2GZZA

Solution structures of the oxidized form of thioredoxin from bacillus subtilis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
104
structure length
104
Chain Sequence
MAIVKATDQSFSAETSEGVVLADFWAPWCGPCKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thioredoxin
publication title Conformational fluctuations coupled to the thiol-disulfide transfer between thioredoxin and arsenate reductase in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Electron transport
total genus 33
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2gzzA00
1X0RA 1MEKA 4AJ8A 3ZRDA 4KA0A 1AQVA 3IXRA 4PURA 3FR3A 3EU4A 1M9BA 5DVBA 2VCTA 4N30A 1MTCA 3TOTA 5GSSA 5HFGA 3IOSA 1X5DA 3ED3A 1FB6A 5G30A 5CAXA 1J0FA 1JLWA 2HSYA 4KDXA 2B5YA 2NBSA 2YPMA 1U3AA 3GRXA 5IMZA 4N0VA 2OE3A 2LJKA 2H8LA 2CVKA 4MH3A 4WBRD 3QFBC 4DSSA 1FG4A 2OKAA 2IMIA 2MMOA 2C3NA 3LQ7A 3GN3A 1TU7A 1T3BA 3FZ9A 3EYTA 3WYWA 3CBUA 2AYTA 2VD0A 2VLVA 3GIXA 1F2EA 1QK8A 3ERGA 1WOUA 3EMPA 1XWBA 2YJ7A 3VWUA 1X5EA 3TRPA 5ECIB 2MBTA 4G10A 1AQWA 5B6NA 2VO4A 3IBHA 3UVTA 3CXGA 11GSA 5DQSA 1ERVA 1R5PA 2NVLA 3KMOA 4FIWA 1UA5A 3H8QA 2REMA 2DIYA 2J23A 3N9JA 3UJ1A 2IMKA 2AHEA 3I43A 4IW9A 3GKMA 1UVZA 2H75A 5KEJA 5C04A 5GAND 1TDIA 1EOGA 2HRNA 2PBJA 4YQVA 2L5OA 5C00A 3GSSA 2FLSA 3TCOA 1MDKA 2YNXA 1K0NA 3TRQA 4Q5NA 4MF7A 5D73A 4K9ZA 5G31A 5JWRB 1NW2A 3GL5A 3LXZA 5J9BA 1YEXA 3P7XA 2PGTA 3E0UA 1T4YA 3GMFA 1NHYA 2P31A 1A2MA 3D22A 5DBQA 1YKCA 3LEFA 4LL1B 3UOMA 4MJAA 2O8VB 4MPFA 3BCIA 5ECOB 2YWMA 1M2BA 2YWOA 2I1UA 1R4WA 1YDKA 2GSTA 4PQHA 3KP8A 1MDIA 1XFLA 1IYIA 5INYA 2FY6A 1OC9B 2ES7A 4OMVA 4V2NA 1K0OA 1S3CA 1V58A 2CVDA 2LRCA 2X8GA 3QPMA 1TRWA 1YF0A 3GH9A 2E2MA 5GSTA 5ECMB 4JZQA 1PA3A 1HD2A 3EURA 2QGVA 4PX1A 6GSSA 2R6KA 5E4WA 1G6YA 5H5RA 3QCPA 3L9UA 1S3AA 2XPDA 1JHBA 3J7Yk 1LU4A 3GA4A 3QAVA 1A0RP 3HD5A 1ZZYA 4RQXA 1WWJA 4XRAA 1WE0A 1AC1A 2H76A 2DC5A 3D4MA 5D9VA 2L57A 2VCXA 4HI7A 5ECHB 4V1Ap 4V1Ag 5FT3A 1ILOA 4KCAA 1X5CA 4WF5A 5G5FA 4YQUA 3TKSE 3UBKA 5IO0A 1FAAA 4GSTA 4IVFA 2MYGA 2GVPA 1TTZA 1AIUA 3F3QA 3P2AA 3UVHA 2YZUA 4DSQA 1SD8A 2LEGA 1Z5YE 1WJKA 4F2IA 2LKUA 3H1NA 1YY7A 3A3TA 1Y6EA 2FHEA 3DMLA 5JCUA 5DJLA 4I2UA 4G9HA 3GV1A 4O32A 3VPTA 2P5QA 3NOFA 1GSEA 3VI5A 3D4TA 1PQNA 3VLNA 2C8UA 1JFUA 2FD3A 1JLVA 2E2GA 2LNSA 1OC3A 3EMXA 2EC4A 1TXXA 2V2GA 2FCHA 4IN0A 1WP0A 1J9BA 1SK2A 2XPEA 2GZYA 2GLRA 4I2TA 1QMVA 3Q19A 5JCGA 2H70A 4WXTA 1NM3A 2H6YA 3DYRA 4JBBA 2GSRA 3EWLA 4D73B 2CX4A 4NMUA 3TKSA 2DMLA 3DKSA 4ECJA 2CA8A 4HS1A 1GUKA 4OFTA 2CT6A 2PERA 2LQOA 17GSA 3LORA 4ZXGA 5IQYA 1IYHA 2DBCA 1TI1A 4TR3A 4F0BA 3H4KA 5G1KA 2IFQB 4I97A 4HEA2 2C1YA 2K8SA 13GSA 1YJ6A 2IN3A 4YH2A 2R3XA 4HZ4A 4N10A 2QSIA 4V2LA 5IMCA 3VFIA 2VUPA 3RHBA 3EVIA 5D8IA 3EC3A 3HHVA 2C0GA 3GX8A 1SENA 2LJAA 2WULA 5F07A 1JZWA 4L0UA 2HZEA 5AISA 1B4QA 2WRTA 1YEPA 1ZYQB 2GQKA 1GRXA 2LV3A 5F8BA 1Z7PA 2XHFA 2VOCA 2KP2A 2A4VA 3LG6A 2O85A 4KH7A 4AJ6A 4EO3A 5IPHA 4LL4B 1UN2A 2GS3A 3C7MA 2CV4A 2K8VA 2MZCA 3O6TA 5J4UA 3VI7A 1EZKA 3GURA 4BVYA 4L8EA 4ZB6A 2ZUPA 4ZIJA 4X43A 2IL3A 3LJRA 1HNBA 4WEYA 4ZL8A 5IMDA 3F0IA 3F9UA 3KP9A 4BL7A 3IK9A 4KB3A 5B8BA 2B6MA 1BX9A 3D21A 1QQ2A 2VCZA 4BWQA 3BBYA 2A2SA 4RQRA 5IMFA 4IQ1A 1VF1A 4KX4A 4MH2A 3C71A 4O92A 2HSHA 1V9WA 1UC7A 2B1KA 2OA7A 1WRYA 4F03A 1ZL9A 1OC8A 2AJQB 3ZVJD 5IOXA 2F8FA 5ECRB 4IQAA 2D2ZA 3TGZA 3E3EA 1GSYA 2F3MA 2ON7A 2I81A 4OWYA 3ZVJA 3KGKA 2K9FA 5IM9A 3O76A 2PU9C 2YV9A 3QD9A 3UAPA 2JACA 3KCMA 2DJ2A 5CREA 3QAGA 3FHKA 3RBTA 3RAZA 2VL3A 3D0ZA 4EUYA 3ZFBA 1K3OA 2IIYA 3KD0A 5F05A 2OE1A 4K1FA 4TR4A 3M9KA 3PR8A 1XW5A 1XW6A 2KLXA 3PINA 1XWCA 3TRXA 3TJJA 2JSYA 2LSTA 3IR4A 1GUMA 3HVVA 3LFLA 10GSA 3A2WA 2FA8A 3CRTA 4TXOA 1QFNA 2KP1A 5ECPB 1BJXA 2CAIA 3LYPA 3WGDA 2G0FA 2WDUA 2H0GA 1YZXA 4O7HA 4IP1A 1EP7A 4GSSA 4XRDA 4JE1A 5IIZA 2HI7A 4P3YB 2OBIA 5ELAA 5IMAA 4POKA 2VLUA 3GL3A 4MP4A 4ECIA 3ERWA 1ZYEA 3A2VA 4DSSB 1PGTA 3DVWA 2C3TA 1OYJA 1OKTA 3F3RA 4TVEA 3HA9A 3CTGA 5B8AA 2TRXA 3UIWA 4L5LA 4IKHA 3ZTLA 4MLYA 3CTFA 4GTUA 1ERWA 3GFKA 4GLTA 3JCML 2FA4A 5L71A 3L0HA 3C73A 4CW9A 1GWCA 1TW9A 3TB2A 4NV2A 1T8EB 1Z3EA 4AJ7A 3IHQA 3U5RE 2IPAA 1RQMA 5HFIA 2HLSA 1TOFA 2OADA 6GSTA 3HY2A 3M3MA 1E6BA 5DCHA 1TI3A 5ECLB 3J7Yb 1BYEA 3FZ4A 3KM6A 2HNLA 3IDVA 4OD7A 3IA1A 4NXIA 2PVQA 1ACVA 2R37A 4V2MA 2H73A 1XVWA 3FR9A 1RW1A 1J08A 3GKKA 4EF0A 4MPGA 3DVXA 1U6TA 5LCZA 5A5KA 5B6MA 2EIRA 3QAWA 5ABRA 2XC2A 3M8NA 2QC7A 5IOWA 3F6DA 4FO5A 4XS1A 3UEMA 4LLRA 4TR1B 3F4SA 1NSWA 1N2AA 4CDOA 3Q74A 1ZOFA 4EXJA 3F4TA 1DSBA 3HJOA 14GSA 4FYUA 2CZ3A 4E8EA 3WT1A 3LXTA 3IE3A 4E8HA 5F0GA 1ERTA 4DEJA 3CSHA 3VWVA 5DAKB 3GHAA 1PX6A 2GQLA 1BAYA 1THOA 1WIKA 5G5EA 1XWKA 1DUGA 4DVCA 2YANA 1TK5B 4I8BA 2CAQA 2N5FA 2B7KA 1KBNA 5DQYA 5HR0A 5ID2A 2H1BA 3MSZA 1JZOA 4IBPA 4IJIA 1PKZA 20GSA 4TXVA 1W4VA 1KTEA 3GUSA 4MMMA 2WS2A 3E9JB 5DALB 2LS5A 2V6OA 1F9MA 1GNWA 3Q6OA 4OFMA 2Z9SA 5B7CA 2CX3A 4IELA 4MABA 3HJMA 2F8AA 3UL3A 2CVBA 1XPVA 1EP8A 2OJLA 2TIRA 3HYPA 1SL2B 2FUG2 3TKRA 3BOAA 3CYNA 2DJ1A 1SL0B 1GSDA 1T1VA 2GT6A 4XHMA 1K0CA 1GLQA 1OC9A 3F63A 2C0FA 5IMVA 2DIZA 3QFAC 1TRVA 3TKSC 5ENUA 4MF6A 4FH8A 3W6GA 3H93A 1OE8A 3UBLA 1A8YA 4MJBA 1F3BA 1BQ7A 1XCCA 3FK8A 4K6XA 1XWGA 2LUSA 2LQQA 5CYYA 2JU5A 1AQXA 4PUAA 3WD6A 5EY6A 5IPGA 1B9YC 3KTBA 2VAFA 1DE2A 3VPQA 4MA9A 4JU5A 4MDCA 5CNWA 5HR2A 4NAXA 1FVKA 5KN2A 2YWNA 5GAPD 3M1GA 1MD3A 2R2JA 2OE0A 2VD1A 1QGVA 1U88A 3MDKA 3BJ5A 4LMVA 1ML6A 2WGRA 3ERFA 4WETA 4Z7XA 2IMFA 3PGTA 4KSOA 3GYKA 5D9XA 3C8EA 1PRXA 3A5WA 2B7JA 1PKWA 4BWSA 1VF3A 4L5OA 2ON5A 3G7JA 4MF5A 1MDJA 1DBYA 5H5QA 2H30A 1EWXA 1XOBA 3G7IA 3I9V2 3H79A 1O8XA 2YCDA 19GSA 2X64A 3LGCA 1XOAA 3UMAA 2GSSA 2YWIA 1F3AA 1THXA 2KUCA 1OE7A 1OKDA 1SD9A 4ZL7A 1A2JA 3HVXA 22GSA 3EINA 1EGOA 4KNDA 4TOPA 2H01A 4XTSA 3GNJA 5ECNB 3CSJA 3S9FA 4L0WA 3IRAA 4RI6A 1TRUA 3GTUA 2O7KA 1USBA 3NIVA 2DSAA 1OAZA 3FW2A 4KW6A 3UARA 2BTOT 2LTKA 4GXZA 2KOKA 4YQMA 5CRWA 8GSSA 2L5LA 2XBIA 4KUNA 3TJFA 3I69A 4ZL9A 3QR6A 4PNFA 2HZEB 3FYGA 3D5JA 4TN8A 3ZIJA 2MMNA 2B3SA 4PQ1A 1DE1A 2J9HA 4GWRA 1M2AA 1B9XC 1Z6MA 4Q5RA 4MZWA 5CP1A 1H4OA 2N5BA 2WCIA 1SKSB 4QL9A 4POMA 1I5GA 12GSA 5J3RA 2HZFA 2IFQA 5COHA 2PMTA 3DIEA 5FWGA 4XIHA 2BMXA 7GSSA 4ZBBA 2DJJA 1XWAA 3DWVA 6GSWA 2H71A 3HJPA 2DLXA 1XW9A 4F0CA 1F6MC 2I3YA 3MNGA 3CRUA 2L6CA 5AGYA 2GQMA 4J2FA 1GH2A 2X8CA 5JWOB 2OBKA 3A2XA 2B5EA 4ML1A 3V1WA 1XZOA 4XS4A 4KCEA 4HZ2A 4MZCA 1A23A 4PXOA 3P8WA 5A4UA 4YAVA 1XBSA 1PD21 1EV4A 3HCZA 2ZNMA 2HT9A 2RIIA 2C0EA 3RPNA 3TJGA 4XCSA 2MBSA 1B4PA 1LBKA 2V1MA 5H5SA 16GSA 3GH6A 1PL1A 5A4VA 1TP9A 2IMEA 1VF2A 1BG5A 4JRRA 5JWQB 2R4VA 3KZQA 2GZPA 4AF2A 3NZNA 2H0HA 1Q4JA 2DJ3A 3QMXA 4HQZA 3DD3A 2DMMA 1PSQA 4GF0A 4GRFA 1M0UA 5KN0A 5ELGA 4WR5A 1O81A 5G2ZA 2VM2A 4NV5A 1SYRA 1PN9A 1SU9A 3KMNA 2FWFA 2R5GA 4DSRA 3W8JA 4IJ3A 4G2EA 4OO4A 5G1LA 2V32A 2CZ2A 4EDZA 6GSVA 4ISDA 2P5RA 3F8UA 2JZTA 3FZAA 4K7NA 1K0DA 4K0GA 2TRCP 5FHIA 3O3TA 3RHCA 4EKZA 2VM1A 4MJCA 1GL8A 2VIMA 3D6IA 3QOUA 4HJ2A 4YAPA 4XS6A 1Z9HA 1JZDA 3ZITA 18GSA 3ZREA 2RUFA 4RI7A 6GSXA 3SWLA 1AW9A 2WB9A 3WGEA 1GLPA 2H1AA 1YF1A 2V41A 4PUFC 1KNGA 2RM6A 4H86A 3OR5A 1TK8B 1SK0A 4MJEA 1ERUA 3DEXA 3ME7A 4HDEA 1F37A 3RPPA 2E7PA 3GKXA 2O87A 3HDCA 2H6XA 1FB0A 4ULXA 1TK0B 4TW5A 5HR1A 4IHUA 1T7PB 2QKEA 1O73A 3DRNA 3W8SA 1A8LA 1N8JA 2FWEA 4NPBA 1V98A 5J9CA 3IAS2 4ML6A 2K18A 1M7TA 2IJYA 5ECSA 6GSUA 2HFDA 1EV9A 1EEMA 2VL2A 1HNCA 1O7UA 4ACSA 6GSYA 1I9DA 1K3LA 4MCUA 3IC4A 1A0FA 3IPZA 5ECKB 2A2RA 4EE0A 4ZBDA 3L78A 3ME8A 2GZZA 1G6WA 3VURA 2YV7A 1ON4A 4WBJA 2O89A 1FHEA 5EVOA 1A24A 2PUKC 3C1RA 3HZ4A 3L9VA 5GZZB 1M99A 1V2AA 3EE2A 5LD0A 4K8MA 3TJKA 1TU8A 3G7YA 2VCVA 4N11A 1JZRA 3L9SA 3RDWA 2AAWA 1QXHA 5E59A 3ZMLA 2N5AA 5ID2B 2VL9A 1FOVA 2PPTA 3G9BA 2H0IA 4NHWA 3CSIA 4EC0A 1Z6NA 3GSTA 4HU9A 5CRHA 3BD2A 1VGLA 4TR1A 1KEBA 1OVNA 2GT5A 4LA1A 1X9SB 4ECCA 1R26A 4POBA 4PNGA 2MMAA 2JSZA 1SL1B 3WGXA 4HOJA 2P0GA 2I9HA 1Q98A 5CRGA 2AB6A 2ALBA 5DAKA 1EEJA 1GTAA 3KTLA 5JCWA 3MAKA 5D96A 1PMTA 5HR3A 5LNKe 4AGSA 1HQOA 1RK4A 1GNEA 4IP6A 1W89A 1G7EA 2RM5A 4KDYA 3AY8A 4MZBA 4TRXA 2VLTA 4K0NA 4WR4A 2WFCA 4GSNA 3M0FA 3KEBA 4JR4A 3LWAA 2C0DA 2YOIA 5CO3A 1YKAA 5DALA 1V40A 3ISOA 2RUEA 2X8HA 2FWHA 1ZMAA 3ZL5A 1SJIA 4K7IA 4N0ZA 5EPFA 4X0XA 2V6KA 1GTBA 3CMIA 1O6JA 2K6VA 4WKWA 1K0BA 5AIVA 3LSZA 3P90A 2YP6A 5AIXA 1GTUA 4IGJA 2M46A 4J57E 3F4RA 5F06A 2L4QA 2JZRA 2L59A 3TKPA 2G2QA 2H66A 3FEUA 3Q18A 9GSSA 1GSUA 3QDNA 1MD4A 1BEDA 1EGRA 4Q5QA 2PWJA 3LYKA 1U3IA 2HE3A 1HYUA 1ZCPA 2HYXA 1WPIA 1SKRB 4HUAA 4CHSA 3FY7A 4F9ZA 4HQSA 3F6FA 2KHPA 2MMZA 1SYXA 1SJZA 2HXKA 4KSMA 3TJBA 1QUWA 3KH9A 3C1SA 4X1UA 1WMJA 3FKFA 3IK7A 4O5RA 3TKQA 3IAM2 1K0AA 2F9SA 3DXBA 1PX7A 3KH7A 4OCEA 1SK1A 3ZMKA 1C72A 2NDOA 5D93A 4RUVA 2CQ9A 2GTUA 4ZBAA 2EIOA 1EOHA 1T00A 3WT2A 1GSQA 2B1LA 2FNOA 4FYCA 4WF4A 1SJ6A 1Y25A 2DJKA 3BCKA 2AV4A 1K0MA 2H72A 2H74A 1G7OA 3KIJA 3GTUB 3ZZXA 2BJXA 3L4NA 4QL7A 3TOUA 4K7OA 1X9MB 1CQGA 2NTOA 2VCQA 1TJDA 1T4ZA 3HXSA 3APSA 3HVSA 1B8XA 3N5OA 2LRTA 4Q5FA 4F82A 4KDUA 2FGXA 1GULA 3HZ8A 5J5NA 2I4AA 1Z7RA 1GTIA 1U87A 3APOA 4KAEA 2C4JA 4KE3A 3ZLPA 3EU3A 5DJMA 3I6AA 4ZB9A 1O8WA 1B48A 1GUHA 1K3YA 1GSSA 3ZIVA 4D73A 2WZ9A 5HFKA 4TKYA 2YN1A 2IWTA 2GDRA 2NPBA 4GQCA 2F51A 1G0TA 1ST9A 1FW1A 3ZYWA 3HKRA 2XBQA 5AN1A 2VCWA 3FRCA 5KN1A 2M80A 1AUCA 2JL4A 4PGTA 4QQ7A 2OACA 1AXDA 5IO2A 1FVJA 4EL1A 3M9JA 1CQHA 5HQPA 5CRDA 1V57A 2LJRA 5KN3A 4TR0A 1ABAA 3PH9A 4KGIA 3VWXA 4BPYA 4ID0A 4XS4B 5ECQB 1A2LA 4OFNA 1H75A 2AUVA 4ZILA 3FZ5A 3VWWA 1VF4A 4NWYA 1NHOA 4NHZA 5A4WA 2GSQA 3GX0A 3K8NA 5D9WA 2LNTA 2RLIA 1XVQA 2FWGA 5EL8A 2EIQA 4MK3A 2WJUA 1URMA 2H19A 5DDLA 2JZSA 2B5XA 4PQIA 3TUEA 4BVXA 4OCFA 1M2DA 5D9TA 1PL2A 1TRSA 3DGQA 4G19A 2IMDA 4I6XA 3TDGA 3KJYA 1XIYA 5J41A 4IS0A 2HRFA 1S3DA 1M9AA 4EDYA 4EVMA 2C3QA 3ZFLA 1GSFA 4FYBA 4I5QA 4K2DA 1R5AA 3VK9A 4LMWA 2YJHA 1ZGNA 4JR6A 3GKNA 4GQFA 4BA7A 4ZB8A 3MWHA 3US3A 3APQA 3U6VA 3R2QA 1SKWB 1TKDB 2VL2C 1X9WB 1XXUA 2X99A 4ECBA 4JEDA 2L6DA 5DCGA 2L4CA 1R7HA 3IV4A 2PN8A 3FR6A 4HJMA 1VRSD 2ZCTA 1GP1A 4TXOB 2DJ0A 1E2YA 2H1GA 2YZHA 2H1DA 2LRNA 2PVOC 4ILFA 2M72A 4HU7A 1AAZA 4GCIA 3KXOA 2H6ZA 2GGTA 2E0QA 1LJRA 2C80A 4OO5A 4J56E 1O85A 1YQ1A 1FO5A 2JADA 4POLA 1HNAA 3SBCA
