 1QBGA 4XJSA 2CK3A 4L3VA 1R0SA 3FHOA 3L84A 4J1SA 4JKIA 4LIPD 5ALFA 2R4UA 1G5FA 3E3MA 3LCJA 5TQVA 1A2QA 1G8FA 2A9KA 5DFAA 5J43A 4D26A 3WKDA 4S0XA 3WSTA 5I3CA 1KNQA 2G0TA 2K2WA 3DDZX 3MB8A 4OBBA 4ZO8A 1KZHA 5TT0A 2BH2A 3PFCA 1ZX1A 3ELBA 1KXJA 1QRDA 1EX6A 2I2CA 3ACDA 3AI1A 1WP4A 3G0OA 1Z82A 4DPLA 3WISA 3MLAA 3NM6B 3M70A 4IVRA 1LK7A 2YH2A 3Q87B 3SQWA 4D9BA 2Z6UA 2J6IA 3HU1A 1ISJA 4RXTA 4YAWA 1QB7A 3WNQA 1QU3A 3R0XA 4R0NA 2HA2A 2QZZA 1QMPA 5TSDA 4MYUA 1QIHA 2L82A 4M9UA 5HQTA 2PUVA 2NG1A 1RIIA 1HYEA 3OCVA 1VIMA 2AVNA 1ECBA 4OKIA 5KTKA 1Z88A 3RYHB 2OD9A 4GYJA 1N3YA 2HJRA 3DDHA 4XEUA 1ML3A 3PGVA 3NHZA 4XX0A 2MSDB 3K9WA 5IYZF 1YB6A 1M54A 2FY8A 1XTQA 1CVLA 1E6UA 1X1TA 2HD4A 2JKVA 1TMGE 2WWXA 4I1IA 4BFWA 5A4JA 3DSRA 5CRIA 1SQ0A 4HDSA 3E9RA 3MT9A 1PJTA 4JXKA 4DG9A 4B09A 1BOOA 3QLTA 1G66A 1PL0A 1NVFA 2QUIA 2WSIA 1P9OA 1XLWA 5FNVA 1MHTA 1GDTA 2J8ZA 3FCOA 1FIUA 3G85A 1XU9A 2BN4A 4FGSA 1I6LA 2GPTA 3L7DA 3W06A 5I9IA 4DREA 4DN6A 2GCPA 1KJJA 2RD2A 5CM8B 4K3UA 3RIGA 3U7JA 4NU0A 5K0BA 1CY6A 4WINA 2ODAA 3G0IA 1M8KA 4NXMB 4GMHA 2J48A 5IHXA 4PONA 3L7NA 4YRRA 2CV1A 2VUIB 4RPJA 1QF6A 4R1OA 1AD2A 1R6AA 5ENVA 1X70A 1NXQA 1US8B 2FWMX 1WG8A 2XMRA 1GSHA 1P4RA 4MJ3A 4NYJQ 4RO0A 4H7EA 2BBOA 2DE0X 1Z0UA 3B13B 4HEA6 1XCGB 1ZOIA 1FVHA 5CB0A 4G5OA 4D02A 5FTLA 2J4FA 4CM1A 5GOTA 3IPAA 1D6JA 3WHPA 2EERA 2O3RA 4QGBA 2Z3VA 1MTZA 5KVQA 5JQGB 3R76A 2C7PA 1EMDA 1PHRA 2D1QA 4P7GA 1TQHA 5KYYB 4EPTA 2WTMA 2B1GA 3RWBA 5F64A 4MO9A 1MF7A 1U2ZA 3E3NA 3EC1A 4N3GA 4BGDA 3BK7A 1T36A 4XOIA 1FFGA 1PZGA 2YWCA 3VR5D 3E5MA 5AYVA 3HZOA 4IXWA 2O3UA 1ENPA 4B32A 1P4GA 4BVGA 1SC3A 1LGYA 1XHEA 4I55A 1VRCA 1SUSA 4BYMA 4S1NA 1UJBA 