chains in the Genus database with same CATH superfamily
1X0RA 1MEKA 4AJ8A 3ZRDA 2HSMA 4KA0A 1AQVA 3IXRA 4PURA 3FR3A 3EU4A 1M9BA 5DVBA 2VCTA 4N30A 1MTCA 2HRKA 4FQUA 3TOTA 5GSSA 2X49A 5HFGA 3IOSA 1X5DA 3ED3A 1FB6A 5G30A 5CAXA 1J0FA 1JLWA 2HSYA 4KDXA 2B5YA 2QA1A 2NBSA 2YPMA 1U3AA 3GRXA 5IMZA 4N0VA 2OE3A 2LJKA 2H8LA 2CVKA 4MH3A 4WBRD 3QFBC 4DSSA 1FG4A 2OKAA 2IMIA 2MMOA 2C3NA 3LQ7A 3GN3A 1TU7A 1T3BA 3FZ9A 3EYTA 3WYWA 3CBUA 2AYTA 2VD0A 2VLVA 3GIXA 1F2EA 1QK8A 3ERGA 1WOUA 3EMPA 1XWBA 2YJ7A 3VWUA 1X5EA 3TRPA 5ECIB 2MBTA 4G10A 1AQWA 5B6NA 2VO4A 3IBHA 3UVTA 3CXGA 11GSA 5DQSA 1ERVA 1R5PA 2NVLA 3KMOA 4FIWA 1UA5A 3H8QA 2REMA 2DIYA 2J23A 3N9JA 3UJ1A 2IMKA 2AHEA 3I43A 1ZYNA 4IW9A 3GKMA 1UVZA 2H75A 5KEJA 5C04A 5GAND 1TDIA 1EOGA 2HRNA 2PBJA 4YQVA 2L5OA 5C00A 3GSSA 4EIPA 2FLSA 3TCOA 1MDKA 2YNXA 1K0NA 3TRQA 4Q5NA 4MF7A 5D73A 4K9ZA 5G31A 5JWRB 1NW2A 3GL5A 3LXZA 5J9BA 1YEXA 3P7XA 2PGTA 3E0UA 1T4YA 3GMFA 2UZ8A 1NHYA 2P31A 1A2MA 3D22A 1M3IA 5DBQA 1YKCA 3LEFA 4LL1B 3UOMA 4MJAA 2O8VB 4MPFA 3BCIA 5ECOB 2YWMA 1M2BA 2YWOA 2I1UA 1R4WA 1YDKA 2GSTA 4Z2UA 4PQHA 3KP8A 1MDIA 1XFLA 1IYIA 5INYA 2FY6A 1OC9B 2ES7A 4OMVA 4V2NA 1K0OA 1S3CA 1V58A 2CVDA 2LRCA 2X8GA 3QPMA 1TRWA 1YF0A 3GH9A 2E2MA 5GSTA 5ECMB 3HVNA 4JZQA 1PA3A 1HD2A 3EURA 2QGVA 4PX1A 6GSSA 2R6KA 5E4WA 1G6YA 5H5RA 3QCPA 3L9UA 2R0PA 1S3AA 3EPTA 2XPDA 1JHBA 3J7Yk 1LU4A 3GA4A 3QAVA 1A0RP 3HD5A 1ZZYA 4RQXA 1WWJA 4XRAA 1WE0A 1AC1A 2H76A 2DC5A 3D4MA 5D9VA 2L57A 2VCXA 4HI7A 5ECHB 4V1Ap 4V1Ag 5FT3A 4K5RA 1ILOA 4KCAA 1X5CA 4WF5A 5G5FA 4YQUA 3TKSE 3UBKA 5IO0A 1FAAA 4GSTA 4YKGA 2HRAA 4IVFA 2MYGA 2GVPA 1TTZA 1AIUA 3F3QA 3P2AA 3UVHA 2A2PA 2YZUA 4DSQA 1SD8A 2LEGA 1Z5YE 1WJKA 4F2IA 2LKUA 3H1NA 1YY7A 3A3TA 1Y6EA 2FHEA 3DMLA 5JCUA 5DJLA 4PTSA 1XG8A 4I2UA 4G9HA 3GV1A 4O32A 3VPTA 2P5QA 3NOFA 1GSEA 3VI5A 3D4TA 1PQNA 3VLNA 2C8UA 1JFUA 2FD3A 1JLVA 2E2GA 2LNSA 1OC3A 3EMXA 2EC4A 1TXXA 2V2GA 2FCHA 4IN0A 1WP0A 1J9BA 1SK2A 2XPEA 3R3EA 2GZYA 2GLRA 4I2TA 1QMVA 3Q19A 5JCGA 2H70A 4WXTA 1NM3A 2H6YA 3DYRA 4JBBA 2GSRA 3EWLA 4D73B 2CX4A 4NMUA 3TKSA 2DMLA 3DKSA 4ECJA 2CA8A 4HS1A 1GUKA 4OFTA 2CT6A 2PERA 2LQOA 17GSA 3LORA 4ZXGA 5IQYA 1IYHA 2DBCA 1TI1A 4TR3A 4F0BA 3H4KA 5G1KA 2IFQB 4I97A 4HEA2 2C1YA 2K8SA 13GSA 4G0IA 1YJ6A 2IN3A 4YH2A 2R3XA 4HZ4A 4N10A 2QSIA 4V2LA 5IMCA 3VFIA 2VUPA 3RHBA 3EVIA 5D8IA 3EC3A 3HHVA 2C0GA 3GX8A 1SENA 2LJAA 2WULA 5F07A 1JZWA 4L0UA 2HZEA 5AISA 1B4QA 2WRTA 1YEPA 1ZYQB 2GQKA 1GRXA 2LV3A 5F8BA 1Z7PA 2XHFA 2VOCA 2KP2A 2A4VA 3LG6A 2O85A 4KH7A 4AJ6A 4EO3A 5IPHA 4LL4B 1UN2A 2GS3A 3C7MA 2CV4A 2K8VA 2MZCA 3O6TA 5J4UA 3VI7A 1EZKA 3GURA 4BVYA 2QA2A 4L8EA 5KOWA 4ZB6A 2ZUPA 4ZIJA 4X43A 2IL3A 3LJRA 1HNBA 4WEYA 4ZL8A 5IMDA 3F0IA 3F9UA 3KP9A 4BL7A 3IK9A 4KB3A 5B8BA 2B6MA 1BX9A 3D21A 1QQ2A 2VCZA 4BWQA 3BBYA 2A2SA 4RQRA 5IMFA 4IQ1A 1VF1A 4KX4A 4MH2A 3C71A 4O92A 2HSHA 1V9WA 1UC7A 2B1KA 2OA7A 1WRYA 4F03A 1ZL9A 4X4JA 1OC8A 2AJQB 3ZVJD 5IOXA 2F8FA 5ECRB 4IQAA 3MYDA 2D2ZA 3TGZA 3E3EA 1GSYA 2F3MA 2ON7A 2I81A 4OWYA 3ZVJA 3KGKA 2K9FA 5IM9A 3O76A 2PU9C 2YV9A 3QD9A 3UAPA 2JACA 3KCMA 2DJ2A 5CREA 3QAGA 3FHKA 3RBTA 3RAZA 2VL3A 3D0ZA 4EUYA 3ZFBA 1K3OA 1PN0A 2IIYA 3KD0A 5F05A 2OE1A 4K1FA 4TR4A 3M9KA 3PR8A 1XW5A 1XW6A 2KLXA 3CQFA 3PINA 1XWCA 3TRXA 3TJJA 2JSYA 2LSTA 3IR4A 1GUMA 3HVVA 3LFLA 10GSA 3A2WA 2FA8A 3CRTA 4TXOA 1QFNA 2KP1A 5ECPB 1BJXA 2CAIA 3LYPA 3WGDA 2G0FA 1ZYPA 2WDUA 2H0GA 1YZXA 4O7HA 4IP1A 1EP7A 4GSSA 4XRDA 4JE1A 5IIZA 2HI7A 4P3YB 2OBIA 5ELAA 5IMAA 4POKA 2VLUA 3GL3A 4MP4A 4ECIA 3ERWA 1ZYEA 3A2VA 4DSSB 1PGTA 3DVWA 2C3TA 1OYJA 1OKTA 3F3RA 4TVEA 3HA9A 3CTGA 5B8AA 2TRXA 3UIWA 4L5LA 4IKHA 3ZTLA 4MLYA 3CTFA 4GTUA 4Z2TA 1ERWA 3GFKA 4GLTA 3JCML 2FA4A 5L71A 3L0HA 3C73A 4CW9A 1GWCA 1TW9A 3TB2A 4NV2A 1T8EB 1Z3EA 4AJ7A 3IHQA 3U5RE 2IPAA 1RQMA 5HFIA 2HLSA 1TOFA 2OADA 6GSTA 3HY2A 3M3MA 1E6BA 5DCHA 1TI3A 5ECLB 3J7Yb 1BYEA 3FZ4A 3KM6A 4USSA 2HNLA 3IDVA 4OD7A 3IA1A 4CY8A 4NXIA 2PVQA 1ACVA 2R37A 4V2MA 2H73A 1XVWA 3FR9A 1RW1A 1J08A 3GKKA 4EF0A 4MPGA 3DVXA 1U6TA 5LCZA 5A5KA 5B6MA 2EIRA 3QAWA 5ABRA 2XC2A 3M8NA 2QC7A 5IOWA 3F6DA 4FO5A 4XS1A 3UEMA 4LLRA 4TR1B 3F4SA 1NSWA 1N2AA 4CDOA 3Q74A 1ZOFA 4EXJA 3F4TA 1DSBA 3HJOA 14GSA 2R0CA 4FYUA 2CZ3A 4E8EA 3WT1A 3LXTA 3IE3A 4E8HA 5F0GA 1ERTA 4DEJA 3CSHA 3VWVA 5DAKB 3GHAA 1PX6A 2GQLA 1BAYA 1THOA 1WIKA 5G5EA 1XWKA 1DUGA 4DVCA 2YANA 1TK5B 4I8BA 2CAQA 2N5FA 2B7KA 1KBNA 5DQYA 5HR0A 5ID2A 2H1BA 3MSZA 1JZOA 4IBPA 4IJIA 1PKZA 20GSA 4TXVA 1W4VA 1KTEA 3GUSA 4MMMA 2WS2A 3E9JB 5DALB 2LS5A 2V6OA 1F9MA 1GNWA 3Q6OA 4Z2RA 4OFMA 2Z9SA 5B7CA 2CX3A 4IELA 4MABA 3HJMA 2F8AA 3UL3A 2CVBA 1XPVA 1EP8A 2OJLA 2TIRA 3HYPA 1SL2B 2FUG2 3TKRA 3BOAA 3CYNA 2DJ1A 1SL0B 1GSDA 1T1VA 2GT6A 4XHMA 1K0CA 1GLQA 1OC9A 3F63A 3LW9A 2C0FA 5IMVA 2DIZA 3QFAC 1TRVA 3TKSC 5ENUA 4MF6A 4FH8A 3W6GA 3H93A 1OE8A 3UBLA 2X4AA 1A8YA 4MJBA 1F3BA 1BQ7A 1XCCA 3FK8A 4K6XA 1XWGA 2LUSA 2LQQA 5CYYA 2JU5A 1AQXA 4PUAA 3WD6A 5EY6A 5IPGA 1B9YC 3KTBA 2VAFA 1DE2A 3VPQA 4MA9A 4JU5A 4MDCA 5CNWA 5HR2A 4NAXA 1FVKA 5KN2A 2YWNA 5GAPD 3M1GA 1MD3A 2R2JA 2OE0A 2VD1A 1QGVA 1U88A 3MDKA 3BJ5A 4LMVA 1ML6A 2WGRA 3ERFA 4WETA 4Z7XA 4A5PA 2IMFA 3PGTA 4KSOA 3GYKA 5D9XA 3C8EA 1PRXA 3A5WA 2B7JA 1PKWA 4BWSA 1VF3A 4L5OA 2ON5A 3G7JA 4MF5A 1MDJA 1DBYA 5H5QA 2H30A 1EWXA 1XOBA 3G7IA 3I9V2 4K5SA 3H79A 1O8XA 2YCDA 19GSA 2X64A 3LGCA 1XOAA 3UMAA 2GSSA 2YWIA 1F3AA 1THXA 2KUCA 1OE7A 1OKDA 1SD9A 4ZL7A 1A2JA 3HVXA 22GSA 3EINA 4ICYA 1EGOA 4KNDA 4TOPA 2H01A 4XTSA 3GNJA 5ECNB 3CSJA 3S9FA 4L0WA 3IRAA 4RI6A 1TRUA 2R0GA 3GTUA 2O7KA 1USBA 3NIVA 2DSAA 1OAZA 3FW2A 4KW6A 3UARA 2BTOT 2LTKA 4GXZA 2KOKA 4YQMA 5CRWA 8GSSA 2L5LA 2XBIA 4KUNA 3TJFA 3I69A 4ZL9A 3QR6A 4PNFA 2HZEB 3FYGA 3D5JA 4TN8A 3ZIJA 2MMNA 2B3SA 4PQ1A 1DE1A 2J9HA 4GWRA 1M2AA 1B9XC 1Z6MA 4Q5RA 4MZWA 5CP1A 1H4OA 2N5BA 2WCIA 1SKSB 4QL9A 4POMA 1I5GA 12GSA 5J3RA 2HZFA 2IFQA 5COHA 2PMTA 2DKHA 3DIEA 5FWGA 4XIHA 2BMXA 7GSSA 3A5IA 4ZBBA 2DJJA 1XWAA 3DWVA 6GSWA 2H71A 3HJPA 2DLXA 1XW9A 4F0CA 1F6MC 2I3YA 3MNGA 3CRUA 2L6CA 4BVXB 4CY6A 5AGYA 2GQMA 4J2FA 1GH2A 2X8CA 5JWOB 2OBKA 3A2XA 1S3RA 2B5EA 4ML1A 3V1WA 1XZOA 4XS4A 4KCEA 4HZ2A 4MNNA 4MZCA 1A23A 4PXOA 3P8WA 3PPUA 4O5QA 5A4UA 4YAVA 1XBSA 1PD21 1EV4A 3HCZA 2ZNMA 2HT9A 2RIIA 4K2XA 2C0EA 3RPNA 3TJGA 4XCSA 2MBSA 1B4PA 1LBKA 2V1MA 5H5SA 16GSA 3GH6A 2A4HA 1PL1A 5A4VA 1TP9A 2IMEA 1VF2A 1BG5A 4JRRA 5JWQB 2R4VA 3KZQA 2GZPA 4AF2A 3NZNA 2H0HA 1Q4JA 2DJ3A 3QMXA 4HQZA 3DD3A 2DMMA 1PSQA 4GF0A 4GRFA 1M0UA 5KN0A 5ELGA 4WR5A 1O81A 5G2ZA 2VM2A 4NV5A 1SYRA 1PN9A 1SU9A 3KMNA 2FWFA 2R5GA 4DSRA 3W8JA 4IJ3A 4G2EA 4OO4A 5G1LA 2V32A 2CZ2A 4EDZA 6GSVA 4ISDA 2P5RA 3F8UA 2JZTA 3FZAA 4K7NA 1K0DA 4K0GA 2TRCP 5FHIA 3O3TA 3RHCA 4EKZA 2VM1A 4MJCA 1GL8A 2VIMA 3D6IA 3QOUA 4HJ2A 4YAPA 4XS6A 1Z9HA 1JZDA 3ZITA 18GSA 3ZREA 2RUFA 4RI7A 6GSXA 3SWLA 1AW9A 2WB9A 3WGEA 1GLPA 2H1AA 1M3JA 1YF1A 2V41A 4PUFC 1KNGA 2RM6A 4H86A 3OR5A 1TK8B 4YKFA 1SK0A 4MJEA 1ERUA 3DEXA 3ME7A 4HDEA 1F37A 3RPPA 2E7PA 3GKXA 2O87A 3HDCA 2H6XA 1FB0A 4ULXA 1TK0B 4TW5A 5HR1A 4IHUA 1T7PB 2QKEA 1O73A 3DRNA 3W8SA 1A8LA 1N8JA 2FWEA 4NPBA 1V98A 5J9CA 3IAS2 1PFOA 4ML6A 2K18A 1M7TA 2IJYA 5ECSA 6GSUA 2HFDA 1EV9A 1EEMA 2VL2A 1HNCA 1O7UA 4ACSA 6GSYA 1I9DA 1K3LA 4MCUA 3IC4A 1A0FA 3IPZA 5ECKB 2A2RA 4EE0A 4ZBDA 3L78A 3ME8A 2GZZA 1G6WA 3VURA 2YV7A 1ON4A 4WBJA 2O89A 1FHEA 5EVOA 1A24A 2PUKC 3C1RA 3HZ4A 3L9VA 5GZZB 1M99A 1V2AA 3EE2A 5LD0A 4K8MA 3TJKA 1TU8A 3G7YA 2VCVA 4N11A 1JZRA 3L9SA 3RDWA 2AAWA 1QXHA 5E59A 3ZMLA 2N5AA 5ID2B 2VL9A 1FOVA 2PPTA 3G9BA 2H0IA 4NHWA 3CSIA 4EC0A 1Z6NA 3GSTA 4HU9A 5CRHA 3BD2A 1VGLA 4TR1A 1KEBA 1OVNA 2GT5A 4LA1A 1X9SB 4ECCA 1R26A 4POBA 4PNGA 2MMAA 2JSZA 1SL1B 3WGXA 4HOJA 2P0GA 2I9HA 1Q98A 5CRGA 2AB6A 2ALBA 5DAKA 1EEJA 1GTAA 3KTLA 5JCWA 3MAKA 5D96A 1PMTA 5HR3A 5LNKe 4AGSA 1HQOA 1RK4A 1GNEA 4IP6A 1W89A 1G7EA 3FMWA 2RM5A 4KDYA 3AY8A 4MZBA 4TRXA 2VLTA 4K0NA 4WR4A 2WFCA 4GSNA 3M0FA 3KEBA 4JR4A 3LWAA 2C0DA 2YOIA 5CO3A 5KOXA 1YKAA 5DALA 1V40A 3ISOA 2RUEA 2X8HA 2FWHA 1ZMAA 4O5UA 3ZL5A 1SJIA 4K7IA 4N0ZA 5EPFA 4X0XA 4EIQA 2V6KA 1GTBA 3CMIA 1O6JA 2K6VA 4WKWA 1K0BA 5AIVA 3LSZA 3P90A 2YP6A 5AIXA 1GTUA 4IGJA 2M46A 4J57E 3F4RA 5F06A 2L4QA 2JZRA 2L59A 3TKPA 2G2QA 2H66A 3FEUA 3Q18A 9GSSA 1GSUA 3QDNA 1MD4A 1BEDA 1EGRA 4Q5QA 2PWJA 3LYKA 1U3IA 2HE3A 1HYUA 5BMUA 1ZCPA 2HYXA 1WPIA 1SKRB 4HUAA 4CHSA 3FY7A 4F9ZA 4HQSA 3F6FA 2KHPA 2MMZA 4KF9A 1SYXA 1SJZA 2HXKA 4KSMA 3TJBA 1QUWA 3KH9A 3C1SA 4X1UA 1WMJA 3FKFA 3IK7A 4O5RA 3TKQA 3IAM2 1K0AA 2F9SA 3DXBA 1PX7A 3KH7A 4OCEA 1SK1A 3ZMKA 1C72A 2NDOA 2DKIA 5D93A 4RUVA 2CQ9A 2GTUA 4ZBAA 2EIOA 1EOHA 1T00A 3WT2A 1GSQA 2B1LA 2FNOA 4FYCA 4WF4A 1SJ6A 1Y25A 2DJKA 3BCKA 2AV4A 1K0MA 2H72A 2H74A 1G7OA 3KIJA 3IHGA 3GTUB 3ZZXA 2BJXA 3L4NA 4QL7A 3TOUA 4K7OA 1X9MB 1CQGA 2NTOA 2VCQA 1TJDA 1T4ZA 3HXSA 3APSA 3HVSA 1B8XA 3N5OA 2LRTA 4Q5FA 4F82A 4KDUA 2FGXA 1GULA 3HZ8A 5J5NA 2I4AA 1Z7RA 1GTIA 1U87A 3MIXA 3APOA 4KAEA 2C4JA 4KE3A 3ZLPA 3EU3A 5DJMA 3I6AA 4ZB9A 1O8WA 1B48A 1GUHA 1K3YA 1GSSA 3ZIVA 4D73A 2WZ9A 5HFKA 4TKYA 2YN1A 2IWTA 2GDRA 2NPBA 4GQCA 2F51A 5BRTA 1G0TA 1ST9A 1FW1A 3ZYWA 3HKRA 2XBQA 5AN1A 2VCWA 3FRCA 5KN1A 2M80A 1AUCA 2JL4A 4BVYB 4PGTA 4QQ7A 2OACA 1AXDA 5IO2A 1FVJA 4EL1A 3M9JA 1CQHA 5HQPA 5CRDA 1V57A 1FOHA 2LJRA 5KN3A 4BL7B 4TR0A 1ABAA 3PH9A 4KGIA 3VWXA 4BPYA 4ID0A 4XS4B 5ECQB 1A2LA 4OFNA 1H75A 2AUVA 4ZILA 3FZ5A 3VWWA 1VF4A 4NWYA 1NHOA 4NHZA 5A4WA 2GSQA 3GX0A 3K8NA 5D9WA 2LNTA 2RLIA 1XVQA 2FWGA 5EL8A 2EIQA 4MK3A 2WJUA 1URMA 2H19A 5DDLA 2JZSA 2B5XA 4PQIA 3TUEA 4BVXA 4OCFA 1M2DA 5D9TA 1PL2A 1TRSA 3DGQA 4G19A 2IMDA 4I6XA 3TDGA 4G0LA 3KJYA 1XIYA 5J41A 4IS0A 2HRFA 1S3DA 1M9AA 4EDYA 4EVMA 2C3QA 3ZFLA 1GSFA 4FYBA 4HSCX 4I5QA 4K2DA 1R5AA 3VK9A 4LMWA 2YJHA 1ZGNA 4JR6A 3GKNA 4GQFA 4BA7A 4ZB8A 3MWHA 3US3A 3APQA 3U6VA 3R2QA 1SKWB 1TKDB 2VL2C 1X9WB 1XXUA 2X99A 4ECBA 4JEDA 2L6DA 5DCGA 2L4CA 1R7HA 3IV4A 2PN8A 3FR6A 4HJMA 1VRSD 2ZCTA 1GP1A 4TXOB 2DJ0A 1E2YA 2H1GA 2YZHA 4G0KA 2H1DA 2LRNA 2PVOC 4ILFA 2M72A 4HU7A 3IC8A 1AAZA 4GCIA 3KXOA 2H6ZA 4BIKA 2GGTA 2E0QA 1LJRA 2C80A 4OO5A 4J56E 1O85A 1YQ1A 1FO5A 2JADA 4POLA 1HNAA 3SBCA
chains in the Genus database with same CATH topology
1X0RA 1MEKA 4AJ8A 3ZRDA 2HSMA 4KA0A 1AQVA 3IXRA 4PURA 3FR3A 3EU4A 1M9BA 5DVBA 2VCTA 4N30A 1MTCA 2HRKA 4FQUA 3TOTA 5GSSA 2X49A 5HFGA 3IOSA 1X5DA 3ED3A 1FB6A 5G30A 5CAXA 1J0FA 1JLWA 2HSYA 4KDXA 2B5YA 2QA1A 2NBSA 2YPMA 1U3AA 3GRXA 5IMZA 4N0VA 2OE3A 2LJKA 2H8LA 2CVKA 4MH3A 4WBRD 3QFBC 4DSSA 1FG4A 2OKAA 2IMIA 2MMOA 2C3NA 3LQ7A 3GN3A 1TU7A 1T3BA 3FZ9A 3EYTA 3WYWA 3CBUA 2AYTA 2VD0A 2VLVA 3GIXA 1F2EA 1QK8A 3ERGA 1WOUA 3EMPA 1XWBA 2YJ7A 3VWUA 1X5EA 3TRPA 5ECIB 2MBTA 4G10A 1AQWA 5B6NA 2VO4A 3IBHA 3UVTA 3CXGA 11GSA 5DQSA 1ERVA 1R5PA 2NVLA 3KMOA 4FIWA 1UA5A 3H8QA 2REMA 2DIYA 2J23A 3N9JA 3UJ1A 2IMKA 2AHEA 3I43A 1ZYNA 4IW9A 3GKMA 1UVZA 2H75A 5KEJA 5C04A 5GAND 1TDIA 1EOGA 2HRNA 2PBJA 4YQVA 2L5OA 5C00A 3GSSA 4EIPA 2FLSA 3TCOA 1MDKA 2YNXA 1K0NA 3TRQA 4Q5NA 4MF7A 5D73A 4K9ZA 5G31A 5JWRB 1NW2A 3GL5A 3LXZA 5J9BA 1YEXA 3P7XA 2PGTA 3E0UA 1T4YA 3GMFA 2UZ8A 1NHYA 2P31A 1A2MA 3D22A 5DBQA 1YKCA 3LEFA 4LL1B 3UOMA 4MJAA 2O8VB 4MPFA 3BCIA 5ECOB 2YWMA 1M2BA 2YWOA 2I1UA 1R4WA 1YDKA 2GSTA 4Z2UA 4PQHA 3KP8A 1MDIA 1XFLA 1IYIA 5INYA 2FY6A 1OC9B 2ES7A 4OMVA 4V2NA 1K0OA 1S3CA 1V58A 2CVDA 2LRCA 2X8GA 3QPMA 1TRWA 1YF0A 3GH9A 2E2MA 5GSTA 5ECMB 4JZQA 1PA3A 1HD2A 3EURA 2QGVA 4PX1A 6GSSA 2R6KA 5E4WA 1G6YA 5H5RA 3QCPA 3L9UA 2R0PA 1S3AA 3EPTA 2XPDA 1JHBA 3J7Yk 1LU4A 3GA4A 3QAVA 1A0RP 3HD5A 1ZZYA 4RQXA 1WWJA 4XRAA 1WE0A 1AC1A 2H76A 2DC5A 3D4MA 5D9VA 2L57A 2VCXA 4HI7A 5ECHB 4V1Ap 4V1Ag 5FT3A 4K5RA 1ILOA 4KCAA 1X5CA 4WF5A 5G5FA 4YQUA 3TKSE 3UBKA 5IO0A 1FAAA 4GSTA 4YKGA 2HRAA 4IVFA 2MYGA 2GVPA 1TTZA 1AIUA 3F3QA 3P2AA 3UVHA 2A2PA 2YZUA 4DSQA 1SD8A 2LEGA 1Z5YE 1WJKA 4F2IA 2LKUA 3H1NA 1YY7A 3A3TA 1Y6EA 2FHEA 3DMLA 5JCUA 5DJLA 4PTSA 4I2UA 4G9HA 3GV1A 4O32A 3VPTA 2P5QA 3NOFA 1GSEA 3VI5A 3D4TA 1PQNA 3VLNA 2C8UA 1JFUA 2FD3A 1JLVA 2E2GA 2LNSA 1OC3A 3EMXA 2EC4A 1TXXA 2V2GA 2FCHA 4IN0A 1WP0A 1J9BA 1SK2A 2XPEA 3R3EA 2GZYA 2GLRA 4I2TA 1QMVA 3Q19A 5JCGA 2H70A 4WXTA 1NM3A 2H6YA 3DYRA 4JBBA 2GSRA 3EWLA 4D73B 2CX4A 4NMUA 3TKSA 2DMLA 3DKSA 4ECJA 2CA8A 4HS1A 1GUKA 4OFTA 2CT6A 2PERA 2LQOA 17GSA 3LORA 4ZXGA 5IQYA 1IYHA 2DBCA 1TI1A 4TR3A 4F0BA 3H4KA 5G1KA 2IFQB 4I97A 4HEA2 2C1YA 2K8SA 13GSA 4G0IA 1YJ6A 2IN3A 4YH2A 2R3XA 4HZ4A 4N10A 2QSIA 4V2LA 5IMCA 3VFIA 2VUPA 3RHBA 3EVIA 5D8IA 3EC3A 3HHVA 2C0GA 3GX8A 1SENA 2LJAA 2WULA 5F07A 1JZWA 4L0UA 2HZEA 5AISA 1B4QA 2WRTA 1YEPA 1ZYQB 2GQKA 1GRXA 2LV3A 5F8BA 1Z7PA 2XHFA 2VOCA 2KP2A 2A4VA 3LG6A 2O85A 4KH7A 4AJ6A 4EO3A 5IPHA 4LL4B 1UN2A 2GS3A 3C7MA 2CV4A 2K8VA 2MZCA 3O6TA 5J4UA 3VI7A 1EZKA 3GURA 4BVYA 2QA2A 4L8EA 5KOWA 4ZB6A 2ZUPA 4ZIJA 4X43A 2IL3A 3LJRA 1HNBA 4WEYA 4ZL8A 5IMDA 3F0IA 3F9UA 3KP9A 4BL7A 3IK9A 4KB3A 5B8BA 2B6MA 1BX9A 3D21A 1QQ2A 2VCZA 4BWQA 3BBYA 2A2SA 4RQRA 5IMFA 4IQ1A 1VF1A 4KX4A 4MH2A 3C71A 4O92A 2HSHA 1V9WA 1UC7A 2B1KA 2OA7A 1WRYA 4F03A 1ZL9A 4X4JA 1OC8A 2AJQB 3ZVJD 5IOXA 2F8FA 5ECRB 4IQAA 3MYDA 2D2ZA 3TGZA 3E3EA 1GSYA 2F3MA 2ON7A 2I81A 4OWYA 3ZVJA 3KGKA 2K9FA 5IM9A 3O76A 2PU9C 2YV9A 3QD9A 3UAPA 2JACA 3KCMA 2DJ2A 5CREA 3QAGA 3FHKA 3RBTA 3RAZA 2VL3A 3D0ZA 4EUYA 3ZFBA 1K3OA 1PN0A 2IIYA 3KD0A 5F05A 2OE1A 4K1FA 4TR4A 3M9KA 3PR8A 1XW5A 1XW6A 2KLXA 3PINA 1XWCA 3TRXA 3TJJA 2JSYA 2LSTA 3IR4A 1GUMA 3HVVA 3LFLA 10GSA 3A2WA 2FA8A 3CRTA 4TXOA 1QFNA 2KP1A 5ECPB 1BJXA 2CAIA 3LYPA 3WGDA 2G0FA 1ZYPA 2WDUA 2H0GA 1YZXA 4O7HA 4IP1A 1EP7A 4GSSA 4XRDA 4JE1A 5IIZA 2HI7A 4P3YB 2OBIA 5ELAA 5IMAA 4POKA 2VLUA 3GL3A 4MP4A 4ECIA 3ERWA 1ZYEA 3A2VA 4DSSB 1PGTA 3DVWA 2C3TA 1OYJA 1OKTA 3F3RA 4TVEA 3HA9A 3CTGA 5B8AA 2TRXA 3UIWA 4L5LA 4IKHA 3ZTLA 4MLYA 3CTFA 4GTUA 4Z2TA 1ERWA 3GFKA 4GLTA 3JCML 2FA4A 5L71A 3L0HA 3C73A 4CW9A 1GWCA 1TW9A 3TB2A 4NV2A 1T8EB 1Z3EA 4AJ7A 3IHQA 3U5RE 2IPAA 1RQMA 5HFIA 2HLSA 1TOFA 2OADA 6GSTA 3HY2A 3M3MA 1E6BA 5DCHA 1TI3A 5ECLB 3J7Yb 1BYEA 3FZ4A 3KM6A 4USSA 2HNLA 3IDVA 4OD7A 3IA1A 4CY8A 4NXIA 2PVQA 1ACVA 2R37A 4V2MA 2H73A 1XVWA 3FR9A 1RW1A 1J08A 3GKKA 4EF0A 4MPGA 3DVXA 1U6TA 5LCZA 5A5KA 5B6MA 2EIRA 3QAWA 5ABRA 2XC2A 3M8NA 2QC7A 5IOWA 3F6DA 4FO5A 4XS1A 3UEMA 4LLRA 4TR1B 3F4SA 1NSWA 1N2AA 4CDOA 3Q74A 1ZOFA 4EXJA 3F4TA 1DSBA 3HJOA 14GSA 2R0CA 4FYUA 2CZ3A 4E8EA 3WT1A 3LXTA 3IE3A 4E8HA 5F0GA 1ERTA 4DEJA 3CSHA 3VWVA 5DAKB 3GHAA 1PX6A 2GQLA 1BAYA 1THOA 1WIKA 5G5EA 1XWKA 1DUGA 4DVCA 2YANA 1TK5B 4I8BA 2CAQA 2N5FA 2B7KA 1KBNA 5DQYA 5HR0A 5ID2A 2H1BA 3MSZA 1JZOA 4IBPA 4IJIA 1PKZA 20GSA 4TXVA 1W4VA 1KTEA 3GUSA 4MMMA 2WS2A 3E9JB 5DALB 2LS5A 2V6OA 1F9MA 1GNWA 3Q6OA 4Z2RA 4OFMA 2Z9SA 5B7CA 2CX3A 4IELA 4MABA 3HJMA 2F8AA 3UL3A 2CVBA 1XPVA 1EP8A 2OJLA 2TIRA 3HYPA 1SL2B 2FUG2 3TKRA 3BOAA 3CYNA 2DJ1A 1SL0B 1GSDA 1T1VA 2GT6A 4XHMA 1K0CA 1GLQA 1OC9A 3F63A 3LW9A 2C0FA 5IMVA 2DIZA 3QFAC 1TRVA 3TKSC 5ENUA 4MF6A 4FH8A 3W6GA 3H93A 1OE8A 3UBLA 2X4AA 1A8YA 4MJBA 1F3BA 1BQ7A 1XCCA 3FK8A 4K6XA 1XWGA 2LUSA 2LQQA 5CYYA 2JU5A 1AQXA 4PUAA 3WD6A 5EY6A 5IPGA 1B9YC 3KTBA 2VAFA 1DE2A 3VPQA 4MA9A 4JU5A 4MDCA 5CNWA 5HR2A 4NAXA 1FVKA 5KN2A 2YWNA 5GAPD 3M1GA 1MD3A 2R2JA 2OE0A 2VD1A 1QGVA 1U88A 3MDKA 3BJ5A 4LMVA 1ML6A 2WGRA 3ERFA 4WETA 4Z7XA 4A5PA 2IMFA 3PGTA 4KSOA 3GYKA 5D9XA 3C8EA 1PRXA 3A5WA 2B7JA 1PKWA 4BWSA 1VF3A 4L5OA 2ON5A 3G7JA 4MF5A 1MDJA 1DBYA 5H5QA 2H30A 1EWXA 1XOBA 3G7IA 3I9V2 4K5SA 3H79A 1O8XA 2YCDA 19GSA 2X64A 3LGCA 1XOAA 3UMAA 2GSSA 2YWIA 1F3AA 1THXA 2KUCA 1OE7A 1OKDA 1SD9A 4ZL7A 1A2JA 3HVXA 22GSA 3EINA 4ICYA 1EGOA 4KNDA 4TOPA 2H01A 4XTSA 3GNJA 5ECNB 3CSJA 3S9FA 4L0WA 3IRAA 4RI6A 1TRUA 2R0GA 3GTUA 2O7KA 1USBA 3NIVA 2DSAA 1OAZA 3FW2A 4KW6A 3UARA 2BTOT 2LTKA 4GXZA 2KOKA 4YQMA 5CRWA 8GSSA 2L5LA 2XBIA 4KUNA 3TJFA 3I69A 4ZL9A 3QR6A 4PNFA 2HZEB 3FYGA 3D5JA 4TN8A 3ZIJA 2MMNA 2B3SA 4PQ1A 1DE1A 2J9HA 4GWRA 1M2AA 1B9XC 1Z6MA 4Q5RA 4MZWA 5CP1A 1H4OA 2N5BA 2WCIA 1SKSB 4QL9A 4POMA 1I5GA 12GSA 5J3RA 2HZFA 2IFQA 5COHA 2PMTA 2DKHA 3DIEA 5FWGA 4XIHA 2BMXA 7GSSA 3A5IA 4ZBBA 2DJJA 1XWAA 3DWVA 6GSWA 2H71A 3HJPA 2DLXA 1XW9A 4F0CA 1F6MC 2I3YA 3MNGA 3CRUA 2L6CA 4BVXB 4CY6A 5AGYA 2GQMA 4J2FA 1GH2A 2X8CA 5JWOB 2OBKA 3A2XA 2B5EA 4ML1A 3V1WA 1XZOA 4XS4A 4KCEA 4HZ2A 4MNNA 4MZCA 1A23A 4PXOA 3P8WA 3PPUA 4O5QA 5A4UA 4YAVA 1XBSA 1PD21 1EV4A 3HCZA 2ZNMA 2HT9A 2RIIA 4K2XA 2C0EA 3RPNA 3TJGA 4XCSA 2MBSA 1B4PA 1LBKA 2V1MA 5H5SA 16GSA 3GH6A 2A4HA 1PL1A 5A4VA 1TP9A 2IMEA 1VF2A 1BG5A 4JRRA 5JWQB 2R4VA 3KZQA 2GZPA 4AF2A 3NZNA 2H0HA 1Q4JA 2DJ3A 3QMXA 4HQZA 3DD3A 2DMMA 1PSQA 4GF0A 4GRFA 1M0UA 5KN0A 5ELGA 4WR5A 1O81A 5G2ZA 2VM2A 4NV5A 1SYRA 1PN9A 1SU9A 3KMNA 2FWFA 2R5GA 4DSRA 3W8JA 4IJ3A 4G2EA 4OO4A 5G1LA 2V32A 2CZ2A 4EDZA 6GSVA 4ISDA 2P5RA 3F8UA 2JZTA 3FZAA 4K7NA 1K0DA 4K0GA 2TRCP 5FHIA 3O3TA 3RHCA 4EKZA 2VM1A 4MJCA 1GL8A 2VIMA 3D6IA 3QOUA 4HJ2A 4YAPA 4XS6A 1Z9HA 1JZDA 3ZITA 18GSA 3ZREA 2RUFA 4RI7A 6GSXA 3SWLA 1AW9A 2WB9A 3WGEA 1GLPA 2H1AA 1YF1A 2V41A 4PUFC 1KNGA 2RM6A 4H86A 3OR5A 1TK8B 4YKFA 1SK0A 4MJEA 1ERUA 3DEXA 3ME7A 4HDEA 1F37A 3RPPA 2E7PA 3GKXA 2O87A 3HDCA 2H6XA 1FB0A 4ULXA 1TK0B 4TW5A 5HR1A 4IHUA 1T7PB 2QKEA 1O73A 3DRNA 3W8SA 1A8LA 1N8JA 2FWEA 4NPBA 1V98A 5J9CA 3IAS2 4ML6A 2K18A 1M7TA 2IJYA 5ECSA 6GSUA 2HFDA 1EV9A 1EEMA 2VL2A 1HNCA 1O7UA 4ACSA 6GSYA 1I9DA 1K3LA 4MCUA 3IC4A 1A0FA 3IPZA 5ECKB 2A2RA 4EE0A 4ZBDA 3L78A 3ME8A 2GZZA 1G6WA 3VURA 2YV7A 1ON4A 4WBJA 2O89A 1FHEA 5EVOA 1A24A 2PUKC 3C1RA 3HZ4A 3L9VA 5GZZB 1M99A 1V2AA 3EE2A 5LD0A 4K8MA 3TJKA 1TU8A 3G7YA 2VCVA 4N11A 1JZRA 3L9SA 3RDWA 2AAWA 1QXHA 5E59A 3ZMLA 2N5AA 5ID2B 2VL9A 1FOVA 2PPTA 3G9BA 2H0IA 4NHWA 3CSIA 4EC0A 1Z6NA 3GSTA 4HU9A 5CRHA 3BD2A 1VGLA 4TR1A 1KEBA 1OVNA 2GT5A 4LA1A 1X9SB 4ECCA 1R26A 4POBA 4PNGA 2MMAA 2JSZA 1SL1B 3WGXA 4HOJA 2P0GA 2I9HA 1Q98A 5CRGA 2AB6A 2ALBA 5DAKA 1EEJA 1GTAA 3KTLA 5JCWA 3MAKA 5D96A 1PMTA 5HR3A 5LNKe 4AGSA 1HQOA 1RK4A 1GNEA 4IP6A 1W89A 1G7EA 3FMWA 2RM5A 4KDYA 3AY8A 4MZBA 4TRXA 2VLTA 4K0NA 4WR4A 