1M76A 4DW8A 3PEWA 2GK4A 1SCQA 1NLFA 4CE6A 1JH8A 1KZ4A 3JQ6A 4OHKA 2D7DA 2ZANA 3GEHA 3URKA 3GG9A 5ALMA 2B3TA 2VWQA 3F7TA 4U0KA 2B21A 5E3IA 3SM3A 3T1OA 4X5OA 3HYLA 3TSZA 2YVQA 4ZYYA 3NDJA 4MRRA 3GFPA 4J29A 1D07A 1FSZA 2CB0A 2GK7A 1Q1GA 2R60A 3ESXA 4H0NA 4R9SA 4U2FA 5K3SA 2OFPA 4WK4B 4EGAA 4TYPA 5AO9A 1K63A 4TRNA 4X1KA 5KTSA 4D8WA 1OYWA 2HIHA 1IXYA 3OZ7A 3IQXA 5G2OA 2NM0A 4J3NA 5L9AA 3NUZA 1TGVA 3PXXA 1JMKC 1WXIA 4BV2A 1X9IA 4TKMA 2HV8A 1UOPA 2C4TA 3A1TA 4WNAB 5EJMA 4II7A 3UT0A 1NVAA 3KOMA 2ZUSA 2JFBA 3VOTA 1NOIA 3BQNB 3E18A 3FDXA 4NQZA 4PR0A 5FOUA 1B6SA 5FAKA 1W88A 2YN4A 4YJ2A 1GTRA 1MC5A 4QOEA 3FMGA 5GP1A 1U2TA 5IZCA 1YJQA 5IEJA 1I30A 2HRCA 3TMYA 3VC2A 1BGWA 3ZV5A 3REFA 1OV4A 2DWUA 2VNIA 1S9DA 1I3KA 1Z25A 1I1OA 2FN7A 2JZOA 2XAAA 3DDCA 3DFUA 3B5JA 3FCUB 4W8GA 4BRZA 5JS6A 3VVLA 5KNCH 5J4KA 3H11A 3LHFA 3TS1A 3RTGA 1OGIA 1VMIA 4DBLC 2DGDA 4I08A 5C3UA 2RB5A 4ZTBA 2O2IA 1XQ1A 2LDBA 1MIOB 4BVJA 2FXIA 3L5KA 1SC6A 2G80A 1NQXA 4J7UA 5DEIA 1LW7A 2EKDA 1O97C 3NNNA 1HDIA 4HDAA 4MAMA 3AUYA 5EWJB 3A4TA 2G08A 3CKLA 4P83A 3NATA 4LWOA 4B80A 4QD3A 1J5XA 4DA8A 1XWFA 5BORA 2PUGA 1WXHA 1XWIA 3ORQA 5JDCA 4WXPA 3TPCA 1PUXA 1CJKC 4UU0A 3GZNB 5IRCD 2FQ1A 4C78A 3L6CA 2PH7A 4ZD6A 4NG4A 3OJLA 1J0AA 4MHSA 2G9VA 1QX3A 1OXTA 2OFWA 3COWA 4RKEA 4HXFB 4QOGA 1EUQA 2XQFA 1QF7A 2IHTA 3JD0A 3EAFA 3FKQA 2OK7A 4XPIA 3WRWA 4D9EA 3G82C 4Q9KA 4TTAA 4ZTZB 1Z28A 2NU9A 4I4IA 4MXDA 1Z5NA 3G0BA 4HGRA 3OI7A 3IODA 1ZN9A 2XIJA 4ABTA 4MDEA 2UUPA 1YB4A 1REQB 3RUHA 1FYDA 3DE2X 1W4BA 1XFDA 1G98A 1VJ0A 3KLMX 1CRQA 3STUA 4D0RA 1WPGA 3EWAA 3KOWA 3UAGA 4X8LA 2J59A 3EA4A 1U31A 3ENKA 1FYFA 1ECGA 4Q4AA 5J2UB 4BLSA 5CB4A 1HK7A 