2WFCA 4GSNA 3M0FA 3KEBA 4JR4A 3LWAA 2C0DA 2YOIA 5CO3A 5KOXA 1YKAA 5DALA 1V40A 3ISOA 2RUEA 2X8HA 2FWHA 1ZMAA 4O5UA 3ZL5A 1SJIA 4K7IA 4N0ZA 5EPFA 4X0XA 4EIQA 2V6KA 1GTBA 3CMIA 1O6JA 2K6VA 4WKWA 1K0BA 5AIVA 3LSZA 3P90A 2YP6A 5AIXA 1GTUA 4IGJA 2M46A 4J57E 3F4RA 5F06A 2L4QA 2JZRA 2L59A 3TKPA 2G2QA 2H66A 3FEUA 3Q18A 9GSSA 1GSUA 3QDNA 1MD4A 1BEDA 1EGRA 4Q5QA 2PWJA 3LYKA 1U3IA 2HE3A 1HYUA 5BMUA 1ZCPA 2HYXA 1WPIA 1SKRB 4HUAA 4CHSA 3FY7A 4F9ZA 4HQSA 3F6FA 2KHPA 2MMZA 4KF9A 1SYXA 1SJZA 2HXKA 4KSMA 3TJBA 1QUWA 3KH9A 3C1SA 4X1UA 1WMJA 3FKFA 3IK7A 4O5RA 3TKQA 3IAM2 1K0AA 2F9SA 3DXBA 1PX7A 3KH7A 4OCEA 1SK1A 3ZMKA 1C72A 2NDOA 2DKIA 5D93A 4RUVA 2CQ9A 2GTUA 4ZBAA 2EIOA 1EOHA 1T00A 3WT2A 1GSQA 2B1LA 2FNOA 4FYCA 4WF4A 1SJ6A 1Y25A 2DJKA 3BCKA 2AV4A 1K0MA 2H72A 2H74A 1G7OA 3KIJA 3IHGA 3GTUB 3ZZXA 2BJXA 3L4NA 4QL7A 3TOUA 4K7OA 1X9MB 1CQGA 2NTOA 2VCQA 1TJDA 1T4ZA 3HXSA 3APSA 3HVSA 1B8XA 3N5OA 2LRTA 4Q5FA 4F82A 4KDUA 2FGXA 1GULA 3HZ8A 5J5NA 2I4AA 1Z7RA 1GTIA 1U87A 3MIXA 3APOA 4KAEA 2C4JA 4KE3A 3ZLPA 3EU3A 5DJMA 3I6AA 4ZB9A 1O8WA 1B48A 1GUHA 1K3YA 1GSSA 3ZIVA 4D73A 2WZ9A 5HFKA 4TKYA 2YN1A 2IWTA 2GDRA 2NPBA 4GQCA 2F51A 5BRTA 1G0TA 1ST9A 1FW1A 3ZYWA 3HKRA 2XBQA 5AN1A 2VCWA 3FRCA 5KN1A 2M80A 1AUCA 2JL4A 4BVYB 4PGTA 4QQ7A 2OACA 1AXDA 5IO2A 1FVJA 4EL1A 3M9JA 1CQHA 5HQPA 5CRDA 1V57A 1FOHA 2LJRA 5KN3A 4BL7B 4TR0A 1ABAA 3PH9A 4KGIA 3VWXA 4BPYA 4ID0A 4XS4B 5ECQB 1A2LA 4OFNA 1H75A 2AUVA 4ZILA 3FZ5A 3VWWA 1VF4A 4NWYA 1NHOA 4NHZA 5A4WA 2GSQA 3GX0A 3K8NA 5D9WA 2LNTA 2RLIA 1XVQA 2FWGA 5EL8A 2EIQA 4MK3A 2WJUA 1URMA 2H19A 5DDLA 2JZSA 2B5XA 4PQIA 3TUEA 4BVXA 4OCFA 1M2DA 5D9TA 1PL2A 1TRSA 3DGQA 4G19A 2IMDA 4I6XA 3TDGA 4G0LA 3KJYA 1XIYA 5J41A 4IS0A 2HRFA 1S3DA 1M9AA 4EDYA 4EVMA 2C3QA 3ZFLA 1GSFA 4FYBA 4I5QA 4K2DA 1R5AA 3VK9A 4LMWA 2YJHA 1ZGNA 4JR6A 3GKNA 4GQFA 4BA7A 4ZB8A 3MWHA 3US3A 3APQA 3U6VA 3R2QA 1SKWB 1TKDB 2VL2C 1X9WB 1XXUA 2X99A 4ECBA 4JEDA 2L6DA 5DCGA 2L4CA 1R7HA 3IV4A 2PN8A 3FR6A 4HJMA 1VRSD 2ZCTA 1GP1A 4TXOB 2DJ0A 1E2YA 2H1GA 2YZHA 4G0KA 2H1DA 2LRNA 2PVOC 4ILFA 2M72A 4HU7A 3IC8A 1AAZA 4GCIA 3KXOA 2H6ZA 2GGTA 2E0QA 1LJRA 2C80A 4OO5A 4J56E 1O85A 1YQ1A 1FO5A 2JADA 4POLA 1HNAA 3SBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X0R A;  1MEK A;  4AJ8 A;  3ZRD A;  4KA0 A;  1AQV A;  3IXR A;  4PUR A;  3FR3 A;  3EU4 A;  1M9B A;  5DVB A;  2VCT A;  4N30 A;  1MTC A;  3TOT A;  5GSS A;  5HFG A;  3IOS A;  1X5D A;  3ED3 A;  1FB6 A;  5G30 A;  5CAX A;  1J0F A;  1JLW A;  2HSY A;  4KDX A;  2B5Y A;  2NBS A;  2YPM A;  1U3A A;  3GRX A;  5IMZ A;  4N0V A;  2OE3 A;  2LJK A;  2H8L A;  2CVK A;  4MH3 A;  4WBR D;  3QFB C;  4DSS A;  1FG4 A;  2OKA A;  2IMI A;  2MMO A;  2C3N A;  3LQ7 A;  3GN3 A;  1TU7 A;  1T3B A;  3FZ9 A;  3EYT A;  3WYW A;  3CBU A;  2AYT A;  2VD0 A;  2VLV A;  3GIX A;  1F2E A;  1QK8 A;  3ERG A;  1WOU A;  3EMP A;  1XWB A;  2YJ7 A;  3VWU A;  1X5E A;  3TRP A;  5ECI B;  2MBT A;  4G10 A;  1AQW A;  5B6N A;  2VO4 A;  3IBH A;  3UVT A;  3CXG A;  11GS A;  5DQS A;  1ERV A;  1R5P A;  2NVL A;  3KMO A;  4FIW A;  1UA5 A;  3H8Q A;  2REM A;  2DIY A;  2J23 A;  3N9J A;  3UJ1 A;  2IMK A;  2AHE A;  3I43 A;  4IW9 A;  3GKM A;  1UVZ A;  2H75 A;  5KEJ A;  5C04 A;  5GAN D;  1TDI A;  1EOG A;  2HRN A;  2PBJ A;  4YQV A;  2L5O A;  5C00 A;  3GSS A;  2FLS A;  3TCO A;  1MDK A;  2YNX A;  1K0N A;  3TRQ A;  4Q5N A;  4MF7 A;  5D73 A;  4K9Z A;  5G31 A;  5JWR B;  1NW2 A;  3GL5 A;  3LXZ A;  5J9B A;  1YEX A;  3P7X A;  2PGT A;  3E0U A;  1T4Y A;  3GMF A;  1NHY A;  2P31 A;  1A2M A;  3D22 A;  5DBQ A;  1YKC A;  3LEF A;  4LL1 B;  3UOM A;  4MJA A;  2O8V B;  4MPF A;  3BCI A;  5ECO B;  2YWM A;  1M2B A;  2YWO A;  2I1U A;  1R4W A;  1YDK A;  2GST A;  4PQH A;  3KP8 A;  1MDI A;  1XFL A;  1IYI A;  5INY A;  2FY6 A;  1OC9 B;  2ES7 A;  4OMV A;  4V2N A;  1K0O A;  1S3C A;  1V58 A;  2CVD A;  2LRC A;  2X8G A;  3QPM A;  1TRW A;  1YF0 A;  3GH9 A;  2E2M A;  5GST A;  5ECM B;  4JZQ A;  1PA3 A;  1HD2 A;  3EUR A;  2QGV A;  4PX1 A;  6GSS A;  2R6K A;  5E4W A;  1G6Y A;  5H5R A;  3QCP A;  3L9U A;  1S3A A;  2XPD A;  1JHB A;  3J7Y k;  1LU4 A;  3GA4 A;  3QAV A;  1A0R P;  3HD5 A;  1ZZY A;  4RQX A;  1WWJ A;  4XRA A;  1WE0 A;  1AC1 A;  2H76 A;  2DC5 A;  3D4M A;  5D9V A;  2L57 A;  2VCX A;  4HI7 A;  5ECH B;  4V1A p;  4V1A g;  5FT3 A;  1ILO A;  4KCA A;  1X5C A;  4WF5 A;  5G5F A;  4YQU A;  3TKS E;  3UBK A;  5IO0 A;  1FAA A;  4GST A;  4IVF A;  2MYG A;  2GVP A;  1TTZ A;  1AIU A;  3F3Q A;  3P2A A;  3UVH A;  2YZU A;  4DSQ A;  1SD8 A;  2LEG A;  1Z5Y E;  1WJK A;  4F2I A;  2LKU A;  3H1N A;  1YY7 A;  3A3T A;  1Y6E A;  2FHE A;  3DML A;  5JCU A;  5DJL A;  4I2U A;  4G9H A;  3GV1 A;  4O32 A;  3VPT A;  2P5Q A;  3NOF A;  1GSE A;  3VI5 A;  3D4T A;  1PQN A;  3VLN A;  2C8U A;  1JFU A;  2FD3 A;  1JLV A;  2E2G A;  2LNS A;  1OC3 A;  3EMX A;  2EC4 A;  1TXX A;  2V2G A;  2FCH A;  4IN0 A;  1WP0 A;  1J9B A;  1SK2 A;  2XPE A;  2GZY A;  2GLR A;  4I2T A;  1QMV A;  3Q19 A;  5JCG A;  2H70 A;  4WXT A;  1NM3 A;  2H6Y A;  3DYR A;  4JBB A;  2GSR A;  3EWL A;  4D73 B;  2CX4 A;  4NMU A;  3TKS A;  2DML A;  3DKS A;  4ECJ A;  2CA8 A;  4HS1 A;  1GUK A;  4OFT A;  2CT6 A;  2PER A;  2LQO A;  17GS A;  3LOR A;  4ZXG A;  5IQY A;  1IYH A;  2DBC A;  1TI1 A;  4TR3 A;  4F0B A;  3H4K A;  5G1K A;  2IFQ B;  4I97 A;  4HEA 2;  2C1Y A;  2K8S A;  13GS A;  1YJ6 A;  2IN3 A;  4YH2 A;  2R3X A;  4HZ4 A;  4N10 A;  2QSI A;  4V2L A;  5IMC A;  3VFI A;  2VUP A;  3RHB A;  3EVI A;  5D8I A;  3EC3 A;  3HHV A;  2C0G A;  3GX8 A;  1SEN A;  2LJA A;  2WUL A;  5F07 A;  1JZW A;  4L0U A;  2HZE A;  5AIS A;  1B4Q A;  2WRT A;  1YEP A;  1ZYQ B;  2GQK A;  1GRX A;  2LV3 A;  5F8B A;  1Z7P A;  2XHF A;  2VOC A;  2KP2 A;  2A4V A;  3LG6 A;  2O85 A;  4KH7 A;  4AJ6 A;  4EO3 A;  5IPH A;  4LL4 B;  1UN2 A;  2GS3 A;  3C7M A;  2CV4 A;  2K8V A;  2MZC A;  3O6T A;  5J4U A;  3VI7 A;  1EZK A;  3GUR A;  4BVY A;  4L8E A;  4ZB6 A;  2ZUP A;  4ZIJ A;  4X43 A;  2IL3 A;  3LJR A;  1HNB A;  4WEY A;  4ZL8 A;  5IMD A;  3F0I A;  3F9U A;  3KP9 A;  4BL7 A;  3IK9 A;  4KB3 A;  5B8B A;  2B6M A;  1BX9 A;  3D21 A;  1QQ2 A;  2VCZ A;  4BWQ A;  3BBY A;  2A2S A;  4RQR A;  5IMF A;  4IQ1 A;  1VF1 A;  4KX4 A;  4MH2 A;  3C71 A;  4O92 A;  2HSH A;  1V9W A;  1UC7 A;  2B1K A;  2OA7 A;  1WRY A;  4F03 A;  1ZL9 A;  1OC8 A;  2AJQ B;  3ZVJ D;  5IOX A;  2F8F A;  5ECR B;  4IQA A;  2D2Z A;  3TGZ A;  3E3E A;  1GSY A;  2F3M A;  2ON7 A;  2I81 A;  4OWY A;  3ZVJ A;  3KGK A;  2K9F A;  5IM9 A;  3O76 A;  2PU9 C;  2YV9 A;  3QD9 A;  3UAP A;  2JAC A;  3KCM A;  2DJ2 A;  5CRE A;  3QAG A;  3FHK A;  3RBT A;  3RAZ A;  2VL3 A;  3D0Z A;  4EUY A;  3ZFB A;  1K3O A;  2IIY A;  3KD0 A;  5F05 A;  2OE1 A;  4K1F A;  4TR4 A;  3M9K A;  3PR8 A;  1XW5 A;  1XW6 A;  2KLX A;  3PIN A;  1XWC A;  3TRX A;  3TJJ A;  2JSY A;  2LST A;  3IR4 A;  1GUM A;  3HVV A;  3LFL A;  10GS A;  3A2W A;  2FA8 A;  3CRT A;  4TXO A;  1QFN A;  2KP1 A;  5ECP B;  1BJX A;  2CAI A;  3LYP A;  3WGD A;  2G0F A;  2WDU A;  2H0G A;  1YZX A;  4O7H A;  4IP1 A;  1EP7 A;  4GSS A;  4XRD A;  4JE1 A;  5IIZ A;  2HI7 A;  4P3Y B;  2OBI A;  5ELA A;  5IMA A;  4POK A;  2VLU A;  3GL3 A;  4MP4 A;  4ECI A;  3ERW A;  1ZYE A;  3A2V A;  4DSS B;  1PGT A;  3DVW A;  2C3T A;  1OYJ A;  1OKT A;  3F3R A;  4TVE A;  3HA9 A;  3CTG A;  5B8A A;  2TRX A;  3UIW A;  4L5L A;  4IKH A;  3ZTL A;  4MLY A;  3CTF A;  4GTU A;  1ERW A;  3GFK A;  4GLT A;  3JCM L;  2FA4 A;  5L71 A;  3L0H A;  3C73 A;  4CW9 A;  1GWC A;  1TW9 A;  3TB2 A;  4NV2 A;  1T8E B;  1Z3E A;  4AJ7 A;  3IHQ A;  3U5R E;  2IPA A;  1RQM A;  5HFI A;  2HLS A;  1TOF A;  2OAD A;  6GST A;  3HY2 A;  3M3M A;  1E6B A;  5DCH A;  1TI3 A;  5ECL B;  3J7Y b;  1BYE A;  3FZ4 A;  3KM6 A;  2HNL A;  3IDV A;  4OD7 A;  3IA1 A;  4NXI A;  2PVQ A;  1ACV A;  2R37 A;  4V2M A;  2H73 A;  1XVW A;  3FR9 A;  1RW1 A;  1J08 A;  3GKK A;  4EF0 A;  4MPG A;  3DVX A;  1U6T A;  5LCZ A;  5A5K A;  5B6M A;  2EIR A;  3QAW A;  5ABR A;  2XC2 A;  3M8N A;  2QC7 A;  5IOW A;  3F6D A;  4FO5 A;  4XS1 A;  3UEM A;  4LLR A;  4TR1 B;  3F4S A;  1NSW A;  1N2A A;  4CDO A;  3Q74 A;  1ZOF A;  4EXJ A;  3F4T A;  1DSB A;  3HJO A;  14GS A;  4FYU A;  2CZ3 A;  4E8E A;  3WT1 A;  3LXT A;  3IE3 A;  4E8H A;  5F0G A;  1ERT A;  4DEJ A;  3CSH A;  3VWV A;  5DAK B;  3GHA A;  1PX6 A;  2GQL A;  1BAY A;  1THO A;  1WIK A;  5G5E A;  1XWK A;  1DUG A;  4DVC A;  2YAN A;  1TK5 B;  4I8B A;  2CAQ A;  2N5F A;  2B7K A;  1KBN A;  5DQY A;  5HR0 A;  5ID2 A;  2H1B A;  3MSZ A;  1JZO A;  4IBP A;  4IJI A;  1PKZ A;  20GS A;  4TXV A;  1W4V A;  1KTE A;  3GUS A;  4MMM A;  2WS2 A;  3E9J B;  5DAL B;  2LS5 A;  2V6O A;  1F9M A;  1GNW A;  3Q6O A;  4OFM A;  2Z9S A;  5B7C A;  2CX3 A;  4IEL A;  4MAB A;  3HJM A;  2F8A A;  3UL3 A;  2CVB A;  1XPV A;  1EP8 A;  2OJL A;  2TIR A;  3HYP A;  1SL2 B;  2FUG 2;  3TKR A;  3BOA A;  3CYN A;  2DJ1 A;  1SL0 B;  1GSD A;  1T1V A;  2GT6 A;  4XHM A;  1K0C A;  1GLQ A;  1OC9 A;  3F63 A;  2C0F A;  5IMV A;  2DIZ A;  3QFA C;  1TRV A;  3TKS C;  5ENU A;  4MF6 A;  4FH8 A;  3W6G A;  3H93 A;  1OE8 A;  3UBL A;  1A8Y A;  4MJB A;  1F3B A;  1BQ7 A;  1XCC A;  3FK8 A;  4K6X A;  1XWG A;  2LUS A;  2LQQ A;  5CYY A;  2JU5 A;  1AQX A;  4PUA A;  3WD6 A;  5EY6 A;  5IPG A;  1B9Y C;  3KTB A;  2VAF A;  1DE2 A;  3VPQ A;  4MA9 A;  4JU5 A;  4MDC A;  5CNW A;  5HR2 A;  4NAX A;  1FVK A;  5KN2 A;  2YWN A;  5GAP D;  3M1G A;  1MD3 A;  2R2J A;  2OE0 A;  2VD1 A;  1QGV A;  1U88 A;  3MDK A;  3BJ5 A;  4LMV A;  1ML6 A;  2WGR A;  3ERF A;  4WET A;  4Z7X A;  2IMF A;  3PGT A;  4KSO A;  3GYK A;  5D9X A;  3C8E A;  1PRX A;  3A5W A;  2B7J A;  1PKW A;  4BWS A;  1VF3 A;  4L5O A;  2ON5 A;  3G7J A;  4MF5 A;  1MDJ A;  1DBY A;  5H5Q A;  2H30 A;  1EWX A;  1XOB A;  3G7I A;  3I9V 2;  3H79 A;  1O8X A;  2YCD A;  19GS A;  2X64 A;  3LGC A;  1XOA A;  3UMA A;  2GSS A;  2YWI A;  1F3A A;  1THX A;  2KUC A;  1OE7 A;  1OKD A;  1SD9 A;  4ZL7 A;  1A2J A;  3HVX A;  22GS A;  3EIN A;  1EGO A;  4KND A;  4TOP A;  2H01 A;  4XTS A;  3GNJ A;  5ECN B;  3CSJ A;  3S9F A;  4L0W A;  3IRA A;  4RI6 A;  1TRU A;  3GTU A;  2O7K A;  1USB A;  3NIV A;  2DSA A;  1OAZ A;  3FW2 A;  4KW6 A;  3UAR A;  2BTO T;  2LTK A;  4GXZ A;  2KOK A;  4YQM A;  5CRW A;  8GSS A;  2L5L A;  2XBI A;  4KUN A;  3TJF A;  3I69 A;  4ZL9 A;  3QR6 A;  4PNF A;  2HZE B;  3FYG A;  3D5J A;  4TN8 A;  3ZIJ A;  2MMN A;  2B3S A;  4PQ1 A;  1DE1 A;  2J9H A;  4GWR A;  1M2A A;  1B9X C;  1Z6M A;  4Q5R A;  4MZW A;  5CP1 A;  1H4O A;  2N5B A;  2WCI A;  1SKS B;  4QL9 A;  4POM A;  1I5G A;  12GS A;  5J3R A;  2HZF A;  2IFQ A;  5COH A;  2PMT A;  3DIE A;  5FWG A;  4XIH A;  2BMX A;  7GSS A;  4ZBB A;  2DJJ A;  1XWA A;  3DWV A;  6GSW A;  2H71 A;  3HJP A;  2DLX A;  1XW9 A;  4F0C A;  1F6M C;  2I3Y A;  3MNG A;  3CRU A;  2L6C A;  5AGY A;  2GQM A;  4J2F A;  1GH2 A;  2X8C A;  5JWO B;  2OBK A;  3A2X A;  2B5E A;  4ML1 A;  3V1W A;  1XZO A;  4XS4 A;  4KCE A;  4HZ2 A;  4MZC A;  1A23 A;  4PXO A;  3P8W A;  5A4U A;  4YAV A;  1XBS A;  1PD2 1;  1EV4 A;  3HCZ A;  2ZNM A;  2HT9 A;  2RII A;  2C0E A;  3RPN A;  3TJG A;  4XCS A;  2MBS A;  1B4P A;  1LBK A;  2V1M A;  5H5S A;  16GS A;  3GH6 A;  1PL1 A;  5A4V A;  1TP9 A;  2IME A;  1VF2 A;  1BG5 A;  4JRR A;  5JWQ B;  2R4V A;  3KZQ A;  2GZP A;  4AF2 A;  3NZN A;  2H0H A;  1Q4J A;  2DJ3 A;  3QMX A;  4HQZ A;  3DD3 A;  2DMM A;  1PSQ A;  4GF0 A;  4GRF A;  1M0U A;  5KN0 A;  5ELG A;  4WR5 A;  1O81 A;  5G2Z A;  2VM2 A;  4NV5 A;  1SYR A;  1PN9 A;  1SU9 A;  3KMN A;  2FWF A;  2R5G A;  4DSR A;  3W8J A;  4IJ3 A;  4G2E A;  4OO4 A;  5G1L A;  2V32 A;  2CZ2 A;  4EDZ A;  6GSV A;  4ISD A;  2P5R A;  3F8U A;  2JZT A;  3FZA A;  4K7N A;  1K0D A;  4K0G A;  2TRC P;  5FHI A;  3O3T A;  3RHC A;  4EKZ A;  2VM1 A;  4MJC A;  1GL8 A;  2VIM A;  3D6I A;  3QOU A;  4HJ2 A;  4YAP A;  4XS6 A;  1Z9H A;  1JZD A;  3ZIT A;  18GS A;  3ZRE A;  2RUF A;  4RI7 A;  6GSX A;  3SWL A;  1AW9 A;  2WB9 A;  3WGE A;  1GLP A;  2H1A A;  1YF1 A;  2V41 A;  4PUF C;  1KNG A;  2RM6 A;  4H86 A;  3OR5 A;  1TK8 B;  1SK0 A;  4MJE A;  1ERU A;  3DEX A;  3ME7 A;  4HDE A;  1F37 A;  3RPP A;  2E7P A;  3GKX A;  2O87 A;  3HDC A;  2H6X A;  1FB0 A;  4ULX A;  1TK0 B;  4TW5 A;  5HR1 A;  4IHU A;  1T7P B;  2QKE A;  1O73 A;  3DRN A;  3W8S A;  1A8L A;  1N8J A;  2FWE A;  4NPB A;  1V98 A;  5J9C A;  3IAS 2;  4ML6 A;  2K18 A;  1M7T A;  2IJY A;  5ECS A;  6GSU A;  2HFD A;  1EV9 A;  1EEM A;  2VL2 A;  1HNC A;  1O7U A;  4ACS A;  6GSY A;  1I9D A;  1K3L A;  4MCU A;  3IC4 A;  1A0F A;  3IPZ A;  5ECK B;  2A2R A;  4EE0 A;  4ZBD A;  3L78 A;  3ME8 A;  2GZZ A;  1G6W A;  3VUR A;  2YV7 A;  1ON4 A;  4WBJ A;  2O89 A;  1FHE A;  5EVO A;  1A24 A;  2PUK C;  3C1R A;  3HZ4 A;  3L9V A;  5GZZ B;  1M99 A;  1V2A A;  3EE2 A;  5LD0 A;  4K8M A;  3TJK A;  1TU8 A;  3G7Y A;  2VCV A;  4N11 A;  1JZR A;  3L9S A;  3RDW A;  2AAW A;  1QXH A;  5E59 A;  3ZML A;  2N5A A;  5ID2 B;  2VL9 A;  1FOV A;  2PPT A;  3G9B A;  2H0I A;  4NHW A;  3CSI A;  4EC0 A;  1Z6N A;  3GST A;  4HU9 A;  5CRH A;  3BD2 A;  1VGL A;  4TR1 A;  1KEB A;  1OVN A;  2GT5 A;  4LA1 A;  1X9S B;  4ECC A;  1R26 A;  4POB A;  4PNG A;  2MMA A;  2JSZ A;  1SL1 B;  3WGX A;  4HOJ A;  2P0G A;  2I9H A;  1Q98 A;  5CRG A;  2AB6 A;  2ALB A;  5DAK A;  1EEJ A;  1GTA A;  3KTL A;  5JCW A;  3MAK A;  5D96 A;  1PMT A;  5HR3 A;  5LNK e;  4AGS A;  1HQO A;  1RK4 A;  1GNE A;  4IP6 A;  1W89 A;  1G7E A;  2RM5 A;  4KDY A;  3AY8 A;  4MZB A;  4TRX A;  2VLT A;  4K0N A;  4WR4 A;  2WFC A;  4GSN A;  3M0F A;  3KEB A;  4JR4 A;  3LWA A;  2C0D A;  2YOI A;  5CO3 A;  1YKA A;  5DAL A;  1V40 A;  3ISO A;  2RUE A;  2X8H A;  2FWH A;  1ZMA A;  3ZL5 A;  1SJI A;  4K7I A;  4N0Z A;  5EPF A;  4X0X A;  2V6K A;  1GTB A;  3CMI A;  1O6J A;  2K6V A;  4WKW A;  1K0B A;  5AIV A;  3LSZ A;  3P90 A;  2YP6 A;  5AIX A;  1GTU A;  4IGJ A;  2M46 A;  4J57 E;  3F4R A;  5F06 A;  2L4Q A;  2JZR A;  2L59 A;  3TKP A;  2G2Q A;  2H66 A;  3FEU A;  3Q18 A;  9GSS A;  1GSU A;  3QDN A;  1MD4 A;  1BED A;  1EGR A;  4Q5Q A;  2PWJ A;  3LYK A;  1U3I A;  2HE3 A;  1HYU A;  1ZCP A;  2HYX A;  1WPI A;  1SKR B;  4HUA A;  4CHS A;  3FY7 A;  4F9Z A;  4HQS A;  3F6F A;  2KHP A;  2MMZ A;  1SYX A;  1SJZ A;  2HXK A;  4KSM A;  3TJB A;  1QUW A;  3KH9 A;  3C1S A;  4X1U A;  1WMJ A;  3FKF A;  3IK7 A;  4O5R A;  3TKQ A;  3IAM 2;  1K0A A;  2F9S A;  3DXB A;  1PX7 A;  3KH7 A;  4OCE A;  1SK1 A;  3ZMK A;  1C72 A;  2NDO A;  5D93 A;  4RUV A;  2CQ9 A;  2GTU A;  4ZBA A;  2EIO A;  1EOH A;  1T00 A;  3WT2 A;  1GSQ A;  2B1L A;  2FNO A;  4FYC A;  4WF4 A;  1SJ6 A;  1Y25 A;  2DJK A;  3BCK A;  2AV4 A;  1K0M A;  2H72 A;  2H74 A;  1G7O A;  3KIJ A;  3GTU B;  3ZZX A;  2BJX A;  3L4N A;  4QL7 A;  3TOU A;  4K7O A;  1X9M B;  1CQG A;  2NTO A;  2VCQ A;  1TJD A;  1T4Z A;  3HXS A;  3APS A;  3HVS A;  1B8X A;  3N5O A;  2LRT A;  4Q5F A;  4F82 A;  4KDU A;  2FGX A;  1GUL A;  3HZ8 A;  5J5N A;  2I4A A;  1Z7R A;  1GTI A;  1U87 A;  3APO A;  4KAE A;  2C4J A;  4KE3 A;  3ZLP A;  3EU3 A;  5DJM A;  3I6A A;  4ZB9 A;  1O8W A;  1B48 A;  1GUH A;  1K3Y A;  1GSS A;  3ZIV A;  4D73 A;  2WZ9 A;  5HFK A;  4TKY A;  2YN1 A;  2IWT A;  2GDR A;  2NPB A;  4GQC A;  2F51 A;  1G0T A;  1ST9 A;  1FW1 A;  3ZYW A;  3HKR A;  2XBQ A;  5AN1 A;  2VCW A;  3FRC A;  5KN1 A;  2M80 A;  1AUC A;  2JL4 A;  4PGT A;  4QQ7 A;  2OAC A;  1AXD A;  5IO2 A;  1FVJ A;  4EL1 A;  3M9J A;  1CQH A;  5HQP A;  5CRD A;  1V57 A;  2LJR A;  5KN3 A;  4TR0 A;  1ABA A;  3PH9 A;  4KGI A;  3VWX A;  4BPY A;  4ID0 A;  4XS4 B;  5ECQ B;  1A2L A;  4OFN A;  1H75 A;  2AUV A;  4ZIL A;  3FZ5 A;  3VWW A;  1VF4 A;  4NWY A;  1NHO A;  4NHZ A;  5A4W A;  2GSQ A;  3GX0 A;  3K8N A;  5D9W A;  2LNT A;  2RLI A;  1XVQ A;  2FWG A;  5EL8 A;  2EIQ A;  4MK3 A;  2WJU A;  1URM A;  2H19 A;  5DDL A;  2JZS A;  2B5X A;  4PQI A;  3TUE A;  4BVX A;  4OCF A;  1M2D A;  5D9T A;  1PL2 A;  1TRS A;  3DGQ A;  4G19 A;  2IMD A;  4I6X A;  3TDG A;  3KJY A;  1XIY A;  5J41 A;  4IS0 A;  2HRF A;  1S3D A;  1M9A A;  4EDY A;  4EVM A;  2C3Q A;  3ZFL A;  1GSF A;  4FYB A;  4I5Q A;  4K2D A;  1R5A A;  3VK9 A;  4LMW A;  2YJH A;  1ZGN A;  4JR6 A;  3GKN A;  4GQF A;  4BA7 A;  4ZB8 A;  3MWH A;  3US3 A;  3APQ A;  3U6V A;  3R2Q A;  1SKW B;  1TKD B;  2VL2 C;  1X9W B;  1XXU A;  2X99 A;  4ECB A;  4JED A;  2L6D A;  5DCG A;  2L4C A;  1R7H A;  3IV4 A;  2PN8 A;  3FR6 A;  4HJM A;  1VRS D;  2ZCT A;  1GP1 A;  4TXO B;  2DJ0 A;  1E2Y A;  2H1G A;  2YZH A;  2H1D A;  2LRN A;  2PVO C;  4ILF A;  2M72 A;  4HU7 A;  1AAZ A;  4GCI A;  3KXO A;  2H6Z A;  2GGT A;  2E0Q A;  1LJR A;  2C80 A;  4OO5 A;  4J56 E;  1O85 A;  1YQ1 A;  1FO5 A;  2JAD A;  4POL A;  1HNA A;  3SBC A; 
#chains in the Genus database with same CATH topology
 1X0R A;  1MEK A;  4AJ8 A;  3ZRD A;  2HSM A;  4KA0 A;  1AQV A;  3IXR A;  4PUR A;  3FR3 A;  3EU4 A;  1M9B A;  5DVB A;  2VCT A;  4N30 A;  1MTC A;  2HRK A;  4FQU A;  3TOT A;  5GSS A;  2X49 A;  5HFG A;  3IOS A;  1X5D A;  3ED3 A;  1FB6 A;  5G30 A;  5CAX A;  1J0F A;  1JLW A;  2HSY A;  4KDX A;  2B5Y A;  2QA1 A;  2NBS A;  2YPM A;  1U3A A;  3GRX A;  5IMZ A;  4N0V A;  2OE3 A;  2LJK A;  2H8L A;  2CVK A;  4MH3 A;  4WBR D;  3QFB C;  4DSS A;  1FG4 A;  2OKA A;  2IMI A;  2MMO A;  2C3N A;  3LQ7 A;  3GN3 A;  1TU7 A;  1T3B A;  3FZ9 A;  3EYT A;  3WYW A;  3CBU A;  2AYT A;  2VD0 A;  2VLV A;  3GIX A;  1F2E A;  1QK8 A;  3ERG A;  1WOU A;  3EMP A;  1XWB A;  2YJ7 A;  3VWU A;  1X5E A;  3TRP A;  5ECI B;  2MBT A;  4G10 A;  1AQW A;  5B6N A;  2VO4 A;  3IBH A;  3UVT A;  3CXG A;  11GS A;  5DQS A;  1ERV A;  1R5P A;  2NVL A;  3KMO A;  4FIW A;  1UA5 A;  3H8Q A;  2REM A;  2DIY A;  2J23 A;  3N9J A;  3UJ1 A;  2IMK A;  2AHE A;  3I43 A;  1ZYN A;  4IW9 A;  3GKM A;  1UVZ A;  2H75 A;  5KEJ A;  5C04 A;  5GAN D;  1TDI A;  1EOG A;  2HRN A;  2PBJ A;  4YQV A;  2L5O A;  5C00 A;  3GSS A;  4EIP A;  2FLS A;  3TCO A;  1MDK A;  2YNX A;  1K0N A;  3TRQ A;  4Q5N A;  4MF7 A;  5D73 A;  4K9Z A;  5G31 A;  5JWR B;  1NW2 A;  3GL5 A;  3LXZ A;  5J9B A;  1YEX A;  3P7X A;  2PGT A;  3E0U A;  1T4Y A;  3GMF A;  2UZ8 A;  1NHY A;  2P31 A;  1A2M A;  3D22 A;  1M3I A;  5DBQ A;  1YKC A;  3LEF A;  4LL1 B;  3UOM A;  4MJA A;  2O8V B;  4MPF A;  3BCI A;  5ECO B;  2YWM A;  1M2B A;  2YWO A;  2I1U A;  1R4W A;  1YDK A;  2GST A;  4Z2U A;  4PQH A;  3KP8 A;  1MDI A;  1XFL A;  1IYI A;  5INY A;  2FY6 A;  1OC9 B;  2ES7 A;  4OMV A;  4V2N A;  1K0O A;  1S3C A;  1V58 A;  2CVD A;  2LRC A;  2X8G A;  3QPM A;  1TRW A;  1YF0 A;  3GH9 A;  2E2M A;  5GST A;  5ECM B;  3HVN A;  4JZQ A;  1PA3 A;  1HD2 A;  3EUR A;  2QGV A;  4PX1 A;  6GSS A;  2R6K A;  5E4W A;  1G6Y A;  5H5R A;  3QCP A;  3L9U A;  2R0P A;  1S3A A;  3EPT A;  2XPD A;  1JHB A;  3J7Y k;  1LU4 A;  3GA4 A;  3QAV A;  1A0R P;  3HD5 A;  