2AUTA 2GPWA 1MOPA 1YOVA 1N0VC 4B6SA 1G8KA 3QVWA 1T91A 1QKKA 4GLLA 4RTOA 1FCJA 4JP2A 1G55A 3FCEA 2WF9A 1AQIA 4DUZB 1VZ3A 2F3QA 3W79A 1D6SA 2MSCB 3VYWA 3RV3A 2IY8A 3BFJA 2XRFA 5BR8B 2I62A 2JHFA 3P0HA 1Z6XA 3O74A 4NCJA 4JT4A 2P6MA 1Z4MA 3M9LA 3C3PA 1KQNA 3V34A 2H4XA 1Q6YA 3PUVA 5AKEA 4ZCPA 5TQ2B 3QXSA 3U44B 1JR4A 2HJHA 3O3NB 4PLYA 3T3GA 5AJVB 2NSDA 3EODA 4TKUB 1ZGAA 2NZYA 5DCYA 4TYNA 3WV4A 2AFVA 1OH8A 1LK5A 3UAZA 2WYVA 1DRUA 1FLAA 4QFBA 5JXIA 4W5OA 4DLWA 3D3WB 2J31A 4L4ZA 1ODTC 4BO8A 2EBFX 1UFRA 4PBRA 4QOIA 3UATA 3NHWA 1ODJA 1Z5WA 2XNKA 1O97D 1J70A 5EJ2A 4AP5A 1J07A 3IDOA 5F7XA 4L6IA 4M46A 4XAQA 2GVNA 2PKEA 3RC9A 5HQ3B 2Z30A 3ZYCA 5DBFA 2G5CA 3V46A 4HBGA 1O4VA 2MSLA 1V6CA 2EHDA 3KZMA 3TAUA 1Q19A 2AKEA 3K20A 4BCBA 1SBZA 2GBIA 5IN5A 3A9CA 3ZKAA 4CMHA 4JK3A 2ANCA 1KK0A 3SJAA 4MS4B 4F5YA 2IYEA 3M6IA 3U7QB 5HBGA 1ZRNA 1SVNA 5JNSA 4EKYA 1RRKA 1JXMA 2VTEA 4A8JB 3ROXA 4F85A 3I62A 3A0UA 1IJEA 1OX4A 3EYWA 1AUPA 1X92A 2HBQA 3T7RA 4ZJUA 3W34A 1P6XA 1RM5A 4OJKA 5MDHA 5E6RA 4TWJA 4DDMA 1W1UA 3CLUC 4TXLA 4QFCA 3T1YB 3M33A 2GEJA 1F0YA 1E0KA 1Y8QB 3B9BA 5JASA 1G7CA 3E9YA 3PQDA 2ZIGA 3AOGA 3JD1A 4WCFC 3HA2A 4RZSA 2C42A 4QG3A 3IP3A 5AM4A 2H1HA 2BBTA 5AVXA 1TTTA 2O5EA 3I2IA 1JKIA 1ZC4A 1T6NA 5BMVB 4HQ0A 2FKAA 4FMPA 1TMKA 5CNJA 1B0UA 3FH0A 4J0HA 1MJGM 1XAJA 2ECPA 4B8YA 1GKYA 4XWAA 4D9GA 1M7BA 4D0GA 3TQFA 5C4IA 5C18A 1PR9A 3ZHSA 1X14A 2P8SA 1KO5A 4FZJA 1US8A 2JI6A 2ONYA 1HO3A 2PMKA 3MWKA 3IPRA 1E61A 4Q1CA 5EIHA 3TNYA 3GPIA 1H4VB 1SHTX 1K5HA 2HB6A 7REQB 3I52A 3GJZA 1A97A 1JUDA 1XT6A 4QQRA 1IN7A 5LP6B 4DR7B 3W1VA 5G0VA 3M34A 2R62A 3LNCA 4CDMA 4KACA 2Q07A 4HX9A 4R05A 4XYEA 2C95A 1E4OA 1XCOA 