1ZZY A;  4RQX A;  1WWJ A;  4XRA A;  1WE0 A;  1AC1 A;  2H76 A;  2DC5 A;  3D4M A;  5D9V A;  2L57 A;  2VCX A;  4HI7 A;  5ECH B;  4V1A p;  4V1A g;  5FT3 A;  4K5R A;  1ILO A;  4KCA A;  1X5C A;  4WF5 A;  5G5F A;  4YQU A;  3TKS E;  3UBK A;  5IO0 A;  1FAA A;  4GST A;  4YKG A;  2HRA A;  4IVF A;  2MYG A;  2GVP A;  1TTZ A;  1AIU A;  3F3Q A;  3P2A A;  3UVH A;  2A2P A;  2YZU A;  4DSQ A;  1SD8 A;  2LEG A;  1Z5Y E;  1WJK A;  4F2I A;  2LKU A;  3H1N A;  1YY7 A;  3A3T A;  1Y6E A;  2FHE A;  3DML A;  5JCU A;  5DJL A;  4PTS A;  1XG8 A;  4I2U A;  4G9H A;  3GV1 A;  4O32 A;  3VPT A;  2P5Q A;  3NOF A;  1GSE A;  3VI5 A;  3D4T A;  1PQN A;  3VLN A;  2C8U A;  1JFU A;  2FD3 A;  1JLV A;  2E2G A;  2LNS A;  1OC3 A;  3EMX A;  2EC4 A;  1TXX A;  2V2G A;  2FCH A;  4IN0 A;  1WP0 A;  1J9B A;  1SK2 A;  2XPE A;  3R3E A;  2GZY A;  2GLR A;  4I2T A;  1QMV A;  3Q19 A;  5JCG A;  2H70 A;  4WXT A;  1NM3 A;  2H6Y A;  3DYR A;  4JBB A;  2GSR A;  3EWL A;  4D73 B;  2CX4 A;  4NMU A;  3TKS A;  2DML A;  3DKS A;  4ECJ A;  2CA8 A;  4HS1 A;  1GUK A;  4OFT A;  2CT6 A;  2PER A;  2LQO A;  17GS A;  3LOR A;  4ZXG A;  5IQY A;  1IYH A;  2DBC A;  1TI1 A;  4TR3 A;  4F0B A;  3H4K A;  5G1K A;  2IFQ B;  4I97 A;  4HEA 2;  2C1Y A;  2K8S A;  13GS A;  4G0I A;  1YJ6 A;  2IN3 A;  4YH2 A;  2R3X A;  4HZ4 A;  4N10 A;  2QSI A;  4V2L A;  5IMC A;  3VFI A;  2VUP A;  3RHB A;  3EVI A;  5D8I A;  3EC3 A;  3HHV A;  2C0G A;  3GX8 A;  1SEN A;  2LJA A;  2WUL A;  5F07 A;  1JZW A;  4L0U A;  2HZE A;  5AIS A;  1B4Q A;  2WRT A;  1YEP A;  1ZYQ B;  2GQK A;  1GRX A;  2LV3 A;  5F8B A;  1Z7P A;  2XHF A;  2VOC A;  2KP2 A;  2A4V A;  3LG6 A;  2O85 A;  4KH7 A;  4AJ6 A;  4EO3 A;  5IPH A;  4LL4 B;  1UN2 A;  2GS3 A;  3C7M A;  2CV4 A;  2K8V A;  2MZC A;  3O6T A;  5J4U A;  3VI7 A;  1EZK A;  3GUR A;  4BVY A;  2QA2 A;  4L8E A;  5KOW A;  4ZB6 A;  2ZUP A;  4ZIJ A;  4X43 A;  2IL3 A;  3LJR A;  1HNB A;  4WEY A;  4ZL8 A;  5IMD A;  3F0I A;  3F9U A;  3KP9 A;  4BL7 A;  3IK9 A;  4KB3 A;  5B8B A;  2B6M A;  1BX9 A;  3D21 A;  1QQ2 A;  2VCZ A;  4BWQ A;  3BBY A;  2A2S A;  4RQR A;  5IMF A;  4IQ1 A;  1VF1 A;  4KX4 A;  4MH2 A;  3C71 A;  4O92 A;  2HSH A;  1V9W A;  1UC7 A;  2B1K A;  2OA7 A;  1WRY A;  4F03 A;  1ZL9 A;  4X4J A;  1OC8 A;  2AJQ B;  3ZVJ D;  5IOX A;  2F8F A;  5ECR B;  4IQA A;  3MYD A;  2D2Z A;  3TGZ A;  3E3E A;  1GSY A;  2F3M A;  2ON7 A;  2I81 A;  4OWY A;  3ZVJ A;  3KGK A;  2K9F A;  5IM9 A;  3O76 A;  2PU9 C;  2YV9 A;  3QD9 A;  3UAP A;  2JAC A;  3KCM A;  2DJ2 A;  5CRE A;  3QAG A;  3FHK A;  3RBT A;  3RAZ A;  2VL3 A;  3D0Z A;  4EUY A;  3ZFB A;  1K3O A;  1PN0 A;  2IIY A;  3KD0 A;  5F05 A;  2OE1 A;  4K1F A;  4TR4 A;  3M9K A;  3PR8 A;  1XW5 A;  1XW6 A;  2KLX A;  3CQF A;  3PIN A;  1XWC A;  3TRX A;  3TJJ A;  2JSY A;  2LST A;  3IR4 A;  1GUM A;  3HVV A;  3LFL A;  10GS A;  3A2W A;  2FA8 A;  3CRT A;  4TXO A;  1QFN A;  2KP1 A;  5ECP B;  1BJX A;  2CAI A;  3LYP A;  3WGD A;  2G0F A;  1ZYP A;  2WDU A;  2H0G A;  1YZX A;  4O7H A;  4IP1 A;  1EP7 A;  4GSS A;  4XRD A;  4JE1 A;  5IIZ A;  2HI7 A;  4P3Y B;  2OBI A;  5ELA A;  5IMA A;  4POK A;  2VLU A;  3GL3 A;  4MP4 A;  4ECI A;  3ERW A;  1ZYE A;  3A2V A;  4DSS B;  1PGT A;  3DVW A;  2C3T A;  1OYJ A;  1OKT A;  3F3R A;  4TVE A;  3HA9 A;  3CTG A;  5B8A A;  2TRX A;  3UIW A;  4L5L A;  4IKH A;  3ZTL A;  4MLY A;  3CTF A;  4GTU A;  4Z2T A;  1ERW A;  3GFK A;  4GLT A;  3JCM L;  2FA4 A;  5L71 A;  3L0H A;  3C73 A;  4CW9 A;  1GWC A;  1TW9 A;  3TB2 A;  4NV2 A;  1T8E B;  1Z3E A;  4AJ7 A;  3IHQ A;  3U5R E;  2IPA A;  1RQM A;  5HFI A;  2HLS A;  1TOF A;  2OAD A;  6GST A;  3HY2 A;  3M3M A;  1E6B A;  5DCH A;  1TI3 A;  5ECL B;  3J7Y b;  1BYE A;  3FZ4 A;  3KM6 A;  4USS A;  2HNL A;  3IDV A;  4OD7 A;  3IA1 A;  4CY8 A;  4NXI A;  2PVQ A;  1ACV A;  2R37 A;  4V2M A;  2H73 A;  1XVW A;  3FR9 A;  1RW1 A;  1J08 A;  3GKK A;  4EF0 A;  4MPG A;  3DVX A;  1U6T A;  5LCZ A;  5A5K A;  5B6M A;  2EIR A;  3QAW A;  5ABR A;  2XC2 A;  3M8N A;  2QC7 A;  5IOW A;  3F6D A;  4FO5 A;  4XS1 A;  3UEM A;  4LLR A;  4TR1 B;  3F4S A;  1NSW A;  1N2A A;  4CDO A;  3Q74 A;  1ZOF A;  4EXJ A;  3F4T A;  1DSB A;  3HJO A;  14GS A;  2R0C A;  4FYU A;  2CZ3 A;  4E8E A;  3WT1 A;  3LXT A;  3IE3 A;  4E8H A;  5F0G A;  1ERT A;  4DEJ A;  3CSH A;  3VWV A;  5DAK B;  3GHA A;  1PX6 A;  2GQL A;  1BAY A;  1THO A;  1WIK A;  5G5E A;  1XWK A;  1DUG A;  4DVC A;  2YAN A;  1TK5 B;  4I8B A;  2CAQ A;  2N5F A;  2B7K A;  1KBN A;  5DQY A;  5HR0 A;  5ID2 A;  2H1B A;  3MSZ A;  1JZO A;  4IBP A;  4IJI A;  1PKZ A;  20GS A;  4TXV A;  1W4V A;  1KTE A;  3GUS A;  4MMM A;  2WS2 A;  3E9J B;  5DAL B;  2LS5 A;  2V6O A;  1F9M A;  1GNW A;  3Q6O A;  4Z2R A;  4OFM A;  2Z9S A;  5B7C A;  2CX3 A;  4IEL A;  4MAB A;  3HJM A;  2F8A A;  3UL3 A;  2CVB A;  1XPV A;  1EP8 A;  2OJL A;  2TIR A;  3HYP A;  1SL2 B;  2FUG 2;  3TKR A;  3BOA A;  3CYN A;  2DJ1 A;  1SL0 B;  1GSD A;  1T1V A;  2GT6 A;  4XHM A;  1K0C A;  1GLQ A;  1OC9 A;  3F63 A;  3LW9 A;  2C0F A;  5IMV A;  2DIZ A;  3QFA C;  1TRV A;  3TKS C;  5ENU A;  4MF6 A;  4FH8 A;  3W6G A;  3H93 A;  1OE8 A;  3UBL A;  2X4A A;  1A8Y A;  4MJB A;  1F3B A;  1BQ7 A;  1XCC A;  3FK8 A;  4K6X A;  1XWG A;  2LUS A;  2LQQ A;  5CYY A;  2JU5 A;  1AQX A;  4PUA A;  3WD6 A;  5EY6 A;  5IPG A;  1B9Y C;  3KTB A;  2VAF A;  1DE2 A;  3VPQ A;  4MA9 A;  4JU5 A;  4MDC A;  5CNW A;  5HR2 A;  4NAX A;  1FVK A;  5KN2 A;  2YWN A;  5GAP D;  3M1G A;  1MD3 A;  2R2J A;  2OE0 A;  2VD1 A;  1QGV A;  1U88 A;  3MDK A;  3BJ5 A;  4LMV A;  1ML6 A;  2WGR A;  3ERF A;  4WET A;  4Z7X A;  4A5P A;  2IMF A;  3PGT A;  4KSO A;  3GYK A;  5D9X A;  3C8E A;  1PRX A;  3A5W A;  2B7J A;  1PKW A;  4BWS A;  1VF3 A;  4L5O A;  2ON5 A;  3G7J A;  4MF5 A;  1MDJ A;  1DBY A;  5H5Q A;  2H30 A;  1EWX A;  1XOB A;  3G7I A;  3I9V 2;  4K5S A;  3H79 A;  1O8X A;  2YCD A;  19GS A;  2X64 A;  3LGC A;  1XOA A;  3UMA A;  2GSS A;  2YWI A;  1F3A A;  1THX A;  2KUC A;  1OE7 A;  1OKD A;  1SD9 A;  4ZL7 A;  1A2J A;  3HVX A;  22GS A;  3EIN A;  4ICY A;  1EGO A;  4KND A;  4TOP A;  2H01 A;  4XTS A;  3GNJ A;  5ECN B;  3CSJ A;  3S9F A;  4L0W A;  3IRA A;  4RI6 A;  1TRU A;  2R0G A;  3GTU A;  2O7K A;  1USB A;  3NIV A;  2DSA A;  1OAZ A;  3FW2 A;  4KW6 A;  3UAR A;  2BTO T;  2LTK A;  4GXZ A;  2KOK A;  4YQM A;  5CRW A;  8GSS A;  2L5L A;  2XBI A;  4KUN A;  3TJF A;  3I69 A;  4ZL9 A;  3QR6 A;  4PNF A;  2HZE B;  3FYG A;  3D5J A;  4TN8 A;  3ZIJ A;  2MMN A;  2B3S A;  4PQ1 A;  1DE1 A;  2J9H A;  4GWR A;  1M2A A;  1B9X C;  1Z6M A;  4Q5R A;  4MZW A;  5CP1 A;  1H4O A;  2N5B A;  2WCI A;  1SKS B;  4QL9 A;  4POM A;  1I5G A;  12GS A;  5J3R A;  2HZF A;  2IFQ A;  5COH A;  2PMT A;  2DKH A;  3DIE A;  5FWG A;  4XIH A;  2BMX A;  7GSS A;  3A5I A;  4ZBB A;  2DJJ A;  1XWA A;  3DWV A;  6GSW A;  2H71 A;  3HJP A;  2DLX A;  1XW9 A;  4F0C A;  1F6M C;  2I3Y A;  3MNG A;  3CRU A;  2L6C A;  4BVX B;  4CY6 A;  5AGY A;  2GQM A;  4J2F A;  1GH2 A;  2X8C A;  5JWO B;  2OBK A;  3A2X A;  1S3R A;  2B5E A;  4ML1 A;  3V1W A;  1XZO A;  4XS4 A;  4KCE A;  4HZ2 A;  4MNN A;  4MZC A;  1A23 A;  4PXO A;  3P8W A;  3PPU A;  4O5Q A;  5A4U A;  4YAV A;  1XBS A;  1PD2 1;  1EV4 A;  3HCZ A;  2ZNM A;  2HT9 A;  2RII A;  4K2X A;  2C0E A;  3RPN A;  3TJG A;  4XCS A;  2MBS A;  1B4P A;  1LBK A;  2V1M A;  5H5S A;  16GS A;  3GH6 A;  2A4H A;  1PL1 A;  5A4V A;  1TP9 A;  2IME A;  1VF2 A;  1BG5 A;  4JRR A;  5JWQ B;  2R4V A;  3KZQ A;  2GZP A;  4AF2 A;  3NZN A;  2H0H A;  1Q4J A;  2DJ3 A;  3QMX A;  4HQZ A;  3DD3 A;  2DMM A;  1PSQ A;  4GF0 A;  4GRF A;  1M0U A;  5KN0 A;  5ELG A;  4WR5 A;  1O81 A;  5G2Z A;  2VM2 A;  4NV5 A;  1SYR A;  1PN9 A;  1SU9 A;  3KMN A;  2FWF A;  2R5G A;  4DSR A;  3W8J A;  4IJ3 A;  4G2E A;  4OO4 A;  5G1L A;  2V32 A;  2CZ2 A;  4EDZ A;  6GSV A;  4ISD A;  2P5R A;  3F8U A;  2JZT A;  3FZA A;  4K7N A;  1K0D A;  4K0G A;  2TRC P;  5FHI A;  3O3T A;  3RHC A;  4EKZ A;  2VM1 A;  4MJC A;  1GL8 A;  2VIM A;  3D6I A;  3QOU A;  4HJ2 A;  4YAP A;  4XS6 A;  1Z9H A;  1JZD A;  3ZIT A;  18GS A;  3ZRE A;  2RUF A;  4RI7 A;  6GSX A;  3SWL A;  1AW9 A;  2WB9 A;  3WGE A;  1GLP A;  2H1A A;  1M3J A;  1YF1 A;  2V41 A;  4PUF C;  1KNG A;  2RM6 A;  4H86 A;  3OR5 A;  1TK8 B;  4YKF A;  1SK0 A;  4MJE A;  1ERU A;  3DEX A;  3ME7 A;  4HDE A;  1F37 A;  3RPP A;  2E7P A;  3GKX A;  2O87 A;  3HDC A;  2H6X A;  1FB0 A;  4ULX A;  1TK0 B;  4TW5 A;  5HR1 A;  4IHU A;  1T7P B;  2QKE A;  1O73 A;  3DRN A;  3W8S A;  1A8L A;  1N8J A;  2FWE A;  4NPB A;  1V98 A;  5J9C A;  3IAS 2;  1PFO A;  4ML6 A;  2K18 A;  1M7T A;  2IJY A;  5ECS A;  6GSU A;  2HFD A;  1EV9 A;  1EEM A;  2VL2 A;  1HNC A;  1O7U A;  4ACS A;  6GSY A;  1I9D A;  1K3L A;  4MCU A;  3IC4 A;  1A0F A;  3IPZ A;  5ECK B;  2A2R A;  4EE0 A;  4ZBD A;  3L78 A;  3ME8 A;  2GZZ A;  1G6W A;  3VUR A;  2YV7 A;  1ON4 A;  4WBJ A;  2O89 A;  1FHE A;  5EVO A;  1A24 A;  2PUK C;  3C1R A;  3HZ4 A;  3L9V A;  5GZZ B;  1M99 A;  1V2A A;  3EE2 A;  5LD0 A;  4K8M A;  3TJK A;  1TU8 A;  3G7Y A;  2VCV A;  4N11 A;  1JZR A;  3L9S A;  3RDW A;  2AAW A;  1QXH A;  5E59 A;  3ZML A;  2N5A A;  5ID2 B;  2VL9 A;  1FOV A;  2PPT A;  3G9B A;  2H0I A;  4NHW A;  3CSI A;  4EC0 A;  1Z6N A;  3GST A;  4HU9 A;  5CRH A;  3BD2 A;  1VGL A;  4TR1 A;  1KEB A;  1OVN A;  2GT5 A;  4LA1 A;  1X9S B;  4ECC A;  1R26 A;  4POB A;  4PNG A;  2MMA A;  2JSZ A;  1SL1 B;  