3GFRA 1NMYA 1R0ZA 3IBGA 1YU6A 3RCBA 1IHDA 2BKUA 2COKA 2GEFA 1VG0B 2MSEB 3X0DA 2QUKA 3GMSA 1IBRA 4LWPA 1OPRA 6ABPA 2YFKA 5KVVA 1PR5A 2OBXA 3G5UA 4DDVA 1QS0B 3BRCA 2Q6OA 3AJ9A 3NRBA 2YIDA 1M34B 2OENG 5GIPE 4P84A 5K0GA 4HZGA 5I7OA 3W5DA 2ZVPX 1CJSA 3N86A 3TQCA 1RM3A 3LFTA 4XD7A 1U9ZA 1BJTA 1E6MA 2AOTA 3FGPA 5ERGB 3F71A 3U3KA 3T12A 4C3VA 2YIJA 4JJ4A 4DLXA 4DQUA 4DYHA 4WQMA 3SBOA 3ICPA 4N0PA 1ZXXA 3GFBA 2X76A 2P2DA 3KEOA 4DXDA 1M2VA 2TMDA 2A84A 5KHOC 1YF3A 4YUYA 1XNGA 2FMHA 1GU7A 1WCV1 3F74A 2BEKA 1EQAA 2Y77A 1C80A 3P4XA 4BKOA 1S2DA 4HX2A 1QYWA 6REQA 2D1SA 4Z4IA 1Y3IA 1NUPA 2O7SA 1D2EA 2Q5HA 3TW8A 5KZMB 2PD3A 3O9ZA 1Y8AA 3RANA 5GOZA 3CLUD 1DO0A 4BMYA 4G0MA 1QFMA 4M6WA 4OA8A 5KTNA 1E64A 2CWDA 4ZQGA 2QK4A 4Q9LA 3O91A 3C3BA 4ZEVA 1T8WA 3X1KA 4YRSA 5EOVA 3KELA 4IZ6A 1A4UA 3IP1A 3WL5A 1I4DD 2DU8A 1WCIB 1CX9B 3E58A 2P9HA 4JGIA 4MVJM 1TPZA 3TLAA 2JBAA 1LTHR 2GHQA 2VEOA 3PWZA 5A0TA 3SR4A 1A9PA 1TGYA 2CZGA 1MIOA 2WNIA 1RXIA 2PVSA 2QDKA 4XQGA 4H77A 2ATEA 4JLOA 5AK3A 1FYEA 3WXMA 2GT1A 4DRXB 4GVPA 4OLBA 3KWLA 5C8YB 3E0QA 5AXBA 5C9ZA 1XJ5A 3PGLA 5C7IO 2H5IA 2DWCA 2XVZA 3VOSA 3DXYA 1F48A 3OQPA 1XZFA 1Z17A 1Y4ZA 1TUEA 3HJCA 3RRZA 3ZGLA 3EPRA 1FDWA 1RXYA 3UB3A 3JZIA 4DIBA 1MC1A 4BQSA 4F1WA 4NMHA 1WA5A 2BZ0A 3HE3A 3OETA 3OPYA 4WCFA 2CL6X 2HSWA 2P4EA 3KQUA 1X94A 1NYRA 2ZQYA 5IKOA 3MERA 4AMBA 3K4PA 4GUAA 2XCSB 3ONWA 3U7GA 2ATCA 3Q7TA 1MENA 2W6OA 2ZI9A 4GOMD 2ET6A 1PV4A 3PEYA 1J56A 4JLBA 1YRLA 5JY1A 5I47A 4XTCS 1XLVA 1H2WA 4HQLA 5DI9A 5F3WB 1MT3A 4E14A 2H57A 4BMNA 1XOIA 2QRNA 3C3YA 4NJMA 4MRPA 1UL1X 3ZBPA 3LUBA 2EG9A 1EBBA 4YGYA 4YMVA 3WO0A 1R6DA 2FWPA 2JW5A 4XIGS 4AROA 1D1TA 3MW8A 1H6CA 3AEXA 5DHSA 3BORA 2QUHA 1Y6FA 1BZYA 3HR7A 1ISFA 2X23A 1PQUA 3CPHA 2YZMA 3HCEA 4MEAA 4WNYA 5KOYA 4COOA 3CSSA 2JS7A 4ZVKA 5K7SA 4R0MA 1PJQA 1V1RB 3F7NA 2BEUA 4RVFA 3EFBA 3EVFA 3MMZA 3ES9A 3PQFA 4IFIA 4PANA 1Y9EA 1Z6PA 4TLCA 1XZEA 3U4MA 3VFDA 1ZIDA 2ZUWA 1J7JA 2RBGA 2VSFA 1ESZA 2IQIA 3QV1A 4OGKA 4RBNA 4KQCA 1R74A 1QQTA 3FB4A 4G86A 521PA 1HWYA 3SNKA 4LF4B 1Q11A 4UZSA 3V3TA 3L1JA 4FGLA 2N75A 3DOCA 2FAXA 4UATA 3BVPA 5K6AA 3CF6R 1YTUA 3ZGZA 4L76A 2NQ8A 4QECA 2LVBA 1LV7A 1PX0A 5DBEX 3PEUA 5KQRA 5IF9A 4C0XA 2Q49A 2YY6A 3EZ2A 2Q8NA 1O5IA 2YKGA 2RK3A 1GNVA 1XQ9A 3HB4X 3HQ4O 3RC1A 3WO1A 1Q83A 1SH7A 3W5HA 5JT1A 1NV8A 4GZMA 1A8HA 4LHEA 5T4HA 1W7AA 4RVOA 4PZUA 4WZAB 1P0IA 2C92A 2A1UB 4JC5A 4E5NA 3REOA 1VTKA 2XGSA 1DPGA 1AS3A 1Z56C 3HZRA 1U2PA 4M83A 5H3CA 2HF2A 5LN1A 5H3LA 4G0UA 1I2MA 1PNQA 1RXSA 2XQKA 3SEZA 4NCAA 4JOSA 1UR5A 1I6KA 2HWXA 5BOSA 1GTMA 1NKSA 2V7UA 1FW8A 3U3JA 1HFWA 2YJTD 1UZNA 1Z0FA 5DEOA 4W99A 3EZGA 4UEKA 3DV2A 5HTKA 4FD2A 1UKZA 3DF7A 3A9VA 2JIZD 3PJGA 2R751 4G9BA 1P8JA 2OCAA 3FWKA 4HATA 4MCIA 4XPIB 5LZ5A 4YMIA 1JIUA 3ESQA 5KYGA 2ZKLA 3WLEA 3Q10A 1WUIS 2AD1A 1UOOA 4BLRA 4EO7A 3PXUA 2DT5A 3UK2A 1B8NA 4CM7A 4TZ6A 4P54A 3UQZA 1R50A 5HZMA 2OB1A 4FFBB 2HJ9A 3O4IA 4HN9A 2JFNA 2X0KA 2RG1A 1ACJA 1TAHA 3B20A 1X7YB 2E6KA 4FI3C 5DU2A 4QGHA 3C2QA 2QAGA 3HXMA 4DR1B 4LCEA 2WZQA 4LJSA 4CN8A 2I2WA 4W6QA 2PL9A 1PDVA 4IVPA 1UPFA 3G9ZA 5K2OA 2NP7A 4LMPA 4KCGA 4YP1A 3N5CA 4YLGA 4MVJP 1NVEA 2DPLA 4KXLA 1S8FA 3W5VA 3AQIA 1QGUB 3VI3B 1AKVA 2CVFA 4DHEA 5EJ4A 3OIVA 1H1DA 1T9GR 3LL4A 3EXHC 2R6HA 3DL4A 4Z4QA 2F9LA 4QWWA 1OC2A 4K9KA 1RJEA 2GFQA 4W5WA 4X8OA 4BE7B 2UXBB 3GLQA 3IALA 3HVHA 3EJWA 