3WGX A;  4HOJ A;  2P0G A;  2I9H A;  1Q98 A;  5CRG A;  2AB6 A;  2ALB A;  5DAK A;  1EEJ A;  1GTA A;  3KTL A;  5JCW A;  3MAK A;  5D96 A;  1PMT A;  5HR3 A;  5LNK e;  4AGS A;  1HQO A;  1RK4 A;  1GNE A;  4IP6 A;  1W89 A;  1G7E A;  3FMW A;  2RM5 A;  4KDY A;  3AY8 A;  4MZB A;  4TRX A;  2VLT A;  4K0N A;  4WR4 A;  2WFC A;  4GSN A;  3M0F A;  3KEB A;  4JR4 A;  3LWA A;  2C0D A;  2YOI A;  5CO3 A;  5KOX A;  1YKA A;  5DAL A;  1V40 A;  3ISO A;  2RUE A;  2X8H A;  2FWH A;  1ZMA A;  4O5U A;  3ZL5 A;  1SJI A;  4K7I A;  4N0Z A;  5EPF A;  4X0X A;  4EIQ A;  2V6K A;  1GTB A;  3CMI A;  1O6J A;  2K6V A;  4WKW A;  1K0B A;  5AIV A;  3LSZ A;  3P90 A;  2YP6 A;  5AIX A;  1GTU A;  4IGJ A;  2M46 A;  4J57 E;  3F4R A;  5F06 A;  2L4Q A;  2JZR A;  2L59 A;  3TKP A;  2G2Q A;  2H66 A;  3FEU A;  3Q18 A;  9GSS A;  1GSU A;  3QDN A;  1MD4 A;  1BED A;  1EGR A;  4Q5Q A;  2PWJ A;  3LYK A;  1U3I A;  2HE3 A;  1HYU A;  5BMU A;  1ZCP A;  2HYX A;  1WPI A;  1SKR B;  4HUA A;  4CHS A;  3FY7 A;  4F9Z A;  4HQS A;  3F6F A;  2KHP A;  2MMZ A;  4KF9 A;  1SYX A;  1SJZ A;  2HXK A;  4KSM A;  3TJB A;  1QUW A;  3KH9 A;  3C1S A;  4X1U A;  1WMJ A;  3FKF A;  3IK7 A;  4O5R A;  3TKQ A;  3IAM 2;  1K0A A;  2F9S A;  3DXB A;  1PX7 A;  3KH7 A;  4OCE A;  1SK1 A;  3ZMK A;  1C72 A;  2NDO A;  2DKI A;  5D93 A;  4RUV A;  2CQ9 A;  2GTU A;  4ZBA A;  2EIO A;  1EOH A;  1T00 A;  3WT2 A;  1GSQ A;  2B1L A;  2FNO A;  4FYC A;  4WF4 A;  1SJ6 A;  1Y25 A;  2DJK A;  3BCK A;  2AV4 A;  1K0M A;  2H72 A;  2H74 A;  1G7O A;  3KIJ A;  3IHG A;  3GTU B;  3ZZX A;  2BJX A;  3L4N A;  4QL7 A;  3TOU A;  4K7O A;  1X9M B;  1CQG A;  2NTO A;  2VCQ A;  1TJD A;  1T4Z A;  3HXS A;  3APS A;  3HVS A;  1B8X A;  3N5O A;  2LRT A;  4Q5F A;  4F82 A;  4KDU A;  2FGX A;  1GUL A;  3HZ8 A;  5J5N A;  2I4A A;  1Z7R A;  1GTI A;  1U87 A;  3MIX A;  3APO A;  4KAE A;  2C4J A;  4KE3 A;  3ZLP A;  3EU3 A;  5DJM A;  3I6A A;  4ZB9 A;  1O8W A;  1B48 A;  1GUH A;  1K3Y A;  1GSS A;  3ZIV A;  4D73 A;  2WZ9 A;  5HFK A;  4TKY A;  2YN1 A;  2IWT A;  2GDR A;  2NPB A;  4GQC A;  2F51 A;  5BRT A;  1G0T A;  1ST9 A;  1FW1 A;  3ZYW A;  3HKR A;  2XBQ A;  5AN1 A;  2VCW A;  3FRC A;  5KN1 A;  2M80 A;  1AUC A;  2JL4 A;  4BVY B;  4PGT A;  4QQ7 A;  2OAC A;  1AXD A;  5IO2 A;  1FVJ A;  4EL1 A;  3M9J A;  1CQH A;  5HQP A;  5CRD A;  1V57 A;  1FOH A;  2LJR A;  5KN3 A;  4BL7 B;  4TR0 A;  1ABA A;  3PH9 A;  4KGI A;  3VWX A;  4BPY A;  4ID0 A;  4XS4 B;  5ECQ B;  1A2L A;  4OFN A;  1H75 A;  2AUV A;  4ZIL A;  3FZ5 A;  3VWW A;  1VF4 A;  4NWY A;  1NHO A;  4NHZ A;  5A4W A;  2GSQ A;  3GX0 A;  3K8N A;  5D9W A;  2LNT A;  2RLI A;  1XVQ A;  2FWG A;  5EL8 A;  2EIQ A;  4MK3 A;  2WJU A;  1URM A;  2H19 A;  5DDL A;  2JZS A;  2B5X A;  4PQI A;  3TUE A;  4BVX A;  4OCF A;  1M2D A;  5D9T A;  1PL2 A;  1TRS A;  3DGQ A;  4G19 A;  2IMD A;  4I6X A;  3TDG A;  4G0L A;  3KJY A;  1XIY A;  5J41 A;  4IS0 A;  2HRF A;  1S3D A;  1M9A A;  4EDY A;  4EVM A;  2C3Q A;  3ZFL A;  1GSF A;  4FYB A;  4HSC X;  4I5Q A;  4K2D A;  1R5A A;  3VK9 A;  4LMW A;  2YJH A;  1ZGN A;  4JR6 A;  3GKN A;  4GQF A;  4BA7 A;  4ZB8 A;  3MWH A;  3US3 A;  3APQ A;  3U6V A;  3R2Q A;  1SKW B;  1TKD B;  2VL2 C;  1X9W B;  1XXU A;  2X99 A;  4ECB A;  4JED A;  2L6D A;  5DCG A;  2L4C A;  1R7H A;  3IV4 A;  2PN8 A;  3FR6 A;  4HJM A;  1VRS D;  2ZCT A;  1GP1 A;  4TXO B;  2DJ0 A;  1E2Y A;  2H1G A;  2YZH A;  4G0K A;  2H1D A;  2LRN A;  2PVO C;  4ILF A;  2M72 A;  4HU7 A;  3IC8 A;  1AAZ A;  4GCI A;  3KXO A;  2H6Z A;  4BIK A;  2GGT A;  2E0Q A;  1LJR A;  2C80 A;  4OO5 A;  4J56 E;  1O85 A;  1YQ1 A;  1FO5 A;  2JAD A;  4POL A;  1HNA A;  3SBC A; 
#chains in the Genus database with same CATH homology
 1X0R A;  1MEK A;  4AJ8 A;  3ZRD A;  2HSM A;  4KA0 A;  1AQV A;  3IXR A;  4PUR A;  3FR3 A;  3EU4 A;  1M9B A;  5DVB A;  2VCT A;  4N30 A;  1MTC A;  2HRK A;  4FQU A;  3TOT A;  5GSS A;  2X49 A;  5HFG A;  3IOS A;  1X5D A;  3ED3 A;  1FB6 A;  5G30 A;  5CAX A;  1J0F A;  1JLW A;  2HSY A;  4KDX A;  2B5Y A;  2QA1 A;  2NBS A;  2YPM A;  1U3A A;  3GRX A;  5IMZ A;  4N0V A;  2OE3 A;  2LJK A;  2H8L A;  2CVK A;  4MH3 A;  4WBR D;  3QFB C;  4DSS A;  1FG4 A;  2OKA A;  2IMI A;  2MMO A;  2C3N A;  3LQ7 A;  3GN3 A;  1TU7 A;  1T3B A;  3FZ9 A;  3EYT A;  3WYW A;  3CBU A;  2AYT A;  2VD0 A;  2VLV A;  3GIX A;  1F2E A;  1QK8 A;  3ERG A;  1WOU A;  3EMP A;  1XWB A;  2YJ7 A;  3VWU A;  1X5E A;  3TRP A;  5ECI B;  2MBT A;  4G10 A;  1AQW A;  5B6N A;  2VO4 A;  3IBH A;  3UVT A;  3CXG A;  11GS A;  5DQS A;  1ERV A;  1R5P A;  2NVL A;  3KMO A;  4FIW A;  1UA5 A;  3H8Q A;  2REM A;  2DIY A;  2J23 A;  3N9J A;  3UJ1 A;  2IMK A;  2AHE A;  3I43 A;  1ZYN A;  4IW9 A;  3GKM A;  1UVZ A;  2H75 A;  5KEJ A;  5C04 A;  5GAN D;  1TDI A;  1EOG A;  2HRN A;  2PBJ A;  4YQV A;  2L5O A;  5C00 A;  3GSS A;  4EIP A;  2FLS A;  3TCO A;  1MDK A;  2YNX A;  1K0N A;  3TRQ A;  4Q5N A;  4MF7 A;  5D73 A;  4K9Z A;  5G31 A;  5JWR B;  1NW2 A;  3GL5 A;  3LXZ A;  5J9B A;  1YEX A;  3P7X A;  2PGT A;  3E0U A;  1T4Y A;  3GMF A;  2UZ8 A;  1NHY A;  2P31 A;  1A2M A;  3D22 A;  5DBQ A;  1YKC A;  3LEF A;  4LL1 B;  3UOM A;  4MJA A;  2O8V B;  4MPF A;  3BCI A;  5ECO B;  2YWM A;  1M2B A;  2YWO A;  2I1U A;  1R4W A;  1YDK A;  2GST A;  4Z2U A;  4PQH A;  3KP8 A;  1MDI A;  1XFL A;  1IYI A;  5INY A;  2FY6 A;  1OC9 B;  2ES7 A;  4OMV A;  4V2N A;  1K0O A;  1S3C A;  1V58 A;  2CVD A;  2LRC A;  2X8G A;  3QPM A;  1TRW A;  1YF0 A;  3GH9 A;  2E2M A;  5GST A;  5ECM B;  4JZQ A;  1PA3 A;  1HD2 A;  3EUR A;  2QGV A;  4PX1 A;  6GSS A;  2R6K A;  5E4W A;  1G6Y A;  5H5R A;  3QCP A;  3L9U A;  2R0P A;  1S3A A;  3EPT A;  2XPD A;  1JHB A;  3J7Y k;  1LU4 A;  3GA4 A;  3QAV A;  1A0R P;  3HD5 A;  1ZZY A;  4RQX A;  1WWJ A;  4XRA A;  1WE0 A;  1AC1 A;  2H76 A;  2DC5 A;  3D4M A;  5D9V A;  2L57 A;  2VCX A;  4HI7 A;  5ECH B;  4V1A p;  4V1A g;  5FT3 A;  4K5R A;  1ILO A;  4KCA A;  1X5C A;  4WF5 A;  5G5F A;  4YQU A;  3TKS E;  3UBK A;  5IO0 A;  1FAA A;  4GST A;  4YKG A;  2HRA A;  4IVF A;  2MYG A;  2GVP A;  1TTZ A;  1AIU A;  3F3Q A;  3P2A A;  3UVH A;  2A2P A;  2YZU A;  4DSQ A;  1SD8 A;  2LEG A;  1Z5Y E;  1WJK A;  4F2I A;  2LKU A;  3H1N A;  1YY7 A;  3A3T A;  1Y6E A;  2FHE A;  3DML A;  5JCU A;  5DJL A;  4PTS A;  4I2U A;  4G9H A;  3GV1 A;  4O32 A;  3VPT A;  2P5Q A;  3NOF A;  1GSE A;  3VI5 A;  3D4T A;  1PQN A;  3VLN A;  2C8U A;  1JFU A;  2FD3 A;  1JLV A;  2E2G A;  2LNS A;  1OC3 A;  3EMX A;  2EC4 A;  1TXX A;  2V2G A;  2FCH A;  4IN0 A;  1WP0 A;  1J9B A;  1SK2 A;  2XPE A;  3R3E A;  2GZY A;  2GLR A;  4I2T A;  1QMV A;  3Q19 A;  5JCG A;  2H70 A;  4WXT A;  1NM3 A;  2H6Y A;  3DYR A;  4JBB A;  2GSR A;  3EWL A;  4D73 B;  2CX4 A;  4NMU A;  3TKS A;  2DML A;  3DKS A;  4ECJ A;  2CA8 A;  4HS1 A;  1GUK A;  4OFT A;  2CT6 A;  2PER A;  2LQO A;  17GS A;  3LOR A;  4ZXG A;  5IQY A;  1IYH A;  2DBC A;  1TI1 A;  4TR3 A;  4F0B A;  3H4K A;  5G1K A;  2IFQ B;  4I97 A;  4HEA 2;  2C1Y A;  2K8S A;  13GS A;  4G0I A;  1YJ6 A;  2IN3 A;  4YH2 A;  2R3X A;  4HZ4 A;  4N10 A;  2QSI A;  4V2L A;  5IMC A;  3VFI A;  2VUP A;  3RHB A;  3EVI A;  5D8I A;  3EC3 A;  3HHV A;  2C0G A;  3GX8 A;  1SEN A;  2LJA A;  2WUL A;  5F07 A;  1JZW A;  4L0U A;  2HZE A;  5AIS A;  1B4Q A;  2WRT A;  1YEP A;  1ZYQ B;  2GQK A;  1GRX A;  2LV3 A;  5F8B A;  1Z7P A;  2XHF A;  2VOC A;  2KP2 A;  2A4V A;  3LG6 A;  2O85 A;  4KH7 A;  4AJ6 A;  4EO3 A;  5IPH A;  4LL4 B;  1UN2 A;  2GS3 A;  3C7M A;  2CV4 A;  2K8V A;  2MZC A;  3O6T A;  5J4U A;  3VI7 A;  1EZK A;  3GUR A;  4BVY A;  2QA2 A;  4L8E A;  5KOW A;  4ZB6 A;  2ZUP A;  4ZIJ A;  4X43 A;  2IL3 A;  3LJR A;  1HNB A;  4WEY A;  4ZL8 A;  5IMD A;  3F0I A;  3F9U A;  3KP9 A;  4BL7 A;  3IK9 A;  4KB3 A;  5B8B A;  2B6M A;  1BX9 A;  3D21 A;  1QQ2 A;  2VCZ A;  4BWQ A;  3BBY A;  2A2S A;  4RQR A;  5IMF A;  4IQ1 A;  1VF1 A;  4KX4 A;  4MH2 A;  3C71 A;  4O92 A;  2HSH A;  1V9W A;  1UC7 A;  2B1K A;  2OA7 A;  1WRY A;  4F03 A;  1ZL9 A;  4X4J A;  1OC8 A;  2AJQ B;  3ZVJ D;  5IOX A;  2F8F A;  5ECR B;  4IQA A;  3MYD A;  2D2Z A;  3TGZ A;  3E3E A;  1GSY A;  2F3M A;  2ON7 A;  2I81 A;  4OWY A;  3ZVJ A;  3KGK A;  2K9F A;  5IM9 A;  3O76 A;  2PU9 C;  2YV9 A;  3QD9 A;  3UAP A;  2JAC A;  3KCM A;  2DJ2 A;  5CRE A;  3QAG A;  3FHK A;  3RBT A;  3RAZ A;  2VL3 A;  3D0Z A;  4EUY A;  3ZFB A;  1K3O A;  1PN0 A;  2IIY A;  3KD0 A;  5F05 A;  2OE1 A;  4K1F A;  4TR4 A;  3M9K A;  3PR8 A;  1XW5 A;  1XW6 A;  2KLX A;  3PIN A;  1XWC A;  3TRX A;  3TJJ A;  2JSY A;  2LST A;  3IR4 A;  1GUM A;  3HVV A;  3LFL A;  10GS A;  3A2W A;  2FA8 A;  3CRT A;  4TXO A;  1QFN A;  2KP1 A;  5ECP B;  1BJX A;  2CAI A;  3LYP A;  3WGD A;  2G0F A;  1ZYP A;  2WDU A;  2H0G A;  1YZX A;  4O7H A;  4IP1 A;  1EP7 A;  4GSS A;  4XRD A;  4JE1 A;  5IIZ A;  2HI7 A;  4P3Y B;  2OBI A;  5ELA A;  5IMA A;  4POK A;  2VLU A;  3GL3 A;  4MP4 A;  4ECI A;  3ERW A;  1ZYE A;  3A2V A;  4DSS B;  1PGT A;  3DVW A;  2C3T A;  1OYJ A;  1OKT A;  3F3R A;  4TVE A;  3HA9 A;  3CTG A;  5B8A A;  2TRX A;  3UIW A;  4L5L A;  4IKH A;  3ZTL A;  4MLY A;  3CTF A;  4GTU A;  4Z2T A;  1ERW A;  3GFK A;  4GLT A;  3JCM L;  2FA4 A;  5L71 A;  3L0H A;  3C73 A;  4CW9 A;  1GWC A;  1TW9 A;  3TB2 A;  4NV2 A;  1T8E B;  1Z3E A;  4AJ7 A;  3IHQ A;  3U5R E;  2IPA A;  1RQM A;  5HFI A;  2HLS A;  1TOF A;  2OAD A;  6GST A;  3HY2 A;  3M3M A;  1E6B A;  5DCH A;  1TI3 A;  5ECL B;  3J7Y b;  1BYE A;  3FZ4 A;  3KM6 A;  4USS A;  2HNL A;  3IDV A;  4OD7 A;  3IA1 A;  4CY8 A;  4NXI A;  2PVQ A;  1ACV A;  2R37 A;  4V2M A;  2H73 A;  1XVW A;  3FR9 A;  1RW1 A;  1J08 A;  3GKK A;  4EF0 A;  4MPG A;  3DVX A;  1U6T A;  5LCZ A;  5A5K A;  5B6M A;  2EIR A;  3QAW A;  5ABR A;  2XC2 A;  3M8N A;  2QC7 A;  5IOW A;  3F6D A;  4FO5 A;  4XS1 A;  3UEM A;  4LLR A;  4TR1 B;  3F4S A;  1NSW A;  1N2A A;  4CDO A;  3Q74 A;  1ZOF A;  4EXJ A;  3F4T A;  1DSB A;  3HJO A;  14GS A;  2R0C A;  4FYU A;  2CZ3 A;  4E8E A;  3WT1 A;  3LXT A;  3IE3 A;  4E8H A;  5F0G A;  1ERT A;  4DEJ A;  3CSH A;  3VWV A;  5DAK B;  3GHA A;  1PX6 A;  2GQL A;  1BAY A;  1THO A;  1WIK A;  5G5E A;  1XWK A;  1DUG A;  4DVC A;  2YAN A;  1TK5 B;  4I8B A;  2CAQ A;  2N5F A;  2B7K A;  1KBN A;  5DQY A;  5HR0 A;  5ID2 A;  2H1B A;  3MSZ A;  1JZO A;  4IBP A;  4IJI A;  1PKZ A;  20GS A;  4TXV A;  1W4V A;  1KTE A;  3GUS A;  4MMM A;  2WS2 A;  3E9J B;  5DAL B;  2LS5 A;  2V6O A;  1F9M A;  1GNW A;  3Q6O A;  4Z2R A;  4OFM A;  2Z9S A;  5B7C A;  2CX3 A;  4IEL A;  4MAB A;  3HJM A;  2F8A A;  3UL3 A;  2CVB A;  1XPV A;  1EP8 A;  2OJL A;  2TIR A;  3HYP A;  1SL2 B;  2FUG 2;  3TKR A;  3BOA A;  3CYN A;  2DJ1 A;  1SL0 B;  1GSD A;  1T1V A;  2GT6 A;  4XHM A;  1K0C A;  1GLQ A;  1OC9 A;  3F63 A;  3LW9 A;  2C0F A;  5IMV A;  2DIZ A;  3QFA C;  1TRV A;  3TKS C;  5ENU A;  4MF6 A;  4FH8 A;  3W6G A;  3H93 A;  1OE8 A;  3UBL A;  2X4A A;  1A8Y A;  4MJB A;  1F3B A;  1BQ7 A;  1XCC A;  3FK8 A;  4K6X A;  1XWG A;  2LUS A;  2LQQ A;  5CYY A;  2JU5 A;  1AQX A;  4PUA A;  3WD6 A;  5EY6 A;  5IPG A;  1B9Y C;  3KTB A;  2VAF A;  1DE2 A;  3VPQ A;  4MA9 A;  4JU5 A;  4MDC A;  5CNW A;  5HR2 A;  4NAX A;  1FVK A;  5KN2 A;  2YWN A;  5GAP D;  3M1G A;  1MD3 A;  2R2J A;  2OE0 A;  2VD1 A;  1QGV A;  1U88 A;  3MDK A;  3BJ5 A;  4LMV A;  1ML6 A;  2WGR A;  3ERF A;  4WET A;  4Z7X A;  4A5P A;  2IMF A;  3PGT A;  4KSO A;  3GYK A;  5D9X A;  3C8E A;  1PRX A;  3A5W A;  2B7J A;  1PKW A;  4BWS A;  1VF3 A;  4L5O A;  2ON5 A;  3G7J A;  4MF5 A;  1MDJ A;  1DBY A;  5H5Q A;  2H30 A;  1EWX A;  1XOB A;  3G7I A;  3I9V 2;  4K5S A;  3H79 A;  1O8X A;  2YCD A;  19GS A;  2X64 A;  3LGC A;  1XOA A;  3UMA A;  2GSS A;  2YWI A;  1F3A A;  1THX A;  2KUC A;  1OE7 A;  1OKD A;  1SD9 A;  4ZL7 A;  1A2J A;  3HVX A;  22GS A;  3EIN A;  4ICY A;  1EGO A;  4KND A;  4TOP A;  2H01 A;  4XTS A;  3GNJ A;  5ECN B;  3CSJ A;  3S9F A;  4L0W A;  3IRA A;  4RI6 A;  1TRU A;  2R0G A;  3GTU A;  2O7K A;  1USB A;  3NIV A;  2DSA A;  1OAZ A;  3FW2 A;  4KW6 A;  3UAR A;  2BTO T;  2LTK A;  4GXZ A;  2KOK A;  4YQM A;  5CRW A;  8GSS A;  2L5L A;  2XBI A;  4KUN A;  3TJF A;  3I69 A;  4ZL9 A;  3QR6 A;  4PNF A;  2HZE B;  3FYG A;  3D5J A;  4TN8 A;  3ZIJ A;  2MMN A;  2B3S A;  4PQ1 A;  1DE1 A;  2J9H A;  4GWR A;  1M2A A;  1B9X C;  1Z6M A;  4Q5R A;  4MZW A;  5CP1 A;  1H4O A;  2N5B A;  2WCI A;  1SKS B;  4QL9 A;  4POM A;  1I5G A;  12GS A;  5J3R A;  2HZF A;  2IFQ A;  5COH A;  2PMT A;  2DKH A;  3DIE A;  5FWG A;  4XIH A;  2BMX A;  7GSS A;  3A5I A;  4ZBB A;  2DJJ A;  1XWA A;  3DWV A;  6GSW A;  2H71 A;  3HJP A;  2DLX A;  1XW9 A;  4F0C A;  1F6M C;  2I3Y A;  3MNG A;  3CRU A;  2L6C A;  4BVX B;  4CY6 A;  5AGY A;  2GQM A;  4J2F A;  1GH2 A;  2X8C A;  5JWO B;  2OBK A;  3A2X A;  2B5E A;  4ML1 A;  3V1W A;  1XZO A;  4XS4 A;  4KCE A;  4HZ2 A;  4MNN A;  4MZC A;  1A23 A;  4PXO A;  3P8W A;  3PPU A;  4O5Q A;  5A4U A;  4YAV A;  1XBS A;  1PD2 1;  1EV4 A;  3HCZ A;  2ZNM A;  2HT9 A;  2RII A;  4K2X A;  2C0E A;  3RPN A;  3TJG A;  4XCS A;  2MBS A;  1B4P A;  1LBK A;  2V1M A;  5H5S A;  16GS A;  3GH6 A;  2A4H A;  1PL1 A;  5A4V A;  1TP9 A;  2IME A;  1VF2 A;  1BG5 A;  4JRR A;  5JWQ B;  2R4V A;  3KZQ A;  2GZP A;  4AF2 A;  3NZN A;  2H0H A;  1Q4J A;  2DJ3 A;  3QMX A;  4HQZ A;  3DD3 A;  2DMM A;  1PSQ A;  4GF0 A;  4GRF A;  1M0U A;  5KN0 A;  5ELG A;  4WR5 A;  1O81 A;  5G2Z A;  2VM2 A;  4NV5 A;  1SYR A;  1PN9 A;  1SU9 A;  3KMN A;  2FWF A;  2R5G A;  4DSR A;  3W8J A;  4IJ3 A;  4G2E A;  4OO4 A;  5G1L A;  2V32 A;  2CZ2 A;  4EDZ A;  6GSV A;  4ISD A;  2P5R A;  3F8U A;  2JZT A;  3FZA A;  4K7N A;  1K0D A;  4K0G A;  2TRC P;  5FHI A;  3O3T A;  3RHC A;  4EKZ A;  2VM1 A;  4MJC A;  1GL8 A;  2VIM A;  3D6I A;  3QOU A;  4HJ2 A;  4YAP A;  4XS6 A;  1Z9H A;  1JZD A;  3ZIT A;  18GS A;  3ZRE A;  2RUF A;  4RI7 A;  6GSX A;  3SWL A;  1AW9 A;  2WB9 A;  3WGE A;  1GLP A;  2H1A A;  1YF1 A;  2V41 A;  4PUF C;  1KNG A;  2RM6 A;  4H86 A;  3OR5 A;  1TK8 B;  4YKF A;  1SK0 A;  4MJE A;  1ERU A;  3DEX A;  3ME7 A;  4HDE A;  1F37 A;  3RPP A;  2E7P A;  3GKX A;  2O87 A;  3HDC A;  2H6X A;  1FB0 A;  4ULX A;  1TK0 B;  4TW5 A;  5HR1 A;  4IHU A;  1T7P B;  2QKE A;  1O73 A;  3DRN A;  3W8S A;  1A8L A;  1N8J A;  2FWE A;  4NPB A;  1V98 A;  5J9C A;  3IAS 2;  4ML6 A;  2K18 A;  1M7T A;  2IJY A;  5ECS A;  6GSU A;  2HFD A;  1EV9 A;  1EEM A;  2VL2 A;  1HNC A;  1O7U A;  4ACS A;  6GSY A;  1I9D A;  1K3L A;  4MCU A;  3IC4 A;  1A0F A;  3IPZ A;  5ECK B;  2A2R A;  4EE0 A;  4ZBD A;  3L78 A;  3ME8 A;  2GZZ A;  1G6W A;  3VUR A;  2YV7 A;  1ON4 A;  4WBJ A;  2O89 A;  1FHE A;  5EVO A;  1A24 A;  2PUK C;  3C1R A;  3HZ4 A;  3L9V A;  5GZZ B;  1M99 A;  1V2A A;  3EE2 A;  5LD0 A;  4K8M A;  3TJK A;  1TU8 A;  3G7Y A;  2VCV A;  4N11 A;  1JZR A;  3L9S A;  3RDW A;  2AAW A;  1QXH A;  5E59 A;  3ZML A;  2N5A A;  5ID2 B;  2VL9 A;  1FOV A;  2PPT A;  3G9B A;  2H0I A;  4NHW A;  3CSI A;  4EC0 A;  1Z6N A;  3GST A;  4HU9 A;  5CRH A;  3BD2 A;  1VGL A;  4TR1 A;  1KEB A;  1OVN A;  2GT5 A;  4LA1 A;  1X9S B;  4ECC A;  1R26 A;  4POB A;  4PNG A;  2MMA A;  2JSZ A;  1SL1 B;  3WGX A;  4HOJ A;  2P0G A;  2I9H A;  1Q98 A;  5CRG A;  2AB6 A;  2ALB A;  5DAK A;  1EEJ A;  1GTA A;  3KTL A;  5JCW A;  3MAK A;  5D96 A;  1PMT A;  5HR3 A;  5LNK e;  4AGS A;  1HQO A;  1RK4 A;  1GNE A;  4IP6 A;  1W89 A;  1G7E A;  3FMW A;  2RM5 A;  4KDY A;  3AY8 A;  4MZB A;  4TRX A;  2VLT A;  4K0N A;  4WR4 A;  2WFC A;  4GSN A;  3M0F A;  3KEB A;  4JR4 A;  3LWA A;  2C0D A;  2YOI A;  5CO3 A;  5KOX A;  1YKA A;  5DAL A;  1V40 A;  3ISO A;  2RUE A;  2X8H A;  2FWH A;  1ZMA A;  4O5U A;  3ZL5 A;  1SJI A;  4K7I A;  4N0Z A;  5EPF A;  4X0X A;  4EIQ A;  2V6K A;  1GTB A;  3CMI A;  1O6J A;  2K6V A;  4WKW A;  1K0B A;  5AIV A;  3LSZ A;  3P90 A;  2YP6 A;  5AIX A;  1GTU A;  4IGJ A;  2M46 A;  4J57 E;  3F4R A;  5F06 A;  2L4Q A;  2JZR A;  2L59 A;  3TKP A;  2G2Q A;  2H66 A;  3FEU A;  3Q18 A;  9GSS A;  1GSU A;  3QDN A;  1MD4 A;  1BED A;  1EGR A;  4Q5Q A;  2PWJ A;  3LYK A;  1U3I A;  2HE3 A;  1HYU A;  5BMU A;  1ZCP A;  2HYX A;  1WPI A;  1SKR B;  4HUA A;  4CHS A;  3FY7 A;  4F9Z A;  4HQS A;  3F6F A;  2KHP A;  2MMZ A;  4KF9 A;  1SYX A;  1SJZ A;  2HXK A;  4KSM A;  3TJB A;  1QUW A;  3KH9 A;  3C1S A;  4X1U A;  1WMJ A;  3FKF A;  3IK7 A;  4O5R A;  3TKQ A;  3IAM 2;  1K0A A;  2F9S A;  3DXB A;  1PX7 A;  3KH7 A;  4OCE A;  1SK1 A;  3ZMK A;  1C72 A;  2NDO A;  2DKI A;  5D93 A;  4RUV A;  2CQ9 A;  2GTU A;  4ZBA A;  2EIO A;  1EOH A;  1T00 A;  3WT2 A;  1GSQ A;  2B1L A;  2FNO A;  4FYC A;  4WF4 A;  1SJ6 A;  1Y25 A;  2DJK A;  3BCK A;  2AV4 A;  1K0M A;  2H72 A;  2H74 A;  1G7O A;  3KIJ A;  3IHG A;  3GTU B;  3ZZX A;  2BJX A;  3L4N A;  4QL7 A;  3TOU A;  4K7O A;  1X9M B;  1CQG A;  2NTO A;  2VCQ A;  1TJD A;  1T4Z A;  3HXS A;  3APS A;  3HVS A;  1B8X A;  3N5O A;  2LRT A;  4Q5F A;  4F82 A;  4KDU A;  2FGX A;  1GUL A;  3HZ8 A;  5J5N A;  2I4A A;  1Z7R A;  1GTI A;  1U87 A;  3MIX A;  3APO A;  4KAE A;  2C4J A;  4KE3 A;  3ZLP A;  3EU3 A;  5DJM A;  3I6A A;  4ZB9 A;  1O8W A;  1B48 A;  1GUH A;  1K3Y A;  1GSS A;  3ZIV A;  4D73 A;  2WZ9 A;  5HFK A;  4TKY A;  2YN1 A;  2IWT A;  2GDR A;  2NPB A;  4GQC A;  2F51 A;  5BRT A;  1G0T A;  1ST9 A;  1FW1 A;  3ZYW A;  3HKR A;  2XBQ A;  5AN1 A;  2VCW A;  3FRC A;  5KN1 A;  2M80 A;  1AUC A;  2JL4 A;  4BVY B;  4PGT A;  4QQ7 A;  2OAC A;  1AXD A;  5IO2 A;  1FVJ A;  4EL1 A;  3M9J A;  1CQH A;  5HQP A;  5CRD A;  1V57 A;  1FOH A;  2LJR A;  5KN3 A;  4BL7 B;  4TR0 A;  1ABA A;  3PH9 A;  4KGI A;  3VWX A;  4BPY A;  4ID0 A;  4XS4 B;  5ECQ B;  1A2L A;  4OFN A;  1H75 A;  2AUV A;  4ZIL A;  3FZ5 A;  3VWW A;  1VF4 A;  4NWY A;  1NHO A;  4NHZ A;  5A4W A;  2GSQ A;  3GX0 A;  3K8N A;  5D9W A;  2LNT A;  2RLI A;  1XVQ A;  2FWG A;  5EL8 A;  2EIQ A;  4MK3 A;  2WJU A;  1URM A;  2H19 A;  5DDL A;  2JZS A;  2B5X A;  4PQI A;  3TUE A;  4BVX A;  4OCF A;  1M2D A;  5D9T A;  1PL2 A;  1TRS A;  3DGQ A;  4G19 A;  2IMD A;  4I6X A;  3TDG A;  4G0L A;  3KJY A;  1XIY A;  5J41 A;  4IS0 A;  2HRF A;  1S3D A;  1M9A A;  4EDY A;  4EVM A;  2C3Q A;  3ZFL A;  1GSF A;  4FYB A;  4I5Q A;  4K2D A;  1R5A A;  3VK9 A;  4LMW A;  2YJH A;  1ZGN A;  4JR6 A;  3GKN A;  4GQF A;  4BA7 A;  4ZB8 A;  3MWH A;  3US3 A;  3APQ A;  3U6V A;  3R2Q A;  1SKW B;  1TKD B;  2VL2 C;  1X9W B;  1XXU A;  2X99 A;  4ECB A;  4JED A;  2L6D A;  5DCG A;  2L4C A;  1R7H A;  3IV4 A;  2PN8 A;  3FR6 A;  4HJM A;  1VRS D;  2ZCT A;  1GP1 A;  4TXO B;  2DJ0 A;  1E2Y A;  2H1G A;  2YZH A;  4G0K A;  2H1D A;  2LRN A;  2PVO C;  4ILF A;  2M72 A;  4HU7 A;  3IC8 A;  1AAZ A;  4GCI A;  3KXO A;  2H6Z A;  2GGT A;  2E0Q A;  1LJR A;  2C80 A;  4OO5 A;  4J56 E;  1O85 A;  1YQ1 A;  1FO5 A;  2JAD A;  4POL A;  1HNA A;  3SBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...