4V0ME 5HRCA 5IC6A 1CZLA 4PM4A 2V9CA 1DIHA 1I4EB 1R8JA 4K6FA 1E32A 2NO5A 3BSWA 2OZPA 3NJRA 1DBRA 1UOQA 5ERXA 4I1YA 1KI7A 1VKZA 5GJWC 4MIOA 5KOHB 3OTGA 3BF7A 4D56A 4YUVA 4QTTB 5G53C 1D6MA 1L8XA 4CGZA 3D6MA 5EINA 3LBHA 2YJ6A 2IBSA 5DWVA 1FNMA 1FX0B 4EEZA 1I14A 1PR6A 3OY7A 1EP2B 3AU8A 2DZDA 3ZI4A 1J21A 5EA2A 4KU4A 2JJ1A 4ITRC 1WIWA 3I5YA 1II8B 2Y99A 2VJPA 4MW6A 3CCFA 4AXXA 5ALVA 1C3VA 3BOSA 3T38A 2C8JA 1YBVA 2FGKA 3FVQA 1BEUB 2QRZA 1NRJB 3G9TA 2D54A 3PLNA 7ADHA 1XMIA 2OO3A 1IIBA 3G8DA 2VLBA 2DC1A 2OXRA 3KUCA 5E4TA 3AR3A 3O9MA 3OICA 3EPPA 1KEEB 4S12A 5FUVA 3TIVA 1XD8A 3V00A 3WHKA 3DAFA 1URPA 4JBWA 3KJEA 5CAEB 3TZLA 4EDFA 3USCS 4YRBA 5A1JA 1DB3A 1A7JA 3AJ8A 4EPXA 3K1JA 1HKHA 5J4VA 4J2HA 4PG5A 5U1PA 3OEHD 4IXMA 4NFHA 1CUYA 3IDFA 4UVIA 1COWD 4J90A 5FAXA 5KTPA 3CX6A 1J8QA 2X22A 3HYNA 1UKBA 3CG0A 3O4GA 3QPBA 3LA8A 4JJ8A 5NLLA 2YWEA 3B9QA 1ZCJA 4F72A 1NOJA 3D6UA 4KR2A 3VV3A 2AKAB 2CLCX 1TCVA 3UHAA 3E2IA 1JIJA 1GL9B 2V58A 2CNNA 4UQOA 1KU6A 3DNFA 1ZGGA 5LA6B 5FDFA 3V1UA 1KH1A 2FF7A 5I7UA 2OC9A 3LBNA 3B51X 3L7AA 4W7HA 1HQYE 3QGMA 2CLOB 3V42A 4NDAA 3GPLA 2HK8A 3U0VA 3W7BA 3VPAA 2D5CA 3IBFA 3TTXA 1XDWA 2NSHA 2B3DA 3IPYA 4P22A 3STXA 3OFJA 1M83A 5JHGB 3N9IA 2P2CA 4DIUA 4H7FA 3ZY5A 1MX9A 1JEQA 3P2MA 1IN1A 1U2RA 1N1DA 2WIDA 1TE2A 2BKAA 3O4VA 2R4QA 5AI5A 5KNBH 1XZCA 2GWRA 3MZ0A 3H5NA 5JCXA 2WPNA 3EGWA 4O2AA 4DA7A 1LY1A 1I2DA 3EXHA 2YMQA 4RHYA 3HWWA 1RC1A 2IUEA 2Y27A 4D9MA 1YXMA 5DP1A 5KVSA 3M1YA 4WLEA 1OYOA 1ZGZA 4WBSA 3IA2A 4TWAA 4W9NA 1T5TA 4B8WA 2ZUCA 4Y6QA 4EHLA 3LE8A 2C58A 1CQZA 1Z5OA 4UARA 6Q21A 1QFYA 4XR9A 3JASB 5EERA 3MGKA 3O31A 1Y8CA 1LNSA 1F6BA 1WWKA 1IRXA 4ISCA 4LE0A 4MX8A 5CPBA 3WJAA 4QPZA 3ZCVA 4DY4A 2GN0A 1FLNA 4R9RA 1M6VB 1V25A 2EFCB 1TJ3A 3BWVA 2Y68A 3VZQA 1ZIOA 4B2PA 3DZFA 4FINA 1E0AA 4M53A 1JB1A 4NBVA 4Y1RA 2WHEA 4J0FA 4EPYA 3NC0C 1E18A 5GGXA 3ZXUB 2DXIA 1ISGA 1QC5A 1UBCA 5CDHA 4OI4A 3GAMA 1R5OA 4TKUA 2JKZA 4Q05A 5HX7A 4D6YA 3LOPA 3OPYI 3PRYA 4I50F 4KFUA 4DMLA 4PC7A 5A6SB 4K6CA 5F3DA 3ENVA 3FPFA 3QVKA 4OQXA 5BSUA 1E7MA 5AR1A 4F8JA 2PUFA 1AKTA 2RIPA 3L02A 5CK4A 3NTRA 4KPYA 3O8QB 3UWOA 3W8NA 3CLTD 5KS2A 1OZHA 3K53A 2CFOA 2BJHA 3FMVA 2WU3A 4XGQA 2OHVA 1DCFA 3HJNA 2W93A 1SZJG 3M0EA 4IQGA 1VBFA 1V4VA 2AEJA 2NXCA 1FVFA 2ZR0A 1ULZA 2GXQA 1W5AA 1WVMA 1DINA 1HT3A 3FZGA 3BF8A 2FTKE 1I7NA 3OE7A 3NP7A 3VO1A 5H1YA 1C3OA 2WNHA 2HZBA 4E22A 3P5BA 5DTQA 5BW5A 3HSSA 4QJ4A 2VXBA 2GJSA 4RTQA 2D3WA 3AJDA 3U7QA 1YVPA 3MUEA 4MWDA 5AKIA 4LFBB 3ISVA 1X7GA 3NHUA 1HSOA 2W4MA 2ZUDA 4KQ2A 4RK4A 5FOWA 2FUCA 1RXUA 1D2GA 2R5FA 1L7VC 4OYLA 4RHFA 3KPWA 4Z0PA 2I54A 1L3BA 1K08A 1R9JA 2Q41A 3WYBA 1II9A 2PSFA 3BHJA 4UOEA 4XUDA 2YV1A 5JSUA 4KSCA 4AJIA 5EXTA 4MMZB 1SGWA 3IEVA 2FZCA 1DBPA 1KQ3A 1IXSB 4YJKA 3O3MB 2WJAA 1GTSA 2GJ4A 1SCJA 2Y1CA 3CJQA 4M1YA 2VDKB 1UAYA 1PL7A 4TMTA 2Z1MA 1FSGA 1Z4JA 4OKNA 2XMCA 3MN1A 1PGQA 4IMIB 2NPIA 1DMRA 4AMUA 1EFVB 1TYCA 4IO1A 3U4DA 2QN8A 2VF8A 3AHFA 4L75A 1LRKA 1XRQA 4G67A 2DP4E 3NHFA 4KWIA 1TVMA 2PKRA 1J4AA 5TMBA 2WYOA 3GJRA 1BWPA 1BSVA 2C7GA 3R6WA 2OCYC 1QGAA 3Q8MA 4KR3A 2J3IA 3OPMA 1FP4A 4L16A 4S05A 1GTVA 3DGFC 4KR9A 4CFSA 4FFBA 4KR6A 3UHOA 3TBHA 2J7PD 4KWEA 5IT4A 1T6BY 1UBHS 1DBWA 2W2XA 2YYAA 5KJCA 5IVHA 3WTBA 1PWZA 2BE9A 3C6QA 3EHDA 2PWZA 1ZUD1 4MQBA 1S01A 3OF5A 4I1UA 5CCXA 2AQHA 1IY2A 4O1MA 3O0DA 3MMXA 4IDOA 3SSNA 4DWJA 1B2LA